5SVYA

Morc3 cw in complex with histone h3k4me1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
b'SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svyA00
4Z0OA 4Z0RA 5SVIB 2L7PA 5SVXA 5SVIA 4QQ4A 4O62A 2E61A 5SVYA 2RR4A
chains in the Genus database with same CATH superfamily
2CSZA 2KGGA 4FO9A 2IQJA 2H0DA 3LRQA 4YBMA 3U5MA 4LKAA 2Y43A 4IC3A 5LCWB 2LQ6A 1WEOA 2VPBA 1WEMA 2CSYA 2ECGA 2MNYA 3U5OA 2MA6A 3C6WA 4YC9A 2JMDA 2MUMA 4ZDTA 4GNDA 4TKPB 3ZPV1 2ECJA 4AYCA 3ZNIA 3N9PA 5FB0A 5TBNA 3C5KA 2NAAA 2LV9A 2CRRA 2EODA 5C11A 3HCUA 2M13A 2MIQA 4B7YC 1WESA 2MNZA 4I7DA 2ZETC 5KH9A 2MT5A 1Z2QA 2XOYA 3PUQA 2MD8C 2HDPA 2FSAA 3RTRB 1HYJA 2KREA 1XWHA 2YHNA 2YQLA 4N3WA 1VYXA 5G04B 2K1JA 2YURA 4I7CA 2RI7A 2LXPC 4XI1A 2MA5A 2JM3A 1WGMA 4Z0RA 2JRJA 2KFTA 4F52B 3ASLA 2C2LA 2D8SA 2E6RA 4V3LC 2L43A 4AVXA 4L7XA 3E2DA 4ZQLA 3M62A 1X4JA 1JM7A 2VNFA 3FAOA 4A0CD 3N9NA 4H9DA 4A4BA 3M63A 1VFYA 4YBTA 1LDJB 1HYIA 4B86C 4QF2A 4QQ4A 2VJFA 2YQMA 2M3HA 5I3LA 1CHCA 2E61A 2E6SA 2L5UA 3MHHA 2I50A 2L75A 3FM8C 4C9ZA 4UP5A 4BHWA 5SVXA 1ZBDB 2UZGA 5AITA 4BBQA 3L1XA 3DQVR 4CA1A 4YATA 2ECIA 2CONA 4V3KC 5G05B 2LRIC 2M1RA 2C2VS 1WEQA 5TDRA 5D1MB 5TRBA 2LGLA 3SUBA 4OGCA 3SOUA 1WEEA 3LVQE 3PHDA 5B77A 3O37A 3N9MA 3MDBC 5H1TA 2LXHC 4LK9A 4P5OB 1RMDA 3H7HA 3O33A 2LDRA 2H0DB 2K16A 2CT2A 2CKLA 3HTKC 2L7PA 2B0OE 2F42A 1WILA 4FJCA 2LAUA 2DX8A 4GNEA 5EYAF 3DWDA 5G0FA 3ZVYA 2P57A 4AYCB 1G25A 2EGMA 2K17A 4PTBA 4GNFA 3FL2A 2DJAA 1WEWA 1WEUA 2RR4A 3RPGC 1T1HA 5FEYA 3PLWA 4O64A 3N9QA 4YBSA 3KV6A 2EGPA 2G43A 5J3XA 2FUUA 2BAYA 2KR4A 1FP0A 2KYUA 2YU4A 5H1UA 2KWNA 2LGVA 2EXUA 2L0BA 2LGGA 5LKZA 4CCGX 4WZ2A 3NG2A 4YADA 3VK6A 2VP7A 2YSMA 4ZUXU 2F6JA 2QIZA 3T9KA 4N4FA 4AP4A 4L58A 3T7LA 5SVIA 4YAXA 2G45A 3JUEA 3LVRE 2XOCA 1IYMA 1JM7B 4MVTA 3QZVA 4LLBA 2VPDA 4Z0OA 3N9OA 3KV5A 2FD4A 4IC2A 3ZTGA 3FEHA 3T6RA 5LKTA 4UP0A 2VJFB 2ECNA 2YVRA 3SOXA 5B8DA 2KWOA 2M85A 2QICA 4NN2A 3L11A 2LN0A 3KQIA 2VJEA 4UI9B 1U6GB 1DVPA 5B75A 2M6MA 2OWAA 5D1KB 1F62A 5H1VA 2YYRA 2G6QA 1FBVA 2XOZA 3RPGB 4W4UA 3O70A 2KKYA 2PUYA 1X4UA 1BORA 2KGIA 4S3OC 1N87A 1WENA 3MHSA 4LADB 3FANA 4WZ0A 1WIMA 2JMIA 