2RR4A

Complex structure of the zf-cw domain and the h3k4me3 peptide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zinc finger CW-type PWWP domain protein 1
publication title Structural insight into the zinc finger CW domain as a histone modification reader
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal-binding protein/nuclear protein
total genus 6
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2rr4A00
5SVIA 4Z0OA 5SVYA 2L7PA 5SVIB 2RR4A 4QQ4A 2E61A 4Z0RA 4O62A 5SVXA
chains in the Genus database with same CATH superfamily
3I2DA 4YC9A 2B0OE 2E6RA 2Y43A 2JRJA 2FD4A 4LK9A 2XOCA 4WZ0A 2KREA 4YAXA 2HDPA 2CRWA 2EA6A 2NAAA 4O64A 5LKUA 2ECGA 4WZ3B 2KU3A 3T7LA 2L0BA 4L7XA 2VPDA 1DCQA 1X4JA 4CA1A 4N3WA 1JM7B 2QICA 4QF2A 4C9ZA 5SVYA 1CHCA 2JUNA 4B7YC 2ECJA 2LQ6A 3LQJA 2YQLA 1WILA 5G04B 3LRQA 2D8SA 2KE1A 3DPLR 4X3GA 5AITA 5K3QA 2XEUA 4OGEA 4MSXA 1X4IA 4UP0A 3KDEC 5AIUA 2JM3A 2M3HA 2I50A 5J3XA 2CKLA 4R2YA 1WIMA 3ZNIA 4AP4A 1LDJB 2KWJA 5B75A 5H1TA 3SUBA 4I7DA 3FAOA 4W4UA 2YVRA 3LVQE 5D1KB 1Z6UA 2VJEB 3RTRB 2VPBA 5LKXA 2JMJA 1N87A 4BHWA 1VFYA 2FUIA 2VPGA 5D1MB 5KH9A 3EB5A 2FFWA 2MNYA 3LVRE 1JOCA 3IHPA 5EYAF 5I3LA 2UZGA 5B76A 3ZVYA 2L75A 3N9QA 2XOYA 5C13A 3Q1DA 3O33A 2KFTA 4LKAA 1HYIA 2H0DB 4AUQB 4N4FA 2XB1A 5SVIB 1MBMA 4R7EA 1FBVA 2D8UA 2YURA 2Y1NA 2P57A 3O70A 3L11A 2KGIA 2L43A 4AYCA 2PNXA 2CONA 2C2LA 4XI1A 5KH7A 2CSZA 4O62A 2LAUA 5LKTA 2YREA 3U5MA 3N9LA 3E2DA 4YBMA 1MM3A 3JUEA 4WA6A 5TDRA 2K4DA 2YYRA 2K16A 5H9MA 1WEVA 3NG2A 1BORA 2K1JA 3LQIA 3M7KA 1WEPA 2C2VS 2YU4A 2KGGA 4YBTA 5H1VA 2F42A 1VYXA 5TBNA 1F62A 2YHNA 3C5KA 2YSMA 4H9DA 3U5NA 1HYJA 2HYED 2M85A 1WESA 3DWDA 2YSJA 2G6QA 5FEYA 2ECTA 5B8DA 1WEQA 3O47A 4I7CA 5G05B 2KIZA 3SOWA 1WFKA 2EODA 3HTKC 2LRIC 2EGMA 2EGPA 2FSAA 3T6RA 3KQIA 1IYMA 3QZVA 2MNZA 5KH3A 2KYUA 2MD8C 1WENA 4BBQA 3RPGB 2VP7A 4L58A 5B78A 2VJFA 4F52B 2CKLB 2OXQC 2IQJA 2QJ0A 4TKPB 1WE9A 4B86C 5C11A 4NN2A 2CT2A 3KV5A 3N9PA 4FJCA 5TABA 4Z0RA 3FM8C 3DQVR 4GNDA 4UP5A 4ZQLA 4YABA 3RPGC 5D1LB 3O36A 4ZUXU 2LGKA 3VK6A 2LXHC 1ZBDB 3O37A 2MA5A 3PURA 4QF3A 2CSYA 3O35A 2MIQA 2PUYA 1LDKC 1FP0A 3M63A 2FUUA 5TDWA 2VJEA 4F1PA 1WEMA 2MA6A 2M6MA 3ZPV1 5G0FA 1XWHA 4AYCB 