5SVYA

Morc3 cw in complex with histone h3k4me1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svyA00
4O62A 5SVXA 5SVIA 2E61A 4Z0OA 2L7PA 5SVYA 2RR4A 5SVIB 4Z0RA 4QQ4A
chains in the Genus database with same CATH superfamily
4LLBA 5LKZA 1K2FA 1JOCA 4LKAA 2YHNA 2MIQA 2M1RA 3FANA 2YURA 3ZVYA 3FAOA 2KWKA 2YU4A 2C2LA 3N9OA 4IC2A 2I50A 4V3KC 2JRJA 5K3QA 3ASLA 2MA6A 3KV6A 5B8DA 2KWJA 4GNDA 3ZYQA 1XWHA 2ECWA 5B75A 2JM3A 5FERA 1X4JA 5D1MB 4YBSA 2FFWA 1WE9A 1Z2QA 1WIMA 2EXUA 3ZTGA 3DWDA 3SUBA 3VK6A 2VJEB 4I7DA 4Q6FA 3N9PA 2DSMA 2FD4A 3U5PA 2E61A 2DX8A 4QQ4A 3LQIA 2P57A 5AITA 1E4UA 4MSXA 2D8UA 2OXQC 4AUQB 1WGMA 3SOWA 1MM3A 2XOCA 2EGMA 2ECJA 3HCTA 2C2VS 5TABA 2KIZA 2YREA 4GNGA 4A4BA 2M85A 3LVRE 1WEUA 4TKPB 3V43A 3M99A 1F62A 1VD4A 2MT5A 2KKYA 4P5OB 2NAAA 2LQ6A 4N4FA 2KR4A 4AYCA 5B79A 2CKLB 2G45A 4ZQLA 4YAXA 2VPDA 3LRQA 5H1UA 4FIPA 4BBQA 3DPLR 2L80A 3N9QA 4A49A 3H7HA 3U5OA 1WENA 2LRIC 1LDKC 2LGLA 2QJ0A 4Z0OA 5G0FA 1HYJA 2M13A 2L0BA 3KDEC 2Y1NA 2KFTA 1N87A 4YBTA 4BHWA 5H9MA 4MVTA 3T9KA 3C6WA 4WA6A 2XOYA 3FL2A 5DKAA 4QF2A 5AIUA 3O35A 3L1ZB 2E6SA 1JM7A 2VPEA 2BAYA 2OWAA 3N9LA 3LJUX 1LDJB 3T6RA 2CRRA 4UP5A 5D1LB 5LKUA 4R8PK 4IC3A 3IHPA 2CSVA 4O64A 2HDPA 3ZPV1 4X3GA 5DINA 2YSJA 4WZ3B 1FP0A 5B76A 2Y43A 4QF3A 3LQJA 4R2YA 2K4DA 4LADB 5LCWB 2VPGA 2VJFB 5SVIB 2H0DB 5C11A 1DVPA 1ZBDB 3SOXA 2DJAA 2VNFA 2FUUA 2QICA 4FK5A 1T1HA 2KGGA 4ZUXU 4YABA 2YQMA 5EYAF 2FUIA 2ECNA 3N9NA 4L58A 3E2DA 2MA5A 5H1VA 3O37A 3C5KA 2F6JA 5FEYA 3GL6A 2IDAA 2MD8C 5FB1A 3LVQE 2YHOA 2LXHC 2JMDA 2ZETC 3HCSA 1HYIA 1WEVA 2CRWA 3QZVA 3FEHA 3MHSA 2IQJA 5SVXA 4FJCA 4A0CD 3DQVR 5G05B 4OGCA 1RMDA 1WFKA 1G25A 4UI9B 1BORA 2D8SA 2L5UA 3SOUA 4PTBA 5B78A 1DCQA 2LXPC 5LKTA 2QIZA 2ECGA 3MHHA 3T7LA 4PPEA 2CT2A 4WZ2A 4F52B 1WESA 2JUNA 4F1PA 4H9DA 3O47A 4Z0RA 4S3OB 4O62A 2F42A 3KQIA 2Y1MA 3M7KA 5J3XA 4YATA 2L43A 2F6NA 3SHBA 3ZPVE 2RSDA 2B0OE 2VJFA 1Z6UA 2H0DA 2RI7A 2KE1A 4I7CA 3FJUB 1V87A 3HTKC 2M6MA 1VFYA 2YQLA 3U5NA 2VJEA 5B77A 2PUYA 2FSAA 2YVRA 2LN0A 2ECIA 3PHDA 2JMIA 4YC9A 2E6RA 3PURA 4S3OC 2EGPA 4GNFA 5H1TA 2KREA 2M3HA 1IYMA 3FM8C 2KKXA 5I3LA 2YYRA 4N3WA 