5SVYA

Morc3 cw in complex with histone h3k4me1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords MORC family CW-type zinc finger protein 3
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2016-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 5svyA00
5SVIA 2E61A 2L7PA 5SVYA 5SVXA 5SVIB 4QQ4A 4Z0RA 4O62A 2RR4A 4Z0OA
chains in the Genus database with same CATH superfamily
4IC2A 2JMIA 2KYUA 2QIZA 1WGMA 4FK5A 3KV6A 2RSDA 3KNVA 2VPEA 5B77A 4FO9A 2KR4A 4R7EA 3ASLA 2MA5A 5LKXA 4ZUXU 5SVIB 3SHBA 3KDEC 5KH3A 2UZGA 3O36A 3PHDA 2KWJA 4L58A 4AUQB 3O70A 1X4UA 2FUUA 2K4DA 5I3LA 4GNFA 3HCSA 4LK9A 1E4UA 5JG6A 5LCWB 1WEWA 3PURA 5C13A 2BAYA 2OXQC 4O64A 4QF3A 2YSMA 4AP4A 4WA6A 3LQJA 2VJEB 4A4BA 5TDRA 1CHCA 4X3GA 2PUYA 2JRJA 2D8SA 5H1UA 3C5KA 4B86C 4MVTA 2ECJA 4R2YA 4O62A 2CKLB 2KREA 1JOCA 2CSYA 3E2DA 4I7DA 2KGIA 1X4JA 2LQ6A 5LKUA 1WEEA 3O35A 2YT5A 3N9NA 2CT2A 1Z6UA 2FSAA 2LN0A 4ZDTA 2PNXA 3M99A 2LXHC 4R8PK 4GB0A 2P57A 5D1LB 2L5UA 4IC3A 1WEUA 2G45A 4YABA 2DX8A 3V43A 4GNGA 2KU3A 4GNEA 1RMDA 2LGLA 3GV4A 2VNFA 4WZ2A 2L0BA 5SVXA 1JM7A 3HCTA 2QJ0A 3MHSA 3KQIA 4YATA 3DQVR 5FEYA 3RPGC 4YADA 1VD4A 2Y1NA 5KH7A 2M85A 2CSVA 3VK6A 2YURA 4AYCB 2EA6A 3NG2A 5G0FA 2HYED 2L80A 2VJEA 1WEPA 3O37A 2F6NA 2B0OE 5H9MA 5KH9A 2NAAA 2ZETC 4P5OB 2FFWA 2FUIA 1DVPA 4LLBA 3DWDA 3U5PA 2VP7A 4Q6FA 3ZPVE 1FP0A 5SVIA 2VPBA 4MSXA 2MIQA 1XWHA 4YC9A 2EGMA 3RPGB 4ZQLA 2LDRA 2IDAA 2JMDA 2KWNA 3SOXA 3EB5A 2VJFB 2MT5A 2MA6A 3U5OA 5DINA 3L1ZB 4H9DA 2ECIA 4I7CA 1HYJA 2DSMA 3C6WA 2ECNA 1MM2A 1U6GB 4S3OB 4V3KC 4F1PA 1HYIA 2CONA 2XEUA 4B7YC 5TABA 5J3XA 2EXUA 3FM8C 3ZVZB 5D1KB 3DDTA 1JM7B 2E61A 5FERA 2KWOA 2F42A 3LQHA 4LADB 2F6JA 3L11A 3QZVA 4UP0A 2Y43A 1VYXA 2HDPA 3LRQA 4F52B 4L7XA 2KWKA 3IHPA 2G6QA 3N9MA 2XOYA 5TDWA 4YAXA 2JUNA 3Q1DA 4Z0RA 5H1VA 2H0DB 3O34A 2C2LA 4CCGX 4TKPB 5FB1A 1IYMA 2ECWA 2JM3A 4YBMA 5TBNA 1X4IA 3GL6A 3ZTGA 1T1HA 2RI7A 2FD4A 4UI9B 1LDKC 2VPGA 2LGGA 2KGGA 3LVRE 2YREA 2MNYA 3T7LA 2IQJA 3N9OA 2LGKA 4BBQA 2E6SA 4LJNA 4I7BA 3HTKC 1Z2QA 2ECVA 1MBMA 3T6RA 2KIZA 2YW8A 1WESA 2VPDA 1ZBDB 2CRRA 4XI1A 3N9LA 1WEMA 1BORA 4N4FA 3EB6A 3PUQA 2AN6A 1VFYA 2MUMA 2YU4A 4WZ3B 2EODA 