1WEUA

Solution structure of phd domain in ing1-like protein bac25009
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
GSSGSSGSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords inhibitor of growth family, member 4
publication title Solution structure of PHD domain in ING1-like protein BAC25009
rcsb
source organism Mus musculus
total genus 4
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weuA00
1WIMA 3N9MA 2KIZA 5G0FA 2LGLA 2KWKA 1FBVA 5TRBA 2KWOA 3SOWA 3L1XA 4S3OC 4S3OB 1RMDA 1WFKA 2K17A 5I3LA 2F6NA 2ECGA 4NN2A 2PUYA 2RI7A 4MVTA 2MNZA 4GNGA 2CSZA 1X4IA 4R7EA 2LXPC 1VD4A 2PNXA 4PTBA 1F62A 3SOXA 4GNDA 4QF2A 1HYIA 4N4FA 1WEMA 2L5UA 5LKXA 3LQIA 3HTKC 2I50A 2UZGA 2LN0A 5AITA 3HCUA 4Q6FA 3PHDA 3ZVZB 1ZBDB 2KWJA 4C9ZA 4F52B 5C11A 3ZPVE 4A49A 5C13A 3M62A 3O35A 2M85A 4BBQA 2VNFA 3ZTGA 2MA5A 3N9QA 4XI1A 4LJNA 2VPEA 2M1RA 2VPDA 2LDRA 3ZYQA 2CSYA 4YBMA 3VK6A 4V3LC 3QZVA 2VJEA 2L0BA 4CA1A 5B78A 2G6QA 4LK9A 2H0DB 4WA6A 4GNFA 2ECWA 5H1UA 2KYUA 1WESA 3I2DA 4MSXA 4A0CD 2ECTA 5FERA 4AP4A 5B8DA 5H1VA 5DKAA 3DPLR 3N9NA 2MD8C 5D1LB 2XB1A 3M99A 5JG6A 3GV4A 2QIZA 1FP0A 3V43A 1T1HA 4BHWA 5KH9A 4V3KC 3KNVA 1WEPA 2CKLB 4WZ3B 4YABA 3SHBA 2K16A 2VJFB 3U5MA 4R8PK 2EA6A 3KV6A 4FO9A 4YAXA 5TDWA 3T7LA 2MIQA 1VFYA 2Y43A 2YU4A 2KU3A 1K2FA 1WENA 5B79A 2NAAA 5AIUA 2Y1NA 3LRQA 4AUQB 3ASLA 5LKUA 2KR4A 3EB5A 5G05B 5H9MA 2KWNA 4ZDTA 2G45A 2ECJA 2YW8A 2VP7A 4FJCA 3U5OA 2HYED 4YC9A 3T6RA 4UI9B 1HYJA 4B86C 2YT5A 3U5NA 4YBTA 4O64A 3C5KA 3L1ZB 5B77A 5FB0A 3O36A 1WEEA 5J3XA 3DQVR 4LKAA 3GL6A 2KGGA 3O34A 2FUIA 2KE1A 2MD7B 4WZ2A 2QJ0A 5B76A 4AYCB 1Z2QA 3EB6A 4YBSA 5LKZA 1JM7A 2C2VS 2MT5A 2D8SA 2JMDA 1WEUA 3ZVYA 2YHOA 3O70A 1DVPA 2M3HA 4AVXA 3U5PA 1WEQA 5TDRA 4GB0A 3HCSA 4L58A 1WE9A 2F42A 2F6JA 2KGIA 1WILA 2L80A 3ZNIA 1WEWA 2ECIA 2QICA 2VPGA 1U6GB 2E6RA 1X4UA 2DX8A 3N9LA 2AN6A 5FEYA 2LGGA 2KFTA 5KH3A 4UP0A 4A4BA 4ZUXU 4FK5A 2YUCA 4IC3A 4W4UA 3IHPA 2YSJA 2MA6A 2YREA 5LKTA 2BAYA 4I7BA 4B7YC 2JMJA 4LLBA 2CT2A 4L7XA 2M6MA 2EODA 3HCTA 2FUUA 1BORA 2FSAA 3O7AA 4X3GA 2YYRA 1LDKC 3LQHA 2LXHC 3O37A 3C6WA 2VPBA 1WEOA 2MNYA 2RSDA 2YSMA 3MHSA 5LCWB 3LQJA 5G04B 3KQIA 1JOCA 3ZPV1 2ZETC 1IYMA 2HDPA 4P5OB 1MM3A 1LDJB 2LQ6A 2ECVA 2K4DA 3MHHA 3SOUA 2G43A 3RPGC 1CHCA 2YQMA 3RPGB 2IDAA 1MM2A 4IC2A 4WZ0A 4YATA 4UP5A 2EGPA 2JMIA 4ZQLA 2XEUA 4I7CA 2K1JA 4FIPA 3PURA 1E4UA 2YURA 3N9OA 4R2YA 