4WA6A 2YW8A 3ZYQA 1MBMA 2CKLB 2FUIA 4FIPA 3ZPVE 2KU3A 2Y1MA 3HCTA 1MM3A 1WFKA 4OGEA 5KH7A 3I2DA 3GL6A 1DCQA 2KWKA 5TDWA 4R7EA 5C13A 3FJUB 3Q1DA 5AIUA 2KE1A 3DDTA 4X3GA 4LJNA 1Z6UA 4F1PA 2JUNA 2QJ0A 3LJUX 4I7BA 3KNVA 3U5PA 3SOWA 5LKUA 3ZVZB 2L80A 5JG6A 5B79A 2XP0A 5FB1A 3EB6A 3O7AA 2MD7B 4YABA 5KH3A 4R2YA 2DSMA 4MSXA 3LQJA 4R8PK 2ECWA 2VPEA 3O35A 4A4CA 3PURA 2LGKA 3HCSA 2YT5A 2AN6A 5FERA 2F6NA 3LQHA 2Y1NA 2ECVA 4WZ3B 2HYED 1MM2A 3KDEC 2CSVA 2KIZA 5TABA 5SVYA 3SHBA 2VPGA 2OXQC 3EB5A 4GNGA 2K4DA 2KKXA 2JMJA 2MKEA 3O47A 1V87A 2D8UA 5B76A 1Z60A 3LDYA 2PNXA 3M99A 2YSJA 4FK5A 1LDKC 5SVIB 1VD4A 3U5NA 4QF3A 3M7KA 2CRWA 4Q6FA 3V43A 3IHPA 5D1LB 5H9MA 2XB1A 4GB0A 3O34A 1JOCA 1WEVA 4S3OB 3L1ZB 5LKXA 2KWJA 1WE9A 2FFWA 2RSDA 3DPLR 3LQIA 2YUCA 3O36A 4A49A 2EA6A 2YREA 5DKAA 3N9LA 4O62A 1E4UA 5B78A 2IDAA 1X4IA 1K2FA 5DINA 2YHOA 4AUQB 1WEPA 3GV4A 2ECTA 5K3QA 2XEUA 4PPEA 2VJEB
chains in the Genus database with same CATH topology
1DCQA 4Z0RA 2L7PA 3FJUB 3JUEA 2KKXA 2B0OE 2XOYA 3PLWA 3Q1DA 2MKEA 3DDTA 2IQJA 4QQ4A 3O47A 2CONA 3LVRE 5SVYA 2FFWA 2LAUA 2XOCA 4F1PA 2D8UA 2YREA 3LDYA 4O62A 2E61A 2JUNA 2OWAA 3E2DA 3LJUX 3DWDA 4Z0OA 3SUBA 5SVIB 4OGCA 2CRRA 2FD4A 2RR4A 2P57A 3LVQE 3M7KA 2CRWA 3FM8C 2M13A 3MDBC 3T9KA 2EGMA 4OGEA 5K3QA 3KDEC 2CSVA 2XP0A 2XOZA 3H7HA 3FEHA 5SVXA 2EXUA 4H9DA 5SVIA 2DJAA 2KKYA 2YVRA 2JM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0O A;  4Z0R A;  5SVI B;  2L7P A;  5SVX A;  5SVI A;  4QQ4 A;  4O62 A;  2E61 A;  5SVY A;  2RR4 A; 
#chains in the Genus database with same CATH topology
 2CSZ A;  2KGG A;  4FO9 A;  2IQJ A;  2H0D A;  3LRQ A;  4YBM A;  3U5M A;  4LKA A;  2Y43 A;  4IC3 A;  5LCW B;  2LQ6 A;  1WEO A;  2VPB A;  1WEM A;  2CSY A;  2ECG A;  2MNY A;  3U5O A;  2MA6 A;  3C6W A;  4YC9 A;  2JMD A;  2MUM A;  4ZDT A;  4GND A;  4TKP B;  3ZPV 1;  2ECJ A;  4AYC A;  3ZNI A;  3N9P A;  5FB0 A;  5TBN A;  3C5K A;  2NAA A;  2LV9 A;  2CRR A;  2EOD A;  5C11 A;  3HCU A;  2M13 A;  2MIQ A;  4B7Y C;  1WES A;  2MNZ A;  4I7D A;  2ZET C;  5KH9 A;  2MT5 A;  1Z2Q A;  2XOY A;  3PUQ A;  2MD8 C;  2HDP A;  2FSA A;  3RTR B;  1HYJ A;  2KRE