1K2FA 1WEOA 2E6RA 4A49A 2K1JA 2KKXA 2MD8C 3SOWA 2M13A 2YYRA 4PTBA 2K17A 2LRIC 2YQMA 2C2VS 4LKAA 2M3HA 3O7AA 2YVRA 2XOCA 3N9QA 3M63A 1MM3A 4A0CD 3U5MA 5DKAA 2CKLA 4QQ4A 3M62A 4QF2A 4Z0OA 3FJUB 2KE1A 2VJFA 5LKTA 1FBVA 2YSJA 2KKYA 2Y1MA 3ZPV1 3U5NA 3DPLR 3JUEA 2LAUA 3O33A 5EYAF 5C11A 5B79A 3T9KA 3M7KA 3SUBA 4UP5A 3FAOA 2I50A 4OGCA 3I2DA 3H7HA 2EGPA 4C9ZA 4CA1A 3LJUX 2MKEA 2G43A 2XOZA 1N87A 2LXPC 3KV5A 5B78A 3LQIA 3LVQE 4GNDA 4A4CA 3HCUA 4N3WA 2M1RA 3ZVYA 4W4UA 5G04B 3LDYA 3L1XA 3N9PA 2YUCA 2LV9A 2LGVA 2XB1A 2L43A 2MD7B 3O47A 2XP0A 5LKZA 2JMJA 5K3QA 4V3LC 2ECGA 4FJCA 5SVYA 2MNZA 3FANA 2DJAA 2YHOA 5AITA 3MHHA 4BHWA 5B76A 5G05B 3FEHA 5B75A 2D8UA 1WIMA 2YQLA 4PPEA 3ZYQA 3ZNIA 2OWAA 4S3OC 2RR4A 4AYCA 2ECTA 3SOUA 1WENA 2KFTA 1WILA 1G25A 4FIPA 2YHNA 5AIUA 4YBSA 2CSZA 4YBTA 2L75A 4NN2A 1Z60A 5TRBA 1DCQA 1LDJB 2H0DA 3PLWA 3FL2A 5B8DA 1WE9A 2QICA 4OGEA 2M6MA 4WZ0A 5FB0A 2K16A 1WEVA 4AVXA 1F62A 1WFKA 1WEQA 1V87A 3RTRB 5H1TA 2L7PA 3MDBC 5D1MB 2CRWA
chains in the Genus database with same CATH topology
2P57A 2YVRA 2FFWA 4H9DA 2XOCA 5K3QA 4OGCA 3DWDA 3H7HA 5SVYA 4O62A 3LJUX 4QQ4A 4Z0OA 2MKEA 3FJUB 2CSVA 2XOZA 2DJAA 4OGEA 3E2DA 3PLWA 4F1PA 3LVQE 2CONA 2JM3A 5SVIA 2KKXA 2KKYA 2EGMA 2EXUA 2CRRA 2M13A 2XOYA 3FM8C 2FD4A 5SVXA 5SVIB 3LDYA 3KDEC 2JUNA 2B0OE 3FEHA 3Q1DA 4Z0RA 3DDTA 3JUEA 2E61A 2D8UA 1DCQA 2L7PA 2LAUA 3MDBC 3LVRE 2YREA 3T9KA 2IQJA 3M7KA 2CRWA 2XP0A 3O47A 2OWAA 3SUBA 2RR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5SVI A;  2E61 A;  2L7P A;  5SVY A;  5SVX A;  5SVI B;  4QQ4 A;  4Z0R A;  4O62 A;  2RR4 A;  4Z0O A; 
#chains in the Genus database with same CATH topology
 4IC2 A;  2JMI A;  2KYU A;  2QIZ A;  1WGM A;  4FK5 A;  3KV6 A;  2RSD A;  3KNV A;  2VPE A;  5B77 A;  4FO9 A;  2KR4 A;  4R7E A;  3ASL A;  2MA5 A;  5LKX A;  4ZUX U;  5SVI B;  3SHB A;  3KDE C;  5KH3 A;  2UZG A;  3O36 A;  3PHD A;  2KWJ A;  4L58 A;  4AUQ B;  3O70 A;  1X4U A;  2FUU A;  2K4D A;  5I3L A;  4GNF A;  3HCS A;  4LK9 A;  1E4U A;  5JG6 A;  5LCW B;  1WEW A;  3PUR A;  5C13 A;  2BAY A;  2OXQ C;  4O64 A;  4QF3 A;  2YSM A;  4AP4 A;  4WA6 A;  3LQJ A;  2VJE B;  4A4B A;  5TDR A;  1CHC