4PPEA 2LV9A 2JRJA 2YHNA 5FB1A 1WGMA 1VYXA 4GNEA 2LGKA 5B75A 4AYCA 2VJEB 1JM7B 2LRIC 5TBNA 3KV5A 4LADB 1Z60A 2OXQC 5DINA 2H0DA 5KH7A 3M63A 2C2LA 5TABA 1V87A 4CCGX 3N9PA 2ECNA 5H1TA 1X4JA 2E6SA 4A4CA 4N3WA 3L11A 3NG2A 1XWHA 4YADA 4TKPB 2LGVA 1N87A 2L75A 3PUQA 2YQLA 4QF3A 1Z6UA 2MUMA 4I7DA 1WEVA 3FL2A 2Y1MA 5EYAF 2KREA 1G25A 2CKLA 5D1KB 3RTRB 3O33A 2VJFA 5D1MB 2L43A
chains in the Genus database with same CATH superfamily
1WIMA 3N9MA 2KIZA 5G0FA 2LGLA 2KWKA 1FBVA 2M13A 5TRBA 2KWOA 3SOWA 3L1XA 4S3OC 4S3OB 1RMDA 1WFKA 2K17A 5I3LA 2F6NA 2FFWA 2YVRA 2ECGA 4NN2A 2PUYA 2RI7A 4MVTA 2MNZA 4GNGA 2CSZA 1X4IA 4R7EA 2LXPC 1VD4A 2PNXA 4Z0RA 4PTBA 1F62A 3SOXA 4GNDA 4QF2A 1HYIA 4N4FA 1WEMA 2L5UA 5LKXA 3LQIA 3HTKC 2I50A 2DSMA 2UZGA 2LN0A 5AITA 3HCUA 4Q6FA 2KKYA 3PHDA 3ZVZB 1ZBDB 2KWJA 4C9ZA 4F52B 5C11A 3ZPVE 4A49A 5C13A 3M62A 3O35A 2M85A 4BBQA 2EXUA 2VNFA 3ZTGA 1DCQA 2MA5A 3N9QA 3JUEA 4XI1A 4LJNA 2VPEA 2M1RA 2VPDA 2LDRA 5SVIB 3ZYQA 2CONA 3LJUX 2CSYA 4YBMA 3VK6A 2EGMA 4V3LC 3QZVA 2VJEA 2L0BA 4CA1A 2JM3A 5B78A 2G6QA 4LK9A 2H0DB 4WA6A 4GNFA 2ECWA 5H1UA 2KYUA 2LAUA 1WESA 3I2DA 4MSXA 4A0CD 2ECTA 5FERA 4AP4A 5B8DA 5H1VA 2L7PA 5DKAA 3DPLR 3N9NA 2MD8C 5D1LB 2XB1A 3M99A 5JG6A 3GV4A 2D8UA 2QIZA 1FP0A 3V43A 2MKEA 1T1HA 4BHWA 5KH9A 4V3KC 3KNVA 1WEPA 2CKLB 4WZ3B 4YABA 3SHBA 2K16A 3DWDA 3KDEC 2VJFB 3U5MA 4R8PK 3FAOA 3M7KA 2EA6A 3KV6A 3MDBC 3O47A 4FO9A 4YAXA 5TDWA 3T7LA 2MIQA 1VFYA 2Y43A 2YU4A 2KU3A 4QQ4A 1K2FA 1WENA 5B79A 2KKXA 2NAAA 5AIUA 2Y1NA 3LRQA 4AUQB 3ASLA 5LKUA 2KR4A 3EB5A 5G05B 5H9MA 2KWNA 4ZDTA 2G45A 2ECJA 2YW8A 2VP7A 4FJCA 3U5OA 2HYED 4YC9A 3Q1DA 3T6RA 4UI9B 1HYJA 2XOYA 2P57A 4B86C 2YT5A 3U5NA 4YBTA 4O64A 3C5KA 3L1ZB 5B77A 5FB0A 3O36A 1WEEA 5J3XA 3DQVR 4LKAA 3DDTA 3GL6A 2KGGA 2E61A 3O34A 2FUIA 3LVRE 2KE1A 2MD7B 4WZ2A 2QJ0A 5B76A 4AYCB 1Z2QA 3EB6A 4YBSA 5LKZA 1JM7A 2C2VS 2MT5A 2D8SA 2JMDA 2CRRA 1WEUA 3ZVYA 2YHOA 3FEHA 3O70A 1DVPA 2M3HA 4AVXA 3U5PA 1WEQA 5TDRA 3SUBA 4GB0A 3HCSA 4L58A 1WE9A 2F42A 2F6JA 2KGIA 5SVYA 1WILA 2L80A 3LDYA 3ZNIA 1WEWA 2ECIA 2QICA 2VPGA 2B0OE 1U6GB 2E6RA 1X4UA 2DX8A 3N9LA 2AN6A 5FEYA 2LGGA 2KFTA 5KH3A 4UP0A 4A4BA 4ZUXU 4FK5A 4O62A 2FD4A 4OGEA 2YUCA 4IC3A 4W4UA 3IHPA 2YSJA 2MA6A 2YREA 5LKTA 2BAYA 4I7BA 4B7YC 2JMJA 4LLBA 2CT2A 4L7XA 2XOCA 2M6MA 2EODA 3HCTA 2FUUA 2JUNA 4OGCA 1BORA 2FSAA 3O7AA 4X3GA 2YYRA 4Z0OA 1LDKC 3LQHA 2LXHC 3O37A 