A;  1XWH A;  2YHN A;  2YQL A;  4N3W A;  1VYX A;  5G04 B;  2K1J A;  2YUR A;  4I7C A;  2RI7 A;  2LXP C;  4XI1 A;  2MA5 A;  2JM3 A;  1WGM A;  4Z0R A;  2JRJ A;  2KFT A;  4F52 B;  3ASL A;  2C2L A;  2D8S A;  2E6R A;  4V3L C;  2L43 A;  4AVX A;  4L7X A;  3E2D A;  4ZQL A;  3M62 A;  1X4J A;  1JM7 A;  2VNF A;  3FAO A;  4A0C D;  3N9N A;  4H9D A;  4A4B A;  3M63 A;  1VFY A;  4YBT A;  1LDJ B;  1HYI A;  4B86 C;  4QF2 A;  4QQ4 A;  2VJF A;  2YQM A;  2M3H A;  5I3L A;  1CHC A;  2E61 A;  2E6S A;  2L5U A;  3MHH A;  2I50 A;  2L75 A;  3FM8 C;  4C9Z A;  4UP5 A;  4BHW A;  5SVX A;  1ZBD B;  2UZG A;  5AIT A;  4BBQ A;  3L1X A;  3DQV R;  4CA1 A;  4YAT A;  2ECI A;  2CON A;  4V3K C;  5G05 B;  2LRI C;  2M1R A;  2C2V S;  1WEQ A;  5TDR A;  5D1M B;  5TRB A;  2LGL A;  3SUB A;  4OGC A;  3SOU A;  1WEE A;  3LVQ E;  3PHD A;  5B77 A;  3O37 A;  3N9M A;  3MDB C;  5H1T A;  2LXH C;  4LK9 A;  4P5O B;  1RMD A;  3H7H A;  3O33 A;  2LDR A;  2H0D B;  2K16 A;  2CT2 A;  2CKL A;  3HTK C;  2L7P A;  2B0O E;  2F42 A;  1WIL A;  4FJC A;  2LAU A;  2DX8 A;  4GNE A;  5EYA F;  3DWD A;  5G0F A;  3ZVY A;  2P57 A;  4AYC B;  1G25 A;  2EGM A;  2K17 A;  4PTB A;  4GNF A;  3FL2 A;  2DJA A;  1WEW A;  1WEU A;  2RR4 A;  3RPG C;  1T1H A;  5FEY A;  3PLW A;  4O64 A;  3N9Q A;  4YBS A;  3KV6 A;  2EGP A;  2G43 A;  5J3X A;  2FUU A;  2BAY A;  2KR4 A;  1FP0 A;  2KYU A;  2YU4 A;  5H1U A;  2KWN A;  2LGV A;  2EXU A;  2L0B A;  2LGG A;  5LKZ A;  4CCG X;  4WZ2 A;  3NG2 A;  4YAD A;  3VK6 A;  2VP7 A;  2YSM A;  4ZUX U;  2F6J A;  2QIZ A;  3T9K A;  4N4F A;  4AP4 A;  4L58 A;  3T7L A;  5SVI A;  4YAX A;  2G45 A;  3JUE A;  3LVR E;  2XOC A;  1IYM A;  1JM7 B;  4MVT A;  3QZV A;  4LLB A;  2VPD A;  4Z0O A;  3N9O A;  3KV5 A;  2FD4 A;  4IC2 A;  3ZTG A;  3FEH A;  3T6R A;  5LKT A;  4UP0 A;  2VJF B;  2ECN A;  2YVR A;  3SOX A;  5B8D A;  2KWO A;  2M85 A;  2QIC A;  4NN2 A;  3L11 A;  2LN0 A;  3KQI A;  2VJE A;  4UI9 B;  1U6G B;  1DVP A;  5B75 A;  2M6M A;  2OWA A;  5D1K B;  1F62 A;  5H1V A;  2YYR A;  2G6Q A;  1FBV A;  2XOZ A;  3RPG B;  4W4U A;  3O70 A;  2KKY A;  2PUY A;  1X4U A;  1BOR A;  2KGI A;  4S3O C;  1N87 A;  1WEN