5SVYA

Morc3 cw in complex with histone h3k4me1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svyA00
5SVIA 5SVIB 4Z0OA 4Z0RA 4QQ4A 5SVXA 4O62A 2RR4A 2E61A 5SVYA 2L7PA
chains in the Genus database with same CATH superfamily
2VPGA 1DVPA 4O64A 5LKXA 5KH3A 5SVIB 2JRJA 5FEYA 2VPEA 2K1JA 2DX8A 2M13A 5H9MA 2VJEA 3O47A 3FL2A 4F1PA 4R7EA 4C9ZA 1VFYA 2L75A 2DJAA 2H0DA 4QF3A 3LQJA 3KDEC 2KGGA 3U5MA 3FM8C 2Y1NA 1X4JA 2KWKA 5G0FA 5FB1A 2QICA 2OWAA 4UP0A 3C6WA 1U6GB 2AN6A 2IQJA 4W4UA 2YSMA 3ZTGA 2LV9A 2EGPA 2ECIA 3O70A 2YU4A 3ZNIA 4LLBA 4QQ4A 2LAUA 2MKEA 4FJCA 2EA6A 4UP5A 2HDPA 4YBTA 1ZBDB 2QIZA 5FB0A 4AYCB 1WEOA 4AUQB 2LRIC 5D1KB 3KNVA 3SHBA 2F6NA 3KV6A 3O36A 3I2DA 2IDAA 1WEWA 2VPBA 2LGGA 4GNFA 1JOCA 2KFTA 3N9NA 4AP4A 2RI7A 2MD7B 3N9PA 4LADB 5LKTA 2MT5A 1WEPA 3Q1DA 4LJNA 2B0OE 3LQHA 2YT5A 3PHDA 3N9MA 2M3HA 2LQ6A 1WIMA 2K4DA 4A0CD 5TABA 4GNEA 3ASLA 2L80A 4V3LC 4B86C 3L11A 3EB5A 3PLWA 2KREA 2KWNA 2M85A 5TDRA 1VYXA 4S3OC 3LDYA 5LCWB 4OGEA 3FJUB 5H1UA 1JM7B 2JUNA 3VK6A 2L7PA 2ECTA 3EB6A 2KKYA 3LQIA 2KWOA 2VPDA 3ZYQA 4BBQA 2KGIA 2KKXA 4R2YA 2G45A 3LJUX 3N9OA 5SVIA 5KH7A 3QZVA 4BHWA 3MDBC 5B77A 4YABA 2F6JA 5DINA 4YAXA 4MVTA 1HYIA 5TRBA 1BORA 3O7AA 5B76A 1CHCA 3T9KA 4L58A 2RR4A 2CKLA 4ZDTA 2C2VS 2G43A 5C11A 5TBNA 2LGLA 4Q6FA 3U5NA 3FEHA 1VD4A 3SUBA 3O33A 2HYED 1MM2A 4CA1A 4B7YC 4X3GA 3C5KA 1WEQA 3SOWA 2VJFB 2DSMA 4WA6A 1WFKA 2JMJA 4H9DA 2E6RA 2FFWA 4FK5A 2LXPC 2YQMA 1HYJA 4AVXA 2JMIA 2YQLA 2KWJA 5B78A 4A4CA 3M62A 2VJEB 3MHSA 1IYMA 2MD8C 4WZ0A 2ZETC 5H1VA 2KYUA 2CSYA 3GL6A 4IC2A 3ZPVE 2CRWA 4WZ3B 1Z6UA 2CONA 2FD4A 2KIZA 3PUQA 1FBVA 3MHHA 4XI1A 5B75A 3HCUA 1LDKC 2XP0A 3U5PA 4Z0OA 5B79A 3O34A 4CCGX 1XWHA 3M99A 2M6MA 4O62A 3ZVZB 2M1RA 4YBMA 4V3KC 5D1MB 1JM7A 3LVRE 4PTBA 2E6SA 3RPGC 2LGVA 2EXUA 2YVRA 1LDJB 3KV5A 2YW8A 2PNXA 2C2LA 4YADA 4Z0RA 2LDRA 2YURA 2YREA 2I50A 2CSZA 3M63A 3JUEA 2L43A 2EODA 2YUCA 3T7LA 2L5UA 2MIQA 1WILA 3RPGB 2KE1A 2YYRA 3L1XA 1DCQA 1G25A 2RSDA 3T6RA 3HCTA 2FUUA 2EGMA 2ECVA 1MBMA 2FUIA 2LN0A 2VJFA 2JM3A 1K2FA 5G04B 4F52B 4LKAA 5TDWA 2KR4A 3DQVR 1WENA 1N87A 2BAYA 4LK9A 2YHNA 2ECJA 4R8PK 5G05B 