3C6WA 2CSVA 2VPBA 3FANA 1WEOA 2MNYA 2RSDA 2YSMA 3MHSA 5LCWB 5SVXA 3LQJA 5G04B 3H7HA 3KQIA 1JOCA 3ZPV1 2ZETC 1IYMA 2HDPA 4P5OB 2DJAA 1MM3A 1LDJB 2LQ6A 2XOZA 2ECVA 2K4DA 3MHHA 3SOUA 2G43A 3RPGC 1CHCA 2YQMA 3RPGB 2IDAA 1MM2A 4IC2A 4WZ0A 4YATA 4UP5A 2EGPA 2JMIA 4ZQLA 2XEUA 3PLWA 4I7CA 2K1JA 4FIPA 3LVQE 3PURA 1E4UA 2YURA 5K3QA 3N9OA 2XP0A 4R2YA 4PPEA 4F1PA 2LV9A 2JRJA 2YHNA 5FB1A 3T9KA 1WGMA 1VYXA 2IQJA 5SVIA 4GNEA 2LGKA 5B75A 4AYCA 2VJEB 1JM7B 2LRIC 5TBNA 3KV5A 4LADB 2CRWA 3FM8C 1Z60A 2OXQC 5DINA 2H0DA 5KH7A 3M63A 2C2LA 5TABA 1V87A 4CCGX 3N9PA 2ECNA 5H1TA 3E2DA 1X4JA 2E6SA 4A4CA 4N3WA 1MBMA 3L11A 3NG2A 1XWHA 4YADA 2OWAA 4TKPB 2LGVA 1N87A 2L75A 3PUQA 2YQLA 4QF3A 1Z6UA 2MUMA 4I7DA 1WEVA 3FL2A 2Y1MA 5EYAF 2KREA 3FJUB 2RR4A 1G25A 2CKLA 5D1KB 3RTRB 3O33A 2VJFA 5D1MB 2L43A 4H9DA
chains in the Genus database with same CATH topology
1WIMA 3N9MA 2KIZA 5G0FA 2LGLA 2KWKA 1FBVA 5TRBA 2KWOA 3SOWA 3L1XA 4S3OC 4S3OB 1RMDA 1WFKA 2K17A 5I3LA 2F6NA 2ECGA 4NN2A 2PUYA 2RI7A 4MVTA 2MNZA 4GNGA 2CSZA 1X4IA 4R7EA 2LXPC 1VD4A 2PNXA 4PTBA 1F62A 3SOXA 4GNDA 4QF2A 1HYIA 4N4FA 1WEMA 2L5UA 5LKXA 3LQIA 3HTKC 2I50A 2UZGA 2LN0A 5AITA 3HCUA 4Q6FA 3PHDA 3ZVZB 1ZBDB 2KWJA 4C9ZA 4F52B 5C11A 3ZPVE 4A49A 5C13A 3M62A 3O35A 2M85A 4BBQA 2VNFA 3ZTGA 2MA5A 3N9QA 4XI1A 4LJNA 2VPEA 2M1RA 2VPDA 2LDRA 3ZYQA 2CSYA 4YBMA 3VK6A 4V3LC 3QZVA 2VJEA 2L0BA 4CA1A 5B78A 2G6QA 4LK9A 2H0DB 4WA6A 4GNFA 2ECWA 5H1UA 2KYUA 1WESA 3I2DA 4MSXA 4A0CD 2ECTA 5FERA 4AP4A 5B8DA 5H1VA 5DKAA 3DPLR 3N9NA 2MD8C 5D1LB 2XB1A 3M99A 5JG6A 3GV4A 2QIZA 1FP0A 3V43A 1T1HA 4BHWA 5KH9A 4V3KC 3KNVA 1WEPA 2CKLB 4WZ3B 4YABA 3SHBA 2K16A 2VJFB 3U5MA 4R8PK 2EA6A 3KV6A 4FO9A 4YAXA 5TDWA 3T7LA 2MIQA 1VFYA 2Y43A 2YU4A 2KU3A 1K2FA 1WENA 5B79A 2NAAA 5AIUA 2Y1NA 3LRQA 4AUQB 3ASLA 5LKUA 2KR4A 3EB5A 5G05B 5H9MA 2KWNA 4ZDTA 2G45A 2ECJA 2YW8A 2VP7A 4FJCA 3U5OA 2HYED 4YC9A 3T6RA 4UI9B 1HYJA 4B86C 2YT5A 3U5NA 4YBTA 4O64A 3C5KA 3L1ZB 5B77A 5FB0A 3O36A 1WEEA 5J3XA 3DQVR 4LKAA 3GL6A 2KGGA 3O34A 2FUIA 2KE1A 2MD7B 4WZ2A 2QJ0A 5B76A 4AYCB 1Z2QA 3EB6A 4YBSA 5LKZA 1JM7A 2C2VS 2MT5A 2D8SA 2JMDA 1WEUA 3ZVYA 2YHOA 3O70A 1DVPA 2M3HA 4AVXA 3U5PA 1WEQA 5TDRA 4GB0A 3HCSA 4L58A 1WE9A 2F42A 2F6JA 2KGIA 1WILA 2L80A 3ZNIA 1WEWA 2ECIA 2QICA 2VPGA 1U6GB 2E6RA 1X4UA 2DX8A 3N9LA 2AN6A 5FEYA 2LGGA 2KFTA 5KH3A 4UP0A 4A4BA 4ZUXU 4FK5A 2YUCA 4IC3A 4W4UA 3IHPA 2YSJA 2MA6A 