2RR4A

Complex structure of the zf-cw domain and the h3k4me3 peptide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
69
structure length
69
Chain Sequence
GSSGSSGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal-binding protein/nuclear protein
molecule keywords Zinc finger CW-type PWWP domain protein 1
publication title Structural insight into the zinc finger CW domain as a histone modification reader
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2010-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2rr4A00
5SVIB 5SVIA 4Z0RA 2E61A 2L7PA 5SVXA 4QQ4A 4Z0OA 2RR4A 4O62A 5SVYA
chains in the Genus database with same CATH superfamily
3SOWA 2VNFA 4L7XA 5B76A 2MUMA 3C5KA 3RPGB 5J3XA 4FK5A 1LDKC 4YABA 1ZBDB 2JMDA 4V3KC 3N9PA 1JM7B 1WIMA 1WESA 2G45A 4ZQLA 3M63A 4LLBA 2XOYA 3DQVR 5TRBA 1LDJB 1VFYA 3ZNIA 4YBTA 2KREA 2E6RA 2KFTA 3C6WA 3IHPA 2LXPC 5B75A 2QJ0A 2E6SA 2F42A 3LQHA 2YHNA 1FBVA 2QIZA 5B79A 2VPBA 2K4DA 2F6NA 1JOCA 3SOUA 5FB0A 2MT5A 2C2LA 4YBSA 3LQIA 4WA6A 4ZUXU 4LADB 4LKAA 2RR4A 3EB5A 4N4FA 5B78A 3GL6A 4ZDTA 2YT5A 3FEHA 3JUEA 2H0DA 2KYUA 5JG6A 2MD8C 2MNZA 3FJUB 2LQ6A 2UZGA 2YVRA 2YW8A 2HDPA 4NN2A 4C9ZA 1DCQA 4UP0A 5D1KB 2XP0A 2M6MA 1IYMA 1F62A 3M62A 3MHSA 5LKUA 2FD4A 4PPEA 3FL2A 2ZETC 2XOZA 2YUCA 2MKEA 5TABA 2F6JA 1Z6UA 2VJFA 3ZVZB 5SVIA 3NG2A 2JM3A 1WEUA 5H1UA 2VJEB 3I2DA 5I3LA 5LCWB 4GB0A 3T6RA 2DSMA 2LGKA 1BORA 1WEMA 3KV6A 2YQLA 4W4UA 2PUYA 3LQJA 2YSJA 2RI7A 1MM2A 1XWHA 2EGPA 5AITA 4UI9B 5B77A 4X3GA 1U6GB 2MA6A 4IC3A 2YURA 2C2VS 4IC2A 2NAAA 3ZPVE 1MM3A 5TBNA 2VPDA 1WE9A 3FAOA 3ZPV1 4BHWA 2OWAA 2CKLA 4AVXA 4YBMA 2XEUA 2CRWA 4AYCA 4YADA 1X4IA 4WZ3B 1CHCA 3Q1DA 3E2DA 3L1ZB 5H1VA 3N9OA 3SUBA 2E61A 5G0FA 2KU3A 2K17A 3U5OA 1WEOA 2MNYA 4R7EA 2KKYA 2XB1A 3ZYQA 2YHOA 1DVPA 4A4BA 3N9QA 5FERA 1JM7A 2ECJA 2IDAA 3KNVA 4YATA 2KIZA 4AUQB 3FANA 5D1MB 1N87A 4GNGA 3SOXA 1WEEA 3O7AA 5G04B 4CA1A 2M85A 1Z2QA 4OGEA 5KH3A 4YAXA 3KDEC 2FUIA 3MDBC 2HYED 4R2YA 2EGMA 2LAUA 2LV9A 5H9MA 4GNDA 2LGVA 2JRJA 5G05B 3LRQA 1X4JA 2M13A 2MIQA 3T9KA 5KH7A 3O36A 4QQ4A 2JMJA 4A0CD 2L43A 2ECTA 1WGMA 1FP0A 3VK6A 2L75A 4LK9A 3O34A 5LKZA 2CSVA 5TDRA 4AP4A 2ECIA 3DWDA 1K2FA 5H1TA 4QF3A 4O62A 3O35A 3T7LA 3ZVYA 4S3OC 5EYAF 2G43A 