2G43A 3RPGB 3ZNIA 2UZGA 2LGGA 4UP0A 2KYUA 4V3LC 4XI1A 3LDYA 1CHCA 2CKLA 2KU3A 2HYED 3M62A 4W4UA 1JM7B 3O7AA 3O70A 2PNXA 1MM2A 4YADA 4AVXA 2MNZA 4YBMA 3Q1DA 3I2DA 5FB0A 4CA1A 5KH7A 2KWOA 5SVYA 1MBMA 4WZ0A 2CSYA 2CSZA 2CONA 3LQHA 3EB6A 2LV9A 1WEEA 3PLWA 1WEQA 4C9ZA 4A4CA 2RR4A 4B7YC 2YW8A 3RPGC 2JMJA 2VP7A 2KWNA 2XP0A 4L7XA 3O34A 4LJNA 2EA6A 4LK9A 5KH3A 4AP4A 2LAUA 3KNVA 5TBNA 2ECVA 5TDWA 1WEPA 4FO9A 2XB1A 4R7EA 5JG6A 2VPBA 1WEWA 2G6QA 2K16A 3O36A 1WEOA 4CCGX 2EODA 2LGKA 2LGVA 3L11A 2ECTA 2L75A 1U6GB 2L7PA 2LDRA 5C13A 5D1KB 5TRBA 3L1XA 3HCUA 1FBVA 2MUMA 3MDBC 1VYXA 3NG2A 2K17A 4OGEA 5SVIA 3JUEA 3DDTA 3PUQA 4GNEA 2AN6A 5G04B 3RTRB 3KV5A 4NN2A 1X4IA 1X4UA 3ZVZB 2XOZA 2YUCA 2KGIA 2MKEA 2YT5A 3GV4A 3M63A 1Z60A 3EB5A 3O33A 5LKXA 4GB0A 4AYCB 3N9MA 4ZDTA 2MNYA 2XEUA 5KH9A 5TDRA 3U5MA 2MD7B 2K1JA 1WEMA 4I7BA 1WILA 2YSMA 4B86C
chains in the Genus database with same CATH topology
2JUNA 2IQJA 3KDEC 5SVXA 2P57A 2CRRA 3FJUB 4F1PA 2KKYA 2D8UA 2XOZA 2RR4A 3O47A 2JM3A 4H9DA 5SVIB 3T9KA 4Z0RA 3E2DA 2MKEA 4O62A 4OGCA 2XP0A 2CSVA 2FFWA 2L7PA 3FM8C 2KKXA 2EXUA 2XOCA 3Q1DA 2EGMA 3M7KA 2XOYA 2DJAA 2YREA 2LAUA 2YVRA 3DWDA 3SUBA 5SVYA 3H7HA 1DCQA 3LVRE 3LVQE 3MDBC 2B0OE 4OGEA 2FD4A 5K3QA 5SVIA 2E61A 2CONA 4Z0OA 3JUEA 3DDTA 2CRWA 2M13A 2OWAA 3LJUX 3LDYA 4QQ4A 3FEHA 3PLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O62 A;  5SVX A;  5SVI A;  2E61 A;  4Z0O A;  2L7P A;  5SVY A;  2RR4 A;  5SVI B;  4Z0R A;  4QQ4 A; 
#chains in the Genus database with same CATH topology
 4LLB A;  5LKZ A;  1K2F A;  1JOC A;  4LKA A;  2YHN A;  2MIQ A;  2M1R A;  3FAN A;  2YUR A;  3ZVY A;  3FAO A;  2KWK A;  2YU4 A;  2C2L A;  3N9O A;  4IC2 A;  2I50 A;  4V3K C;  2JRJ A;  5K3Q A;  3ASL A;  2MA6 A;  3KV6 A;  5B8D A;  2KWJ A;  4GND A;  3ZYQ A;  1XWH A;  2ECW A;  5B75 A;  2JM3 A;  5FER A;  1X4J A;  5D1M B;  4YBS A;  2FFW A;  1WE9 A;  1Z2Q A;  1WIM A;  2EXU A;  3ZTG A;  3DWD A;  3SUB A;  3VK6 A;  2VJE B;  4I7D A;  4Q6F A;  3N9P A;  2DSM A;  2FD4 A;  3U5P A;  2E61 A;  2DX8 A;  4QQ4 A;  3LQI A;  2P57 A;  5AIT A;  1E4U A;  4MSX A;  2D8U A;  2OXQ C;  4AUQ B;  1WGM A;  3SOW A;  1MM3 A;  2XOC A;  2EGM A;  2ECJ A;  3HCT A;  2C2V S;  5TAB A;  2KIZ A;  2YRE A;  4GNG A;  4A4B A;  2M85 A;  3LVR E;  1WEU A;  4TKP B;  3V43 A;  3M99 A;  1F62 A;  1VD4 A;  2MT5 A;  2KKY A;  4P5O B;  2NAA A;  2LQ6 A;  4N4F A;  2KR4 A;  4AYC A;  5B79 A;  2CKL B;  2G45 A;  4ZQL A;  4YAX A;  2VPD A;  3LRQ A;  5H1U A;  4FIP A;  4BBQ A;  3DPL R;  2L80 A;  3N9Q A;  4A49 A;  3H7H A;  3U5O A;  1WEN A;  2LRI C;  1LDK C;  2LGL A;  2QJ0 A;  4Z0O A;  5G0F A;  1HYJ A;  2M13 A;  2L0B A;  3KDE C;  2Y1N A;  2KFT A;  1N87 A;  4YBT A;  4BHW A;  5H9M A;  4MVT A;  3T9K A;  3C6W A;  4WA6 A;  2XOY A;  3FL2 A;  5DKA A;  4QF2 A;  5AIU A;  3O35 A;  3L1Z B;  2E6S A;  1JM7 A;  2VPE A;  2BAY A;  2OWA A;  3N9L A;  3LJU X;  1LDJ B;  3T6R A;  2CRR A;  4UP5 A;  5D1L B;  5LKU A;  4R8P K;  4IC3 A;  3IHP A;  2CSV A;  4O64 A;  2HDP A;  3ZPV 1;  4X3G A;  5DIN A;  2YSJ A;  4WZ3 B;  1FP0 A;  5B76 A;  2Y43 A;  4QF3 A;  3LQJ A;  4R2Y A;  2K4D A;  4LAD B;  5LCW B;  2VPG A;  2VJF B;  5SVI B;  2H0D B;  5C11 A;  1DVP A;  1ZBD B;  3SOX A;  2DJA A;  2VNF A;  2FUU A;  2QIC A;  4FK5 A;  1T1H A;  2KGG A;  4ZUX U;  4YAB A;  2YQM A;  5EYA F;  2FUI A;  2ECN A;  3N9N A;  4L58 A;  3E2D A;  2MA5 A;  5H1V A;  3O37 A;  3C5K A;  2F6J A;  5FEY A;  3GL6 A;  2IDA A;  2MD8 C;  5FB1 A;  3LVQ E;  2YHO A;  2LXH C;  2JMD A;  2ZET C;  3HCS A;  1HYI A;  1WEV A;  2CRW A;  3QZV A;  3FEH A;  3MHS A;  2IQJ A;  5SVX A;  4FJC A;  4A0C D;  3DQV R;  5G05 B;  4OGC A;  1RMD A;  1WFK A;  1G25 A;  4UI9 B;  1BOR A;  2D8S A;  2L5U A;  3SOU A;  4PTB A;  5B78 A;  1DCQ A;  2LXP C;  5LKT A;  2QIZ A;  2ECG A;  3MHH A;  3T7L A;  4PPE A;  2CT2 A;  4WZ2 A;  4F52 B;  1WES A;  2JUN A;  4F1P A;  4H9D A;  3O47 A;  4Z0R A;  4S3O B;  4O62 A;  2F42 A;  3KQI A;  2Y1M A;  3M7K A;  5J3X A;  4YAT A;  2L43 A;  2F6N A;  3SHB A;  3ZPV E;  2RSD A;  2B0O E;  2VJF A;  1Z6U A;  2H0D A;  2RI7 A;  2KE1 A;  4I7C A;  3FJU B;  1V87 A;  3HTK C;  2M6M A;  1VFY A;  2YQL A;  3U5N A;  2VJE A;  5B77 A;  2PUY A;  2FSA A;  2YVR A;  2LN0 A;  2ECI A;  3PHD A;  2JMI A;  4YC9 A;  2E6R A;  3PUR A;  