2OXQC 1V87A 4UI9B 2D8SA 5AITA 5B8DA 2K17A 2MNZA 1FP0A 1Z60A 3HCSA 4PPEA 1WEEA 4I7CA 1WESA 3ZVYA 2CSVA 1X4IA 2Y43A 2XOYA 4N3WA 1E4UA 5FERA 1Z2QA 4AYCA 5JG6A 3M7KA 1MM3A 3N9LA 4TKPB 2CKLB 3FAOA 4MSXA 4P5OB 4I7DA 3NG2A 3KQIA 2H0DB 4YBSA 4L7XA 2MNYA 1WEUA 3DPLR 4YATA 3U5OA 3L1ZB 5D1LB 2ECWA 3SOUA 2G6QA 2K16A 4ZUXU 4YC9A 4OGCA 2D8UA 5C13A 2XEUA 4GNDA 5SVXA 1RMDA 4WZ2A 2CRRA 2P57A 3DWDA 5KH9A 3O35A 2MA5A 5LKZA 4NN2A 2MUMA 2XOCA 3E2DA 5LKUA 3SOXA 4QF2A 5EYAF 1T1HA 1WE9A 2YHOA 2JMDA 3ZPV1 2YSJA 3LVQE 2F42A 2Y1MA 3H7HA 3PURA 3O37A 5AIUA 1F62A 4ZQLA 5SVYA 2XOZA 2UZGA 2VP7A 4A4BA 5H1TA 4I7BA 5I3LA 1WEMA 5K3QA 2L0BA 2KU3A 1X4UA 2MA6A 2PUYA 2ECNA 4A49A 3V43A 2ECGA 5DKAA 2CT2A 5J3XA 2XB1A 1WGMA 4N4FA 3IHPA 4GB0A 4GNGA 3RTRB 3FANA 4FIPA 3DDTA 3N9QA 4FO9A 2QJ0A 2VNFA 1WEVA 2LXHC 2FSAA 3GV4A 2E61A 3LRQA 4IC3A 2NAAA 3HTKC 4S3OB 2LGKA
chains in the Genus database with same CATH topology
3FM8C 2XP0A 4OGCA 4Z0OA 2D8UA 4OGEA 2EGMA 3FJUB 5SVYA 2XOZA 5SVXA 2OWAA 2JUNA 2CRRA 2P57A 3DWDA 5SVIB 4Z0RA 4O62A 4H9DA 3T9KA 2RR4A 2XOCA 2YREA 3E2DA 2CRWA 2L7PA 2CSVA 2IQJA 2M13A 3DDTA 3JUEA 3O47A 2CONA 2FD4A 2FFWA 2KKYA 2XOYA 4F1PA 2KKXA 5K3QA 3PLWA 2JM3A 2E61A 3LVRE 3LJUX 5SVIA 3M7KA 3Q1DA 3LVQE 3FEHA 2DJAA 3MDBC 2LAUA 4QQ4A 3SUBA 1DCQA 2EXUA 2B0OE 2YVRA 3KDEC 2MKEA 3LDYA 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI A;  5SVI B;  4Z0O A;  4Z0R A;  4QQ4 A;  5SVX A;  4O62 A;  2RR4 A;  2E61 A;  5SVY A;  2L7P A; 
#chains in the Genus database with same CATH topology
 2VPG A;  1DVP A;  4O64 A;  5LKX A;  5KH3 A;  5SVI B;  2JRJ A;  5FEY A;  2VPE A;  2K1J A;  2DX8 A;  2M13 A;  5H9M A;  2VJE A;  3O47 A;  3FL2 A;  4F1P A;  4R7E A;  4C9Z A;  1VFY A;  2L75 A;  2DJA A;  2H0D A;  4QF3 A;  3LQJ A;  3KDE C;  2KGG A;  3U5M A;  3FM8 C;  2Y1N A;  1X4J A;  2KWK A;  5G0F A;  5FB1 A;  2QIC A;  2OWA A;  4UP0 A;  3C6W A;  1U6G B;  2AN6 A;  2IQJ A;  4W4U A;  2YSM A;  3ZTG A;  2LV9 A;  2EGP A;  2ECI A;  3O70 A;  2YU4 A;  3ZNI A;  4LLB A;  4QQ4 A;  2LAU A;  2MKE A;  4FJC A;  2EA6 A;  4UP5 A;  2HDP A;  4YBT A;  1ZBD B;  2QIZ A;  5FB0 A;  4AYC