2YYRA 3V43A 2LGGA 4UP5A 4N3WA 4Z0OA 3ASLA 2KWJA 4R8PK 3O47A 3EB6A 4F1PA 2B0OE 2DJAA 3U5MA 3PURA 2VJEA 2KE1A 3O33A 4BBQA 4I7DA 4PTBA 5FEYA 4B86C 2ECGA 1E4UA 3HCUA 2P57A 1RMDA 1HYJA 4S3OB 2K16A 2CT2A 2D8UA 4L58A 4GNFA 2ECWA 3KQIA 5DINA 2D8SA 4TKPB 2CRRA 4OGCA 5C13A 2LN0A 2VPEA 4F52B 4MVTA 3DDTA 3H7HA 3O70A 4I7CA 3LJUX 5D1LB 3N9MA 3RTRB 2I50A 2FUUA 2OXQC 3PUQA 1X4UA 1WFKA 5AIUA 5C11A 2K1JA 2FSAA 4CCGX 4XI1A 2DX8A 3PLWA 3SHBA 3M99A 4A49A 2H0DB 2YREA 4I7BA 2KR4A 4V3LC 2CONA 2L0BA 3N9NA 2BAYA 2L80A 2XOCA 1WEWA 2ECNA 5LKTA 4YC9A 3ZTGA 4MSXA 5KH9A 5SVXA 1T1HA 1HYIA 2YU4A 3U5NA 2FFWA 2IQJA 2YSMA 1WILA 3U5PA 3HCSA 2VJFB 5SVIB 2L5UA 2Y43A 2EA6A 2AN6A 1VD4A 2RSDA 2EXUA 3DPLR 1WEVA 2KKXA 3HTKC 4FIPA 1WEPA 3FM8C 5TDWA 3LVRE 1WENA 2LDRA 3PHDA 3L1XA 2KGIA 2CSZA 2QICA 1Z60A 3KV5A 2MA5A 3MHHA 1V87A 2VP7A 4H9DA 2JUNA 5SVYA 5B8DA 3LDYA 4QF2A 2LRIC 4WZ0A 3L11A 5DKAA 2G6QA 3LVQE 2ECVA 3RPGC 2KWOA 2YQMA 4LJNA 3GV4A 3O37A 4B7YC 2CKLB 2M3HA 1G25A 2CSYA 2VPGA 3N9LA 4AYCB 4FJCA 3M7KA 2L7PA 1MBMA 2LXHC 2PNXA 2KWNA 1VYXA 5LKXA 2Y1MA 2KGGA 2M1RA 2JMIA 5FB1A 2KWKA 4A4CA 5K3QA 2LGLA 4Z0RA 4O64A 3HCTA 2EODA 4Q6FA 1WEQA 2Y1NA 3QZVA 4WZ2A 2MD7B 4GNEA 4FO9A 4P5OB
chains in the Genus database with same CATH topology
2DJAA 2XP0A 2YREA 3SUBA 3M7KA 2E61A 2L7PA 2CRRA 3PLWA 4OGCA 2OWAA 5SVYA 4H9DA 2CONA 2FD4A 2JUNA 5SVIB 3LDYA 2M13A 3T9KA 3FEHA 2XOZA 2CRWA 2MKEA 2XOCA 3JUEA 2P57A 4QQ4A 2EXUA 3DDTA 2KKXA 3H7HA 4Z0OA 3Q1DA 2KKYA 3FJUB 3LJUX 4OGEA 3FM8C 5K3QA 5SVIA 3LVQE 2XOYA 2YVRA 3LVRE 2JM3A 4Z0RA 5SVXA 3E2DA 3KDEC 2D8UA 1DCQA 2CSVA 2FFWA 3MDBC 3DWDA 3O47A 2IQJA 2EGMA 4F1PA 2LAUA 2RR4A 4O62A 2B0OE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI B;  5SVI A;  4Z0R A;  2E61 A;  2L7P A;  5SVX A;  4QQ4 A;  4Z0O A;  2RR4 A;  4O62 A;  5SVY A; 
#chains in the Genus database with same CATH topology
 3SOW A;  2VNF A;  4L7X A;  5B76 A;  2MUM A;  3C5K A;  3RPG B;  5J3X A;  4FK5 A;  1LDK C;  4YAB A;  1ZBD B;  2JMD A;  4V3K C;  3N9P A;  1JM7 B;  1WIM A;  1WES A;  2G45 A;  4ZQL A;  3M63 A;  4LLB A;  2XOY A;  3DQV R;  5TRB A;  1LDJ B;  1VFY A;  3ZNI A;  4YBT A;  2KRE A;  2E6R A;  2KFT A;  3C6W A;  3IHP A;  2LXP C;  5B75 A;  2QJ0 A;  2E6S A;  2F42 A;  