1K2FA 2DX8A 3KNVA 2F6JA 2KKYA 3FEHA 3O34A 4YATA 1WEUA 4IC3A 4S3OB 3HCSA 3M99A 2XOZA 2LGGA 2E61A 1V87A 3GV4A 3MHSA 2RI7A 2ECIA 4FK5A 2K17A 4PPEA 4V3LC 2BAYA 4A4CA 3LDYA 2ECVA 3C6WA 3PUQA 2KWNA 3T9KA 4GNEA 2LDRA 4PTBA 2JMDA 2DSMA 2KWOA 3N9MA 2L5UA 4P5OB 2ECWA 1WEOA 3ZTGA 2M13A 4FIPA 2KWKA 4S3OC 2VPEA 3U5PA 3ZYQA 2MKEA 4GNGA 2L7PA 1MM2A 3H7HA 4FO9A 3V43A 2MD7B 2MT5A 3DDTA 5DKAA 3ZPVE 3N9NA 4ZDTA 4A49A 5B77A 3M62A 4OGCA 5B79A 2ZETC 4A0CD 2RR4A 4I7BA 1G25A 2VNFA 2VJFB 2KKXA 2CRRA 2XP0A 3ASLA 4LADB 1JM7A 3MHHA 5DINA 2JMIA 4MVTA 2YQMA 3HCUA 2YW8A 2IDAA 3SHBA 3LQHA 2RSDA 3L1XA 1WEWA 2G43A 3SOUA 4UI9B 2LV9A 2MUMA 2ECNA 1U6GB 3O7AA 3LJUX 4YBSA 5LKZA 1T1HA 1Z60A 2E6SA 4V3KC 3FANA 5FB0A 1VD4A 2LN0A 5JG6A 2AN6A 2YT5A 3ZVZB 2DJAA 3MDBC 3PLWA 3EB6A 4YADA 4Z0OA 4A4BA 2QIZA 1DVPA 4LLBA 1RMDA 4CCGX 3GL6A 5SVXA 2G45A 2F6NA 1E4UA 4WZ2A 3PHDA 5LCWB 2YUCA 4AVXA 3L1ZB 4GB0A 4R8PK 2OWAA 1X4UA 1Z2QA 2L80A 2YHOA 2Y1MA 2LGVA 1WGMA 1WEEA 2M1RA 2LXPC 2H0DA 3SOXA 4IC2A 5FB1A 5H1UA 5SVIA 5TRBA 2LGLA 4GNFA 3N9OA 3FL2A 4QQ4A 2KR4A 5FERA 2EXUA 3HCTA 3KV6A 4Q6FA 2CSVA 3FJUB 3U5OA 4LJNA
chains in the Genus database with same CATH topology
2KKXA 4Z0OA 2L7PA 5SVIB 3JUEA 2CRRA 5K3QA 2B0OE 2XP0A 4OGEA 3LJUX 3O47A 3KDEC 3H7HA 2FD4A 2D8UA 2XOCA 5SVIA 3DDTA 5SVYA 2FFWA 2JM3A 2P57A 3LVRE 3LDYA 3M7KA 2CRWA 2JUNA 2KKYA 3FEHA 5SVXA 3T9KA 2IQJA 4OGCA 2CONA 3SUBA 2EGMA 4QQ4A 4O62A 4H9DA 2EXUA 2YVRA 2LAUA 2DJAA 3LVQE 2OWAA 2XOYA 2XOZA 2YREA 2M13A 2CSVA 3MDBC 3PLWA 2RR4A 3Q1DA 2E61A 4Z0RA 3FJUB 3DWDA 1DCQA 2MKEA 4F1PA 3FM8C 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI A;  4Z0O A;  5SVY A;  2L7P A;  5SVI B;  2RR4 A;  4QQ4 A;  2E61 A;  4Z0R A;  4O62 A;  5SVX A; 
#chains in the Genus database with same CATH topology
 3I2D A;  4YC9 A;  2B0O E;  2E6R A;  2Y43 A;  2JRJ A;  2FD4 A;  4LK9 A;  2XOC A;  4WZ0 A;  2KRE A;  4YAX A;  2HDP A;  2CRW A;  2EA6 A;  2NAA A;  4O64 A;  5LKU A;  2ECG A;  4WZ3 B;  2KU3 A;  3T7L A;  2L0B A;  4L7X A;  2VPD A;  1DCQ A;  1X4J A;  4CA1 A;  4N3W A;  1JM7 B;  2QIC A;  4QF2 A;  4C9Z A;  5SVY A;  1CHC A;  2JUN A;  4B7Y C;  2ECJ A;  2LQ6 A;  3LQJ A;  2YQL A;  1WIL A;  5G04 B;  3LRQ A;  2D8S