B;  1WEO A;  4AUQ B;  2LRI C;  5D1K B;  3KNV A;  3SHB A;  2F6N A;  3KV6 A;  3O36 A;  3I2D A;  2IDA A;  1WEW A;  2VPB A;  2LGG A;  4GNF A;  1JOC A;  2KFT A;  3N9N A;  4AP4 A;  2RI7 A;  2MD7 B;  3N9P A;  4LAD B;  5LKT A;  2MT5 A;  1WEP A;  3Q1D A;  4LJN A;  2B0O E;  3LQH A;  2YT5 A;  3PHD A;  3N9M A;  2M3H A;  2LQ6 A;  1WIM A;  2K4D A;  4A0C D;  5TAB A;  4GNE A;  3ASL A;  2L80 A;  4V3L C;  4B86 C;  3L11 A;  3EB5 A;  3PLW A;  2KRE A;  2KWN A;  2M85 A;  5TDR A;  1VYX A;  4S3O C;  3LDY A;  5LCW B;  4OGE A;  3FJU B;  5H1U A;  1JM7 B;  2JUN A;  3VK6 A;  2L7P A;  2ECT A;  3EB6 A;  2KKY A;  3LQI A;  2KWO A;  2VPD A;  3ZYQ A;  4BBQ A;  2KGI A;  2KKX A;  4R2Y A;  2G45 A;  3LJU X;  3N9O A;  5SVI A;  5KH7 A;  3QZV A;  4BHW A;  3MDB C;  5B77 A;  4YAB A;  2F6J A;  5DIN A;  4YAX A;  4MVT A;  1HYI A;  5TRB A;  1BOR A;  3O7A A;  5B76 A;  1CHC A;  3T9K A;  4L58 A;  2RR4 A;  2CKL A;  4ZDT A;  2C2V S;  2G43 A;  5C11 A;  5TBN A;  2LGL A;  4Q6F A;  3U5N A;  3FEH A;  1VD4 A;  3SUB A;  3O33 A;  2HYE D;  1MM2 A;  4CA1 A;  4B7Y C;  4X3G A;  3C5K A;  1WEQ A;  3SOW A;  2VJF B;  2DSM A;  4WA6 A;  1WFK A;  2JMJ A;  4H9D A;  2E6R A;  2FFW A;  4FK5 A;  2LXP C;  2YQM A;  1HYJ A;  4AVX A;  2JMI A;  2YQL A;  2KWJ A;  5B78 A;  4A4C A;  3M62 A;  2VJE B;  3MHS A;  1IYM A;  2MD8 C;  4WZ0 A;  2ZET C;  5H1V A;  2KYU A;  2CSY A;  3GL6 A;  4IC2 A;  3ZPV E;  2CRW A;  4WZ3 B;  1Z6U A;  2CON A;  2FD4 A;  2KIZ A;  3PUQ A;  1FBV A;  3MHH A;  4XI1 A;  5B75 A;  3HCU A;  1LDK C;  2XP0 A;  3U5P A;  4Z0O A;  5B79 A;  3O34 A;  4CCG X;  1XWH A;  3M99 A;  2M6M A;  4O62 A;  3ZVZ B;  2M1R A;  4YBM A;  4V3K C;  5D1M B;  1JM7 A;  3LVR E;  4PTB A;  2E6S A;  3RPG C;  2LGV A;  2EXU A;  2YVR A;  1LDJ B;  3KV5 A;  2YW8 A;  2PNX A;  2C2L A;  4YAD A;  4Z0R A;  2LDR A;  2YUR A;  2YRE A;  2I50 A;  2CSZ A;  3M63 A;  3JUE A;  2L43 A;  2EOD A;  2YUC A;  3T7L A;  2L5U A;  2MIQ A;  1WIL A;  3RPG B;  2KE1 A;  2YYR A;  3L1X A;  1DCQ A;  1G25 A;  2RSD A;  3T6R A;  3HCT A;  2FUU A;  2EGM A;  2ECV A;  1MBM A;  2FUI A;  2LN0 A;  2VJF A;  2JM3 A;  1K2F A;  5G04 B;  4F52 B;  