3LQH A;  2YHN A;  1FBV A;  2QIZ A;  5B79 A;  2VPB A;  2K4D A;  2F6N A;  1JOC A;  3SOU A;  5FB0 A;  2MT5 A;  2C2L A;  4YBS A;  3LQI A;  4WA6 A;  4ZUX U;  4LAD B;  4LKA A;  2RR4 A;  3EB5 A;  4N4F A;  5B78 A;  3GL6 A;  4ZDT A;  2YT5 A;  3FEH A;  3JUE A;  2H0D A;  2KYU A;  5JG6 A;  2MD8 C;  2MNZ A;  3FJU B;  2LQ6 A;  2UZG A;  2YVR A;  2YW8 A;  2HDP A;  4NN2 A;  4C9Z A;  1DCQ A;  4UP0 A;  5D1K B;  2XP0 A;  2M6M A;  1IYM A;  1F62 A;  3M62 A;  3MHS A;  5LKU A;  2FD4 A;  4PPE A;  3FL2 A;  2ZET C;  2XOZ A;  2YUC A;  2MKE A;  5TAB A;  2F6J A;  1Z6U A;  2VJF A;  3ZVZ B;  5SVI A;  3NG2 A;  2JM3 A;  1WEU A;  5H1U A;  2VJE B;  3I2D A;  5I3L A;  5LCW B;  4GB0 A;  3T6R A;  2DSM A;  2LGK A;  1BOR A;  1WEM A;  3KV6 A;  2YQL A;  4W4U A;  2PUY A;  3LQJ A;  2YSJ A;  2RI7 A;  1MM2 A;  1XWH A;  2EGP A;  5AIT A;  4UI9 B;  5B77 A;  4X3G A;  1U6G B;  2MA6 A;  4IC3 A;  2YUR A;  2C2V S;  4IC2 A;  2NAA A;  3ZPV E;  1MM3 A;  5TBN A;  2VPD A;  1WE9 A;  3FAO A;  3ZPV 1;  4BHW A;  2OWA A;  2CKL A;  4AVX A;  4YBM A;  2XEU A;  2CRW A;  4AYC A;  4YAD A;  1X4I A;  4WZ3 B;  1CHC A;  3Q1D A;  3E2D A;  3L1Z B;  5H1V A;  3N9O A;  3SUB A;  2E61 A;  5G0F A;  2KU3 A;  2K17 A;  3U5O A;  1WEO A;  2MNY A;  4R7E A;  2KKY A;  2XB1 A;  3ZYQ A;  2YHO A;  1DVP A;  4A4B A;  3N9Q A;  5FER A;  1JM7 A;  2ECJ A;  2IDA A;  3KNV A;  4YAT A;  2KIZ A;  4AUQ B;  3FAN A;  5D1M B;  1N87 A;  4GNG A;  3SOX A;  1WEE A;  3O7A A;  5G04 B;  4CA1 A;  2M85 A;  1Z2Q A;  4OGE A;  5KH3 A;  4YAX A;  3KDE C;  2FUI A;  3MDB C;  2HYE D;  4R2Y A;  2EGM A;  2LAU A;  2LV9 A;  5H9M A;  4GND A;  2LGV A;  2JRJ A;  5G05 B;  3LRQ A;  1X4J A;  2M13 A;  2MIQ A;  3T9K A;  5KH7 A;  3O36 A;  4QQ4 A;  2JMJ A;  4A0C D;  2L43 A;  2ECT A;  1WGM A;  1FP0 A;  3VK6 A;  2L75 A;  4LK9 A;  3O34 A;  5LKZ A;  2CSV A;  5TDR A;  4AP4 A;  2ECI A;  3DWD A;  1K2F A;  5H1T A;  4QF3 A;  4O62 A;  3O35 A;  3T7L A;  3ZVY A;  4S3O C;  5EYA F;  2G43 A;  2YYR A;  3V43 A;  2LGG A;  4UP5 A;  4N3W A;  4Z0O A;  3ASL A;  2KWJ A;  4R8P K;  3O47 A;  3EB6 A;  4F1P A;  2B0O E;  2DJA A;  3U5M A;  3PUR A;  2VJE A;  2KE1 A;  3O33 A;  4BBQ A;  4I7D A;  4PTB A;  5FEY A;  4B86 C;  2ECG A;  1E4U A;  3HCU A;  2P57 A;  1RMD A;  1HYJ A;  4S3O B;  2K16 A;  2CT2 A;  2D8U A;  4L58 A;  4GNF A;  2ECW A;  3KQI A;  5DIN A;  2D8S A;  4TKP B;  2CRR A;  4OGC A;  5C13 A;  2LN0 A;  2VPE A;  4F52 B;  4MVT A;  3DDT A;  3H7H A;  3O70 A;  4I7C A;  3LJU X;  5D1L B;  3N9M A;  3RTR B;  2I50 A;  2FUU A;  2OXQ C;  3PUQ A;  1X4U A;  1WFK A;  5AIU A;  5C11 A;  2K1J A;  2FSA A;  4CCG X;  4XI1 A;  2DX8 A;  3PLW A;  3SHB A;  3M99 A;  4A49 A;  2H0D B;  2YRE A;  4I7B A;  2KR4 A;  4V3L C;  2CON A;  2L0B A;  3N9N A;  2BAY A;  2L80 A;  2XOC A;  1WEW A;  2ECN A;  5LKT A;  4YC9 A;  3ZTG A;  4MSX A;  5KH9 A;  5SVX A;  1T1H A;  1HYI A;  2YU4 A;  3U5N A;  2FFW A;  2IQJ A;  2YSM A;  1WIL A;  3U5P A;  3HCS A;  2VJF B;  5SVI B;  2L5U A;  2Y43 A;  2EA6 A;  2AN6 A;  1VD4 A;  2RSD A;  2EXU A;  3DPL R;  1WEV A;  2KKX A;  3HTK C;  4FIP A;  1WEP A;  3FM8 C;  5TDW A;  3LVR E;  1WEN A;  2LDR A;  3PHD A;  3L1X A;  2KGI A;  2CSZ A;  2QIC A;  1Z60 A;  3KV5 A;  2MA5 A;  3MHH A;  1V87 A;  2VP7 A;  4H9D A;  2JUN A;  5SVY A;  5B8D A;  3LDY A;  4QF2 A;  2LRI C;  4WZ0 A;  3L11 A;  5DKA A;  2G6Q A;  3LVQ E;  2ECV A;  3RPG C;  2KWO A;  2YQM A;  4LJN A;  3GV4 A;  3O37 A;  4B7Y C;  2CKL B;  2M3H A;  1G25 A;  2CSY A;  2VPG A;  3N9L A;  4AYC B;  4FJC A;  3M7K A;  2L7P A;  1MBM A;  2LXH C;  2PNX A;  2KWN A;  1VYX A;  5LKX A;  2Y1M A;  2KGG A;  2M1R A;  2JMI A;  5FB1 A;  2KWK A;  4A4C A;  5K3Q A;  2LGL A;  4Z0R A;  4O64 A;  3HCT A;  2EOD A;  4Q6F A;  1WEQ A;  2Y1N A;  3QZV A;  4WZ2 A;  2MD7 B;  4GNE A;  4FO9 A;  4P5O B; 
#chains in the Genus database with same CATH homology
 2DJA A;  2XP0 A;  2YRE A;  3SUB A;  3M7K A;  2E61 A;  2L7P A;  2CRR A;  3PLW A;  4OGC A;  2OWA A;  5SVY A;  4H9D A;  2CON A;  2FD4 A;  2JUN A;  5SVI B;  3LDY A;  2M13 A;  3T9K A;  3FEH A;  2XOZ A;  2CRW A;  2MKE A;  2XOC A;  3JUE A;  2P57 A;  4QQ4 A;  2EXU A;  3DDT A;  2KKX A;  3H7H A;  4Z0O A;  3Q1D A;  2KKY A;  3FJU B;  3LJU X;  4OGE A;  3FM8 C;  5K3Q A;  5SVI A;  3LVQ E;  2XOY A;  2YVR A;  3LVR E;  2JM3 A;  4Z0R A;  5SVX A;  3E2D A;  3KDE C;  2D8U A;  1DCQ A;  2CSV A;  2FFW A;  3MDB C;  3DWD A;  3O47 A;  2IQJ A;  2EGM A;  4F1P A;  2LAU A;  2RR4 A;  4O62 A;  2B0O E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...