A;  2KE1 A;  3DPL R;  4X3G A;  5AIT A;  5K3Q A;  2XEU A;  4OGE A;  4MSX A;  1X4I A;  4UP0 A;  3KDE C;  5AIU A;  2JM3 A;  2M3H A;  2I50 A;  5J3X A;  2CKL A;  4R2Y A;  1WIM A;  3ZNI A;  4AP4 A;  1LDJ B;  2KWJ A;  5B75 A;  5H1T A;  3SUB A;  4I7D A;  3FAO A;  4W4U A;  2YVR A;  3LVQ E;  5D1K B;  1Z6U A;  2VJE B;  3RTR B;  2VPB A;  5LKX A;  2JMJ A;  1N87 A;  4BHW A;  1VFY A;  2FUI A;  2VPG A;  5D1M B;  5KH9 A;  3EB5 A;  2FFW A;  2MNY A;  3LVR E;  1JOC A;  3IHP A;  5EYA F;  5I3L A;  2UZG A;  5B76 A;  3ZVY A;  2L75 A;  3N9Q A;  2XOY A;  5C13 A;  3Q1D A;  3O33 A;  2KFT A;  4LKA A;  1HYI A;  2H0D B;  4AUQ B;  4N4F A;  2XB1 A;  5SVI B;  1MBM A;  4R7E A;  1FBV A;  2D8U A;  2YUR A;  2Y1N A;  2P57 A;  3O70 A;  3L11 A;  2KGI A;  2L43 A;  4AYC A;  2PNX A;  2CON A;  2C2L A;  4XI1 A;  5KH7 A;  2CSZ A;  4O62 A;  2LAU A;  5LKT A;  2YRE A;  3U5M A;  3N9L A;  3E2D A;  4YBM A;  1MM3 A;  3JUE A;  4WA6 A;  5TDR A;  2K4D A;  2YYR A;  2K16 A;  5H9M A;  1WEV A;  3NG2 A;  1BOR A;  2K1J A;  3LQI A;  3M7K A;  1WEP A;  2C2V S;  2YU4 A;  2KGG A;  4YBT A;  5H1V A;  2F42 A;  1VYX A;  5TBN A;  1F62 A;  2YHN A;  3C5K A;  2YSM A;  4H9D A;  3U5N A;  1HYJ A;  2HYE D;  2M85 A;  1WES A;  3DWD A;  2YSJ A;  2G6Q A;  5FEY A;  2ECT A;  5B8D A;  1WEQ A;  3O47 A;  4I7C A;  5G05 B;  2KIZ A;  3SOW A;  1WFK A;  2EOD A;  3HTK C;  2LRI C;  2EGM A;  2EGP A;  2FSA A;  3T6R A;  3KQI A;  1IYM A;  3QZV A;  2MNZ A;  5KH3 A;  2KYU A;  2MD8 C;  1WEN A;  4BBQ A;  3RPG B;  2VP7 A;  4L58 A;  5B78 A;  2VJF A;  4F52 B;  2CKL B;  2OXQ C;  2IQJ A;  2QJ0 A;  4TKP B;  1WE9 A;  4B86 C;  5C11 A;  4NN2 A;  2CT2 A;  3KV5 A;  3N9P A;  4FJC A;  5TAB A;  4Z0R A;  3FM8 C;  3DQV R;  4GND A;  4UP5 A;  4ZQL A;  4YAB A;  3RPG C;  5D1L B;  3O36 A;  4ZUX U;  2LGK A;  3VK6 A;  2LXH C;  1ZBD B;  3O37 A;  2MA5 A;  3PUR A;  4QF3 A;  2CSY A;  3O35 A;  2MIQ A;  2PUY A;  1LDK C;  1FP0 A;  3M63 A;  2FUU A;  5TDW A;  2VJE A;  4F1P A;  1WEM A;  2MA6 A;  2M6M A;  3ZPV 1;  5G0F A;  1XWH A;  4AYC B;  1K2F A;  2DX8 A;  3KNV A;  2F6J A;  2KKY A;  3FEH A;  3O34 A;  4YAT A;  1WEU A;  4IC3 A;  4S3O B;  3HCS A;  3M99 A;  2XOZ A;  2LGG A;  2E61 A;  1V87 A;  3GV4 A;  3MHS A;  