2YREA 5LKTA 2BAYA 4I7BA 4B7YC 2JMJA 4LLBA 2CT2A 4L7XA 2M6MA 2EODA 3HCTA 2FUUA 1BORA 2FSAA 3O7AA 4X3GA 2YYRA 1LDKC 3LQHA 2LXHC 3O37A 3C6WA 2VPBA 1WEOA 2MNYA 2RSDA 2YSMA 3MHSA 5LCWB 3LQJA 5G04B 3KQIA 1JOCA 3ZPV1 2ZETC 1IYMA 2HDPA 4P5OB 1MM3A 1LDJB 2LQ6A 2ECVA 2K4DA 3MHHA 3SOUA 2G43A 3RPGC 1CHCA 2YQMA 3RPGB 2IDAA 1MM2A 4IC2A 4WZ0A 4YATA 4UP5A 2EGPA 2JMIA 4ZQLA 2XEUA 4I7CA 2K1JA 4FIPA 3PURA 1E4UA 2YURA 3N9OA 4R2YA 4PPEA 2LV9A 2JRJA 2YHNA 5FB1A 1WGMA 1VYXA 4GNEA 2LGKA 5B75A 4AYCA 2VJEB 1JM7B 2LRIC 5TBNA 3KV5A 4LADB 1Z60A 2OXQC 5DINA 2H0DA 5KH7A 3M63A 2C2LA 5TABA 1V87A 4CCGX 3N9PA 2ECNA 5H1TA 1X4JA 2E6SA 4A4CA 4N3WA 3L11A 3NG2A 1XWHA 4YADA 4TKPB 2LGVA 1N87A 2L75A 3PUQA 2YQLA 4QF3A 1Z6UA 2MUMA 4I7DA 1WEVA 3FL2A 2Y1MA 5EYAF 2KREA 1G25A 2CKLA 5D1KB 3RTRB 3O33A 2VJFA 5D1MB 2L43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WIM A;  3N9M A;  2KIZ A;  5G0F A;  2LGL A;  2KWK A;  1FBV A;  5TRB A;  2KWO A;  3SOW A;  3L1X A;  4S3O C;  4S3O B;  1RMD A;  1WFK A;  2K17 A;  5I3L A;  2F6N A;  2ECG A;  4NN2 A;  2PUY A;  2RI7 A;  4MVT A;  2MNZ A;  4GNG A;  2CSZ A;  1X4I A;  4R7E A;  2LXP C;  1VD4 A;  2PNX A;  4PTB A;  1F62 A;  3SOX A;  4GND A;  4QF2 A;  1HYI A;  4N4F A;  1WEM A;  2L5U A;  5LKX A;  3LQI A;  3HTK C;  2I50 A;  2UZG A;  2LN0 A;  5AIT A;  3HCU A;  4Q6F A;  3PHD A;  3ZVZ B;  1ZBD B;  2KWJ A;  4C9Z A;  4F52 B;  5C11 A;  3ZPV E;  4A49 A;  5C13 A;  3M62 A;  3O35 A;  2M85 A;  4BBQ A;  2VNF A;  3ZTG A;  2MA5 A;  3N9Q A;  4XI1 A;  4LJN A;  2VPE A;  2M1R A;  2VPD A;  2LDR A;  3ZYQ A;  2CSY A;  4YBM A;  3VK6 A;  4V3L C;  3QZV A;  2VJE A;  2L0B A;  4CA1 A;  5B78 A;  2G6Q A;  4LK9 A;  2H0D B;  4WA6 A;  4GNF A;  2ECW A;  5H1U A;  2KYU A;  1WES A;  3I2D A;  4MSX A;  4A0C D;  2ECT A;  5FER A;  4AP4 A;  5B8D A;  5H1V A;  5DKA A;  3DPL R;  3N9N A;  2MD8 C;  5D1L B;  2XB1 A;  3M99 A;  5JG6 A;  3GV4 A;  2QIZ A;  1FP0 A;  3V43 A;  1T1H A;  4BHW A;  5KH9 A;  4V3K C;  3KNV A;  1WEP A;  2CKL B;  4WZ3 B;  4YAB A;  3SHB A;  2K16 A;  2VJF B;  3U5M A;  4R8P K;  2EA6 A;  3KV6 A;  4FO9 A;  4YAX A;  5TDW A;  3T7L A;  2MIQ A;  1VFY A;  2Y43 A;  2YU4 A;  2KU3 A;  1K2F A;  1WEN A;  5B79 A;  2NAA A;  5AIU A;  2Y1N A;  3LRQ A;  4AUQ B;  3ASL A;  5LKU A;  2KR4 A;  3EB5 A;  5G05 B;  5H9M A;  2KWN A;  4ZDT A;  2G45 A;  2ECJ A;  2YW8 A;  2VP7 A;  4FJC A;  3U5O A;  2HYE D;  