4S3O C;  2EGP A;  4GNF A;  5H1T A;  2KRE A;  2M3H A;  1IYM A;  3FM8 C;  2KKX A;  5I3L A;  2YYR A;  4N3W A;  2G43 A;  3RPG B;  3ZNI A;  2UZG A;  2LGG A;  4UP0 A;  2KYU A;  4V3L C;  4XI1 A;  3LDY A;  1CHC A;  2CKL A;  2KU3 A;  2HYE D;  3M62 A;  4W4U A;  1JM7 B;  3O7A A;  3O70 A;  2PNX A;  1MM2 A;  4YAD A;  4AVX A;  2MNZ A;  4YBM A;  3Q1D A;  3I2D A;  5FB0 A;  4CA1 A;  5KH7 A;  2KWO A;  5SVY A;  1MBM A;  4WZ0 A;  2CSY A;  2CSZ A;  2CON A;  3LQH A;  3EB6 A;  2LV9 A;  1WEE A;  3PLW A;  1WEQ A;  4C9Z A;  4A4C A;  2RR4 A;  4B7Y C;  2YW8 A;  3RPG C;  2JMJ A;  2VP7 A;  2KWN A;  2XP0 A;  4L7X A;  3O34 A;  4LJN A;  2EA6 A;  4LK9 A;  5KH3 A;  4AP4 A;  2LAU A;  3KNV A;  5TBN A;  2ECV A;  5TDW A;  1WEP A;  4FO9 A;  2XB1 A;  4R7E A;  5JG6 A;  2VPB A;  1WEW A;  2G6Q A;  2K16 A;  3O36 A;  1WEO A;  4CCG X;  2EOD A;  2LGK A;  2LGV A;  3L11 A;  2ECT A;  2L75 A;  1U6G B;  2L7P A;  2LDR A;  5C13 A;  5D1K B;  5TRB A;  3L1X A;  3HCU A;  1FBV A;  2MUM A;  3MDB C;  1VYX A;  3NG2 A;  2K17 A;  4OGE A;  5SVI A;  3JUE A;  3DDT A;  3PUQ A;  4GNE A;  2AN6 A;  5G04 B;  3RTR B;  3KV5 A;  4NN2 A;  1X4I A;  1X4U A;  3ZVZ B;  2XOZ A;  2YUC A;  2KGI A;  2MKE A;  2YT5 A;  3GV4 A;  3M63 A;  1Z60 A;  3EB5 A;  3O33 A;  5LKX A;  4GB0 A;  4AYC B;  3N9M A;  4ZDT A;  2MNY A;  2XEU A;  5KH9 A;  5TDR A;  3U5M A;  2MD7 B;  2K1J A;  1WEM A;  4I7B A;  1WIL A;  2YSM A;  4B86 C; 
#chains in the Genus database with same CATH homology
 2JUN A;  2IQJ A;  3KDE C;  5SVX A;  2P57 A;  2CRR A;  3FJU B;  4F1P A;  2KKY A;  2D8U A;  2XOZ A;  2RR4 A;  3O47 A;  2JM3 A;  4H9D A;  5SVI B;  3T9K A;  4Z0R A;  3E2D A;  2MKE A;  4O62 A;  4OGC A;  2XP0 A;  2CSV A;  2FFW A;  2L7P A;  3FM8 C;  2KKX A;  2EXU A;  2XOC A;  3Q1D A;  2EGM A;  3M7K A;  2XOY A;  2DJA A;  2YRE A;  2LAU A;  2YVR A;  3DWD A;  3SUB A;  5SVY A;  3H7H A;  1DCQ A;  3LVR E;  3LVQ E;  3MDB C;  2B0O E;  4OGE A;  2FD4 A;  5K3Q A;  5SVI A;  2E61 A;  2CON A;  4Z0O A;  3JUE A;  3DDT A;  2CRW A;  2M13 A;  2OWA A;  3LJU X;  3LDY A;  4QQ4 A;  3FEH A;  3PLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...