A;  3MHS A;  4LAD B;  3FAN A;  4WZ0 A;  1WIM A;  2JMI A;  4WA6 A;  2YW8 A;  3ZYQ A;  1MBM A;  2CKL B;  2FUI A;  4FIP A;  3ZPV E;  2KU3 A;  2Y1M A;  3HCT A;  1MM3 A;  1WFK A;  4OGE A;  5KH7 A;  3I2D A;  3GL6 A;  1DCQ A;  2KWK A;  5TDW A;  4R7E A;  5C13 A;  3FJU B;  3Q1D A;  5AIU A;  2KE1 A;  3DDT A;  4X3G A;  4LJN A;  1Z6U A;  4F1P A;  2JUN A;  2QJ0 A;  3LJU X;  4I7B A;  3KNV A;  3U5P A;  3SOW A;  5LKU A;  3ZVZ B;  2L80 A;  5JG6 A;  5B79 A;  2XP0 A;  5FB1 A;  3EB6 A;  3O7A A;  2MD7 B;  4YAB A;  5KH3 A;  4R2Y A;  2DSM A;  4MSX A;  3LQJ A;  4R8P K;  2ECW A;  2VPE A;  3O35 A;  4A4C A;  3PUR A;  2LGK A;  3HCS A;  2YT5 A;  2AN6 A;  5FER A;  2F6N A;  3LQH A;  2Y1N A;  2ECV A;  4WZ3 B;  2HYE D;  1MM2 A;  3KDE C;  2CSV A;  2KIZ A;  5TAB A;  5SVY A;  3SHB A;  2VPG A;  2OXQ C;  3EB5 A;  4GNG A;  2K4D A;  2KKX A;  2JMJ A;  2MKE A;  3O47 A;  1V87 A;  2D8U A;  5B76 A;  1Z60 A;  3LDY A;  2PNX A;  3M99 A;  2YSJ A;  4FK5 A;  1LDK C;  5SVI B;  1VD4 A;  3U5N A;  4QF3 A;  3M7K A;  2CRW A;  4Q6F A;  3V43 A;  3IHP A;  5D1L B;  5H9M A;  2XB1 A;  4GB0 A;  3O34 A;  1JOC A;  1WEV A;  4S3O B;  3L1Z B;  5LKX A;  2KWJ A;  1WE9 A;  2FFW A;  2RSD A;  3DPL R;  3LQI A;  2YUC A;  3O36 A;  4A49 A;  2EA6 A;  2YRE A;  5DKA A;  3N9L A;  4O62 A;  1E4U A;  5B78 A;  2IDA A;  1X4I A;  1K2F A;  5DIN A;  2YHO A;  4AUQ B;  1WEP A;  3GV4 A;  2ECT A;  5K3Q A;  2XEU A;  4PPE A;  2VJE B; 
#chains in the Genus database with same CATH homology
 1DCQ A;  4Z0R A;  2L7P A;  3FJU B;  3JUE A;  2KKX A;  2B0O E;  2XOY A;  3PLW A;  3Q1D A;  2MKE A;  3DDT A;  2IQJ A;  4QQ4 A;  3O47 A;  2CON A;  3LVR E;  5SVY A;  2FFW A;  2LAU A;  2XOC A;  4F1P A;  2D8U A;  2YRE A;  3LDY A;  4O62 A;  2E61 A;  2JUN A;  2OWA A;  3E2D A;  3LJU X;  3DWD A;  4Z0O A;  3SUB A;  5SVI B;  4OGC A;  2CRR A;  2FD4 A;  2RR4 A;  2P57 A;  3LVQ E;  3M7K A;  2CRW A;  3FM8 C;  2M13 A;  3MDB C;  3T9K A;  2EGM A;  4OGE A;  5K3Q A;  3KDE C;  2CSV A;  2XP0 A;  2XOZ A;  3H7H A;  3FEH A;  5SVX A;  2EXU A;  4H9D A;  5SVI A;  2DJA A;  2KKY A;  2YVR A;  2JM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...