4YC9 A;  3T6R A;  4UI9 B;  1HYJ A;  4B86 C;  2YT5 A;  3U5N A;  4YBT A;  4O64 A;  3C5K A;  3L1Z B;  5B77 A;  5FB0 A;  3O36 A;  1WEE A;  5J3X A;  3DQV R;  4LKA A;  3GL6 A;  2KGG A;  3O34 A;  2FUI A;  2KE1 A;  2MD7 B;  4WZ2 A;  2QJ0 A;  5B76 A;  4AYC B;  1Z2Q A;  3EB6 A;  4YBS A;  5LKZ A;  1JM7 A;  2C2V S;  2MT5 A;  2D8S A;  2JMD A;  1WEU A;  3ZVY A;  2YHO A;  3O70 A;  1DVP A;  2M3H A;  4AVX A;  3U5P A;  1WEQ A;  5TDR A;  4GB0 A;  3HCS A;  4L58 A;  1WE9 A;  2F42 A;  2F6J A;  2KGI A;  1WIL A;  2L80 A;  3ZNI A;  1WEW A;  2ECI A;  2QIC A;  2VPG A;  1U6G B;  2E6R A;  1X4U A;  2DX8 A;  3N9L A;  2AN6 A;  5FEY A;  2LGG A;  2KFT A;  5KH3 A;  4UP0 A;  4A4B A;  4ZUX U;  4FK5 A;  2YUC A;  4IC3 A;  4W4U A;  3IHP A;  2YSJ A;  2MA6 A;  2YRE A;  5LKT A;  2BAY A;  4I7B A;  4B7Y C;  2JMJ A;  4LLB A;  2CT2 A;  4L7X A;  2M6M A;  2EOD A;  3HCT A;  2FUU A;  1BOR A;  2FSA A;  3O7A A;  4X3G A;  2YYR A;  1LDK C;  3LQH A;  2LXH C;  3O37 A;  3C6W A;  2VPB A;  1WEO A;  2MNY A;  2RSD A;  2YSM A;  3MHS A;  5LCW B;  3LQJ A;  5G04 B;  3KQI A;  1JOC A;  3ZPV 1;  2ZET C;  1IYM A;  2HDP A;  4P5O B;  1MM3 A;  1LDJ B;  2LQ6 A;  2ECV A;  2K4D A;  3MHH A;  3SOU A;  2G43 A;  3RPG C;  1CHC A;  2YQM A;  3RPG B;  2IDA A;  1MM2 A;  4IC2 A;  4WZ0 A;  4YAT A;  4UP5 A;  2EGP A;  2JMI A;  4ZQL A;  2XEU A;  4I7C A;  2K1J A;  4FIP A;  3PUR A;  1E4U A;  2YUR A;  3N9O A;  4R2Y A;  4PPE A;  2LV9 A;  2JRJ A;  2YHN A;  5FB1 A;  1WGM A;  1VYX A;  4GNE A;  2LGK A;  5B75 A;  4AYC A;  2VJE B;  1JM7 B;  2LRI C;  5TBN A;  3KV5 A;  4LAD B;  1Z60 A;  2OXQ C;  5DIN A;  2H0D A;  5KH7 A;  3M63 A;  2C2L A;  5TAB A;  1V87 A;  4CCG X;  3N9P A;  2ECN A;  5H1T A;  1X4J A;  2E6S A;  4A4C A;  4N3W A;  3L11 A;  3NG2 A;  1XWH A;  4YAD A;  4TKP B;  2LGV A;  1N87 A;  2L75 A;  3PUQ A;  2YQL A;  4QF3 A;  1Z6U A;  2MUM A;  4I7D A;  1WEV A;  3FL2 A;  2Y1M A;  5EYA F;  2KRE A;  1G25 A;  2CKL A;  5D1K B;  3RTR B;  3O33 A;  2VJF A;  5D1M B;  2L43 A; 
#chains in the Genus database with same CATH topology
 1WIM A;  3N9M A;  2KIZ A;  5G0F A;  2LGL A;  2KWK A;  1FBV A;  2M13 A;  5TRB A;  2KWO A;  3SOW A;  3L1X A;  4S3O C;  4S3O B;  1RMD A;  1WFK A;  2K17 A;  5I3L A;  2F6N A;  2FFW A;  2YVR A;  2ECG A;  4NN2 A;  2PUY A;  2RI7 A;  4MVT A;  2MNZ A;  4GNG A;  2CSZ A;  1X4I A;  4R7E A;  2LXP C;  1VD4 A;  2PNX A;  4Z0R A;  4PTB A;  1F62 A;  3SOX A;  4GND A;  4QF2 A;  1HYI A;  4N4F A;  1WEM A;  2L5U A;  5LKX A;  3LQI A;  3HTK C;  2I50 A;  2DSM A;  2UZG A;  2LN0 A;  5AIT A;  3HCU A;  4Q6F A;  2KKY A;  3PHD A;  3ZVZ B;  1ZBD B;  2KWJ A;  4C9Z A;  4F52 B;  5C11 A;  3ZPV E;  4A49 A;  5C13 A;  3M62 A;  3O35 A;  2M85 A;  4BBQ A;  2EXU A;  2VNF A;  3ZTG A;  1DCQ A;  2MA5 A;  3N9Q A;  3JUE A;  4XI1 A;  4LJN A;  2VPE A;  2M1R A;  2VPD A;  2LDR A;  5SVI B;  3ZYQ A;  2CON A;  3LJU X;  2CSY A;  4YBM A;  3VK6 A;  2EGM A;  4V3L C;  3QZV A;  2VJE A;  2L0B A;  4CA1 A;  2JM3 A;  5B78 A;  2G6Q A;  4LK9 A;  2H0D B;  4WA6 A;  4GNF A;  2ECW A;  5H1U A;  2KYU A;  2LAU A;  1WES A;  3I2D A;  4MSX A;  4A0C D;  2ECT A;  5FER A;  4AP4 A;  5B8D A;  5H1V A;  2L7P A;  5DKA A;  3DPL R;  3N9N A;  2MD8 C;  5D1L B;  2XB1 A;  3M99 A;  5JG6 A;  3GV4 A;  2D8U A;  2QIZ A;  1FP0 A;  3V43 A;  2MKE A;  1T1H A;  4BHW A;  5KH9 A;  4V3K C;  3KNV A;  1WEP A;  2CKL B;  4WZ3 B;  4YAB A;  3SHB A;  2K16 A;  3DWD A;  3KDE C;  2VJF B;  3U5M A;  4R8P K;  3FAO A;  3M7K A;  2EA6 A;  3KV6 A;  3MDB C;  3O47 A;  4FO9 A;  4YAX A;  5TDW A;  3T7L A;  2MIQ A;  1VFY A;  2Y43 A;  2YU4 A;  2KU3 A;  4QQ4 A;  1K2F A;  1WEN A;  5B79 A;  2KKX A;  2NAA A;  5AIU A;  2Y1N A;  3LRQ A;  4AUQ B;  3ASL A;  5LKU A;  2KR4 A;  3EB5 A;  5G05 B;  5H9M A;  2KWN A;  4ZDT A;  2G45 A;  2ECJ A;  2YW8 A;  2VP7 A;  4FJC A;  3U5O A;  2HYE D;  4YC9 A;  3Q1D A;  3T6R A;  4UI9 B;  1HYJ A;  2XOY A;  2P57 A;  4B86 C;  2YT5 A;  3U5N A;  4YBT A;  4O64 A;  3C5K A;  3L1Z B;  5B77 A;  5FB0 A;  3O36 A;  1WEE A;  5J3X A;  3DQV R;  4LKA A;  3DDT A;  3GL6 A;  2KGG A;  2E61 A;  3O34 A;  2FUI A;  3LVR E;  2KE1 A;  2MD7 B;  4WZ2 A;  2QJ0 A;  5B76 A;  4AYC B;  1Z2Q A;  3EB6 A;  4YBS A;  5LKZ A;  1JM7 A;  2C2V S;  2MT5 A;  2D8S A;  2JMD A;  2CRR A;  1WEU A;  3ZVY A;  2YHO A;  3FEH A;  3O70 A;  1DVP A;  2M3H A;  4AVX A;  3U5P A;  1WEQ A;  5TDR A;  3SUB A;  4GB0 A;  3HCS A;  4L58 A;  1WE9 A;  2F42 A;  2F6J A;  2KGI A;  5SVY A;  1WIL A;  2L80 A;  3LDY A;  3ZNI A;  1WEW A;  2ECI A;  2QIC A;  2VPG A;  2B0O E;  1U6G B;  2E6R A;  1X4U A;  2DX8 A;  3N9L A;  2AN6 A;  5FEY A;  2LGG A;  2KFT A;  5KH3 A;  4UP0 A;  4A4B A;  4ZUX U;  4FK5 A;  4O62 A;  2FD4 A;  4OGE A;  2YUC A;  4IC3 A;  4W4U A;  3IHP A;  2YSJ A;  2MA6 A;  2YRE A;  5LKT A;  2BAY A;  4I7B A;  4B7Y C;  2JMJ A;  4LLB A;  2CT2 A;  4L7X A;  2XOC A;  2M6M A;  2EOD A;  3HCT A;  2FUU A;  2JUN A;  4OGC A;  1BOR A;  2FSA A;  3O7A A;  4X3G A;  2YYR A;  4Z0O A;  1LDK C;  3LQH A;  2LXH C;  3O37 A;  3C6W A;  2CSV A;  2VPB A;  3FAN A;  1WEO A;  2MNY A;  2RSD A;  2YSM A;  3MHS A;  5LCW B;  5SVX A;  3LQJ A;  5G04 B;  3H7H A;  3KQI A;  1JOC A;  3ZPV 1;  2ZET C;  1IYM A;  2HDP A;  4P5O B;  2DJA A;  1MM3 A;  1LDJ B;  2LQ6 A;  2XOZ A;  2ECV A;  2K4D A;  3MHH A;  3SOU A;  2G43 A;  3RPG C;  1CHC A;  2YQM A;  3RPG B;  2IDA A;  1MM2 A;  4IC2 A;  4WZ0 A;  4YAT A;  4UP5 A;  2EGP A;  2JMI A;  4ZQL A;  2XEU A;  3PLW A;  4I7C A;  2K1J A;  4FIP A;  3LVQ E;  3PUR A;  1E4U A;  2YUR A;  5K3Q A;  3N9O A;  2XP0 A;  4R2Y A;  4PPE A;  4F1P A;  2LV9 A;  2JRJ A;  2YHN A;  5FB1 A;  3T9K A;  1WGM A;  1VYX A;  2IQJ A;  5SVI A;  4GNE A;  2LGK A;  5B75 A;  4AYC A;  2VJE B;  1JM7 B;  2LRI C;  5TBN A;  3KV5 A;  4LAD B;  2CRW A;  3FM8 C;  1Z60 A;  2OXQ C;  5DIN A;  2H0D A;  5KH7 A;  3M63 A;  2C2L A;  5TAB A;  1V87 A;  4CCG X;  3N9P A;  2ECN A;  5H1T A;  3E2D A;  1X4J A;  2E6S A;  4A4C A;  4N3W A;  1MBM A;  3L11 A;  3NG2 A;  1XWH A;  4YAD A;  2OWA A;  4TKP B;  2LGV A;  1N87 A;  2L75 A;  3PUQ A;  2YQL A;  4QF3 A;  1Z6U A;  2MUM A;  4I7D A;  1WEV A;  3FL2 A;  2Y1M A;  5EYA F;  2KRE A;  3FJU B;  2RR4 A;  1G25 A;  2CKL A;  5D1K B;  3RTR B;  3O33 A;  2VJF A;  5D1M B;  2L43 A;  4H9D A; 
#chains in the Genus database with same CATH homology
 1WIM A;  3N9M A;  2KIZ A;  5G0F A;  2LGL A;  2KWK A;  1FBV A;  5TRB A;  2KWO A;  3SOW A;  3L1X A;  4S3O C;  4S3O B;  1RMD A;  1WFK A;  2K17 A;  5I3L A;  2F6N A;  2ECG A;  4NN2 A;  2PUY A;  2RI7 A;  4MVT A;  2MNZ A;  4GNG A;  2CSZ A;  1X4I A;  4R7E A;  2LXP C;  1VD4 A;  2PNX A;  4PTB A;  1F62 A;  3SOX A;  4GND A;  4QF2 A;  1HYI A;  4N4F A;  1WEM A;  2L5U A;  5LKX A;  3LQI A;  3HTK C;  2I50 A;  2UZG A;  2LN0 A;  5AIT A;  3HCU A;  4Q6F A;  3PHD A;  3ZVZ B;  1ZBD B;  2KWJ A;  4C9Z A;  4F52 B;  5C11 A;  3ZPV E;  4A49 A;  5C13 A;  3M62 A;  3O35 A;  2M85 A;  4BBQ A;  2VNF A;  3ZTG A;  2MA5 A;  3N9Q A;  4XI1 A;  4LJN A;  2VPE A;  2M1R A;  2VPD A;  2LDR A;  3ZYQ A;  2CSY A;  4YBM A;  3VK6 A;  4V3L C;  3QZV A;  2VJE A;  2L0B A;  4CA1 A;  5B78 A;  2G6Q A;  4LK9 A;  2H0D B;  4WA6 A;  4GNF A;  2ECW A;  5H1U A;  2KYU A;  1WES A;  3I2D A;  4MSX A;  4A0C D;  2ECT A;  5FER A;  