A;  4X3G A;  2PUY A;  2JRJ A;  2D8S A;  5H1U A;  3C5K A;  4B86 C;  4MVT A;  2ECJ A;  4R2Y A;  4O62 A;  2CKL B;  2KRE A;  1JOC A;  2CSY A;  3E2D A;  4I7D A;  2KGI A;  1X4J A;  2LQ6 A;  5LKU A;  1WEE A;  3O35 A;  2YT5 A;  3N9N A;  2CT2 A;  1Z6U A;  2FSA A;  2LN0 A;  4ZDT A;  2PNX A;  3M99 A;  2LXH C;  4R8P K;  4GB0 A;  2P57 A;  5D1L B;  2L5U A;  4IC3 A;  1WEU A;  2G45 A;  4YAB A;  2DX8 A;  3V43 A;  4GNG A;  2KU3 A;  4GNE A;  1RMD A;  2LGL A;  3GV4 A;  2VNF A;  4WZ2 A;  2L0B A;  5SVX A;  1JM7 A;  3HCT A;  2QJ0 A;  3MHS A;  3KQI A;  4YAT A;  3DQV R;  5FEY A;  3RPG C;  4YAD A;  1VD4 A;  2Y1N A;  5KH7 A;  2M85 A;  2CSV A;  3VK6 A;  2YUR A;  4AYC B;  2EA6 A;  3NG2 A;  5G0F A;  2HYE D;  2L80 A;  2VJE A;  1WEP A;  3O37 A;  2F6N A;  2B0O E;  5H9M A;  5KH9 A;  2NAA A;  2ZET C;  4P5O B;  2FFW A;  2FUI A;  1DVP A;  4LLB A;  3DWD A;  3U5P A;  2VP7 A;  4Q6F A;  3ZPV E;  1FP0 A;  5SVI A;  2VPB A;  4MSX A;  2MIQ A;  1XWH A;  4YC9 A;  2EGM A;  3RPG B;  4ZQL A;  2LDR A;  2IDA A;  2JMD A;  2KWN A;  3SOX A;  3EB5 A;  2VJF B;  2MT5 A;  2MA6 A;  3U5O A;  5DIN A;  3L1Z B;  4H9D A;  2ECI A;  4I7C A;  1HYJ A;  2DSM A;  3C6W A;  2ECN A;  1MM2 A;  1U6G B;  4S3O B;  4V3K C;  4F1P A;  1HYI A;  2CON A;  2XEU A;  4B7Y C;  5TAB A;  5J3X A;  2EXU A;  3FM8 C;  3ZVZ B;  5D1K B;  3DDT A;  1JM7 B;  2E61 A;  5FER A;  2KWO A;  2F42 A;  3LQH A;  4LAD B;  2F6J A;  3L11 A;  3QZV A;  4UP0 A;  2Y43 A;  1VYX A;  2HDP A;  3LRQ A;  4F52 B;  4L7X A;  2KWK A;  3IHP A;  2G6Q A;  3N9M A;  2XOY A;  5TDW A;  4YAX A;  2JUN A;  3Q1D A;  4Z0R A;  5H1V A;  2H0D B;  3O34 A;  2C2L A;  4CCG X;  4TKP B;  5FB1 A;  1IYM A;  2ECW A;  2JM3 A;  4YBM A;  5TBN A;  1X4I A;  3GL6 A;  3ZTG A;  1T1H A;  2RI7 A;  2FD4 A;  4UI9 B;  1LDK C;  2VPG A;  2LGG A;  2KGG A;  3LVR E;  2YRE A;  2MNY A;  3T7L A;  2IQJ A;  3N9O A;  2LGK A;  4BBQ A;  2E6S A;  4LJN A;  4I7B A;  3HTK C;  1Z2Q A;  2ECV A;  1MBM A;  3T6R A;  2KIZ A;  2YW8 A;  1WES A;  2VPD A;  1ZBD B;  2CRR A;  4XI1 A;  3N9L A;  1WEM A;  1BOR A;  4N4F A;  3EB6 A;  3PUQ A;  2AN6 A;  1VFY A;  2MUM A;  2YU4 A;  4WZ3 B;  2EOD A;  1K2F A;  1WEO A;  2E6R A;  4A49 