4LKA A;  5TDW A;  2KR4 A;  3DQV R;  1WEN A;  1N87 A;  2BAY A;  4LK9 A;  2YHN A;  2ECJ A;  4R8P K;  5G05 B;  2OXQ C;  1V87 A;  4UI9 B;  2D8S A;  5AIT A;  5B8D A;  2K17 A;  2MNZ A;  1FP0 A;  1Z60 A;  3HCS A;  4PPE A;  1WEE A;  4I7C A;  1WES A;  3ZVY A;  2CSV A;  1X4I A;  2Y43 A;  2XOY A;  4N3W A;  1E4U A;  5FER A;  1Z2Q A;  4AYC A;  5JG6 A;  3M7K A;  1MM3 A;  3N9L A;  4TKP B;  2CKL B;  3FAO A;  4MSX A;  4P5O B;  4I7D A;  3NG2 A;  3KQI A;  2H0D B;  4YBS A;  4L7X A;  2MNY A;  1WEU A;  3DPL R;  4YAT A;  3U5O A;  3L1Z B;  5D1L B;  2ECW A;  3SOU A;  2G6Q A;  2K16 A;  4ZUX U;  4YC9 A;  4OGC A;  2D8U A;  5C13 A;  2XEU A;  4GND A;  5SVX A;  1RMD A;  4WZ2 A;  2CRR A;  2P57 A;  3DWD A;  5KH9 A;  3O35 A;  2MA5 A;  5LKZ A;  4NN2 A;  2MUM A;  2XOC A;  3E2D A;  5LKU A;  3SOX A;  4QF2 A;  5EYA F;  1T1H A;  1WE9 A;  2YHO A;  2JMD A;  3ZPV 1;  2YSJ A;  3LVQ E;  2F42 A;  2Y1M A;  3H7H A;  3PUR A;  3O37 A;  5AIU A;  1F62 A;  4ZQL A;  5SVY A;  2XOZ A;  2UZG A;  2VP7 A;  4A4B A;  5H1T A;  4I7B A;  5I3L A;  1WEM A;  5K3Q A;  2L0B A;  2KU3 A;  1X4U A;  2MA6 A;  2PUY A;  2ECN A;  4A49 A;  3V43 A;  2ECG A;  5DKA A;  2CT2 A;  5J3X A;  2XB1 A;  1WGM A;  4N4F A;  3IHP A;  4GB0 A;  4GNG A;  3RTR B;  3FAN A;  4FIP A;  3DDT A;  3N9Q A;  4FO9 A;  2QJ0 A;  2VNF A;  1WEV A;  2LXH C;  2FSA A;  3GV4 A;  2E61 A;  3LRQ A;  4IC3 A;  2NAA A;  3HTK C;  4S3O B;  2LGK A; 
#chains in the Genus database with same CATH homology
 3FM8 C;  2XP0 A;  4OGC A;  4Z0O A;  2D8U A;  4OGE A;  2EGM A;  3FJU B;  5SVY A;  2XOZ A;  5SVX A;  2OWA A;  2JUN A;  2CRR A;  2P57 A;  3DWD A;  5SVI B;  4Z0R A;  4O62 A;  4H9D A;  3T9K A;  2RR4 A;  2XOC A;  2YRE A;  3E2D A;  2CRW A;  2L7P A;  2CSV A;  2IQJ A;  2M13 A;  3DDT A;  3JUE A;  3O47 A;  2CON A;  2FD4 A;  2FFW A;  2KKY A;  2XOY A;  4F1P A;  2KKX A;  5K3Q A;  3PLW A;  2JM3 A;  2E61 A;  3LVR E;  3LJU X;  5SVI A;  3M7K A;  3Q1D A;  3LVQ E;  3FEH A;  2DJA A;  3MDB C;  2LAU A;  4QQ4 A;  3SUB A;  1DCQ A;  2EXU A;  2B0O E;  2YVR A;  3KDE C;  2MKE A;  3LDY A;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...