2RI7 A;  2ECI A;  4FK5 A;  2K17 A;  4PPE A;  4V3L C;  2BAY A;  4A4C A;  3LDY A;  2ECV A;  3C6W A;  3PUQ A;  2KWN A;  3T9K A;  4GNE A;  2LDR A;  4PTB A;  2JMD A;  2DSM A;  2KWO A;  3N9M A;  2L5U A;  4P5O B;  2ECW A;  1WEO A;  3ZTG A;  2M13 A;  4FIP A;  2KWK A;  4S3O C;  2VPE A;  3U5P A;  3ZYQ A;  2MKE A;  4GNG A;  2L7P A;  1MM2 A;  3H7H A;  4FO9 A;  3V43 A;  2MD7 B;  2MT5 A;  3DDT A;  5DKA A;  3ZPV E;  3N9N A;  4ZDT A;  4A49 A;  5B77 A;  3M62 A;  4OGC A;  5B79 A;  2ZET C;  4A0C D;  2RR4 A;  4I7B A;  1G25 A;  2VNF A;  2VJF B;  2KKX A;  2CRR A;  2XP0 A;  3ASL A;  4LAD B;  1JM7 A;  3MHH A;  5DIN A;  2JMI A;  4MVT A;  2YQM A;  3HCU A;  2YW8 A;  2IDA A;  3SHB A;  3LQH A;  2RSD A;  3L1X A;  1WEW A;  2G43 A;  3SOU A;  4UI9 B;  2LV9 A;  2MUM A;  2ECN A;  1U6G B;  3O7A A;  3LJU X;  4YBS A;  5LKZ A;  1T1H A;  1Z60 A;  2E6S A;  4V3K C;  3FAN A;  5FB0 A;  1VD4 A;  2LN0 A;  5JG6 A;  2AN6 A;  2YT5 A;  3ZVZ B;  2DJA A;  3MDB C;  3PLW A;  3EB6 A;  4YAD A;  4Z0O A;  4A4B A;  2QIZ A;  1DVP A;  4LLB A;  1RMD A;  4CCG X;  3GL6 A;  5SVX A;  2G45 A;  2F6N A;  1E4U A;  4WZ2 A;  3PHD A;  5LCW B;  2YUC A;  4AVX A;  3L1Z B;  4GB0 A;  4R8P K;  2OWA A;  1X4U A;  1Z2Q A;  2L80 A;  2YHO A;  2Y1M A;  2LGV A;  1WGM A;  1WEE A;  2M1R A;  2LXP C;  2H0D A;  3SOX A;  4IC2 A;  5FB1 A;  5H1U A;  5SVI A;  5TRB A;  2LGL A;  4GNF A;  3N9O A;  3FL2 A;  4QQ4 A;  2KR4 A;  5FER A;  2EXU A;  3HCT A;  3KV6 A;  4Q6F A;  2CSV A;  3FJU B;  3U5O A;  4LJN A; 
#chains in the Genus database with same CATH homology
 2KKX A;  4Z0O A;  2L7P A;  5SVI B;  3JUE A;  2CRR A;  5K3Q A;  2B0O E;  2XP0 A;  4OGE A;  3LJU X;  3O47 A;  3KDE C;  3H7H A;  2FD4 A;  2D8U A;  2XOC A;  5SVI A;  3DDT A;  5SVY A;  2FFW A;  2JM3 A;  2P57 A;  3LVR E;  3LDY A;  3M7K A;  2CRW A;  2JUN A;  2KKY A;  3FEH A;  5SVX A;  3T9K A;  2IQJ A;  4OGC A;  2CON A;  3SUB A;  2EGM A;  4QQ4 A;  4O62 A;  4H9D A;  2EXU A;  2YVR A;  2LAU A;  2DJA A;  3LVQ E;  2OWA A;  2XOY A;  2XOZ A;  2YRE A;  2M13 A;  2CSV A;  3MDB C;  3PLW A;  2RR4 A;  3Q1D A;  2E61 A;  4Z0R A;  3FJU B;  3DWD A;  1DCQ A;  2MKE A;  4F1P A;  3FM8 C;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...