A;  2K1J A;  2KKX A;  2MD8 C;  3SOW A;  2M13 A;  2YYR A;  4PTB A;  2K17 A;  2LRI C;  2YQM A;  2C2V S;  4LKA A;  2M3H A;  3O7A A;  2YVR A;  2XOC A;  3N9Q A;  3M63 A;  1MM3 A;  4A0C D;  3U5M A;  5DKA A;  2CKL A;  4QQ4 A;  3M62 A;  4QF2 A;  4Z0O A;  3FJU B;  2KE1 A;  2VJF A;  5LKT A;  1FBV A;  2YSJ A;  2KKY A;  2Y1M A;  3ZPV 1;  3U5N A;  3DPL R;  3JUE A;  2LAU A;  3O33 A;  5EYA F;  5C11 A;  5B79 A;  3T9K A;  3M7K A;  3SUB A;  4UP5 A;  3FAO A;  2I50 A;  4OGC A;  3I2D A;  3H7H A;  2EGP A;  4C9Z A;  4CA1 A;  3LJU X;  2MKE A;  2G43 A;  2XOZ A;  1N87 A;  2LXP C;  3KV5 A;  5B78 A;  3LQI A;  3LVQ E;  4GND A;  4A4C A;  3HCU A;  4N3W A;  2M1R A;  3ZVY A;  4W4U A;  5G04 B;  3LDY A;  3L1X A;  3N9P A;  2YUC A;  2LV9 A;  2LGV A;  2XB1 A;  2L43 A;  2MD7 B;  3O47 A;  2XP0 A;  5LKZ A;  2JMJ A;  5K3Q A;  4V3L C;  2ECG A;  4FJC A;  5SVY A;  2MNZ A;  3FAN A;  2DJA A;  2YHO A;  5AIT A;  3MHH A;  4BHW A;  5B76 A;  5G05 B;  3FEH A;  5B75 A;  2D8U A;  1WIM A;  2YQL A;  4PPE A;  3ZYQ A;  3ZNI A;  2OWA A;  4S3O C;  2RR4 A;  4AYC A;  2ECT A;  3SOU A;  1WEN A;  2KFT A;  1WIL A;  1G25 A;  4FIP A;  2YHN A;  5AIU A;  4YBS A;  2CSZ A;  4YBT A;  2L75 A;  4NN2 A;  1Z60 A;  5TRB A;  1DCQ A;  1LDJ B;  2H0D A;  3PLW A;  3FL2 A;  5B8D A;  1WE9 A;  2QIC A;  4OGE A;  2M6M A;  4WZ0 A;  5FB0 A;  2K16 A;  1WEV A;  4AVX A;  1F62 A;  1WFK A;  1WEQ A;  1V87 A;  3RTR B;  5H1T A;  2L7P A;  3MDB C;  5D1M B;  2CRW A; 
#chains in the Genus database with same CATH homology
 2P57 A;  2YVR A;  2FFW A;  4H9D A;  2XOC A;  5K3Q A;  4OGC A;  3DWD A;  3H7H A;  5SVY A;  4O62 A;  3LJU X;  4QQ4 A;  4Z0O A;  2MKE A;  3FJU B;  2CSV A;  2XOZ A;  2DJA A;  4OGE A;  3E2D A;  3PLW A;  4F1P A;  3LVQ E;  2CON A;  2JM3 A;  5SVI A;  2KKX A;  2KKY A;  2EGM A;  2EXU A;  2CRR A;  2M13 A;  2XOY A;  3FM8 C;  2FD4 A;  5SVX A;  5SVI B;  3LDY A;  3KDE C;  2JUN A;  2B0O E;  3FEH A;  3Q1D A;  4Z0R A;  3DDT A;  3JUE A;  2E61 A;  2D8U A;  1DCQ A;  2L7P A;  2LAU A;  3MDB C;  3LVR E;  2YRE A;  3T9K A;  2IQJ A;  3M7K A;  2CRW A;  2XP0 A;  3O47 A;  2OWA A;  3SUB A;  2RR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...