4AP4 A;  5B8D A;  5H1V A;  5DKA A;  3DPL R;  3N9N A;  2MD8 C;  5D1L B;  2XB1 A;  3M99 A;  5JG6 A;  3GV4 A;  2QIZ A;  1FP0 A;  3V43 A;  1T1H A;  4BHW A;  5KH9 A;  4V3K C;  3KNV A;  1WEP A;  2CKL B;  4WZ3 B;  4YAB A;  3SHB A;  2K16 A;  2VJF B;  3U5M A;  4R8P K;  2EA6 A;  3KV6 A;  4FO9 A;  4YAX A;  5TDW A;  3T7L A;  2MIQ A;  1VFY A;  2Y43 A;  2YU4 A;  2KU3 A;  1K2F A;  1WEN A;  5B79 A;  2NAA A;  5AIU A;  2Y1N A;  3LRQ A;  4AUQ B;  3ASL A;  5LKU A;  2KR4 A;  3EB5 A;  5G05 B;  5H9M A;  2KWN A;  4ZDT A;  2G45 A;  2ECJ A;  2YW8 A;  2VP7 A;  4FJC A;  3U5O A;  2HYE D;  4YC9 A;  3T6R A;  4UI9 B;  1HYJ A;  4B86 C;  2YT5 A;  3U5N A;  4YBT A;  4O64 A;  3C5K A;  3L1Z B;  5B77 A;  5FB0 A;  3O36 A;  1WEE A;  5J3X A;  3DQV R;  4LKA A;  3GL6 A;  2KGG A;  3O34 A;  2FUI A;  2KE1 A;  2MD7 B;  4WZ2 A;  2QJ0 A;  5B76 A;  4AYC B;  1Z2Q A;  3EB6 A;  4YBS A;  5LKZ A;  1JM7 A;  2C2V S;  2MT5 A;  2D8S A;  2JMD A;  1WEU A;  3ZVY A;  2YHO A;  3O70 A;  1DVP A;  2M3H A;  4AVX A;  3U5P A;  1WEQ A;  5TDR A;  4GB0 A;  3HCS A;  4L58 A;  1WE9 A;  2F42 A;  2F6J A;  2KGI A;  1WIL A;  2L80 A;  3ZNI A;  1WEW A;  2ECI A;  2QIC A;  2VPG A;  1U6G B;  2E6R A;  1X4U A;  2DX8 A;  3N9L A;  2AN6 A;  5FEY A;  2LGG A;  2KFT A;  5KH3 A;  4UP0 A;  4A4B A;  4ZUX U;  4FK5 A;  2YUC A;  4IC3 A;  4W4U A;  3IHP A;  2YSJ A;  2MA6 A;  2YRE A;  5LKT A;  2BAY A;  4I7B A;  4B7Y C;  2JMJ A;  4LLB A;  2CT2 A;  4L7X A;  2M6M A;  2EOD A;  3HCT A;  2FUU A;  1BOR A;  2FSA A;  3O7A A;  4X3G A;  2YYR A;  1LDK C;  3LQH A;  2LXH C;  3O37 A;  3C6W A;  2VPB A;  1WEO A;  2MNY A;  2RSD A;  2YSM A;  3MHS A;  5LCW B;  3LQJ A;  5G04 B;  3KQI A;  1JOC A;  3ZPV 1;  2ZET C;  1IYM A;  2HDP A;  4P5O B;  1MM3 A;  1LDJ B;  2LQ6 A;  2ECV A;  2K4D A;  3MHH A;  3SOU A;  2G43 A;  3RPG C;  1CHC A;  2YQM A;  3RPG B;  2IDA A;  1MM2 A;  4IC2 A;  4WZ0 A;  4YAT A;  4UP5 A;  2EGP A;  2JMI A;  4ZQL A;  2XEU A;  4I7C A;  2K1J A;  4FIP A;  3PUR A;  1E4U A;  2YUR A;  3N9O A;  4R2Y A;  4PPE A;  2LV9 A;  2JRJ A;  2YHN A;  5FB1 A;  1WGM A;  1VYX A;  4GNE A;  2LGK A;  5B75 A;  4AYC A;  2VJE B;  1JM7 B;  2LRI C;  5TBN A;  3KV5 A;  4LAD B;  1Z60 A;  2OXQ C;  5DIN A;  2H0D A;  5KH7 A;  3M63 A;  2C2L A;  5TAB A;  1V87 A;  4CCG X;  3N9P A;  2ECN A;  5H1T A;  1X4J A;  2E6S A;  4A4C A;  4N3W A;  3L11 A;  3NG2 A;  1XWH A;  4YAD A;  4TKP B;  2LGV A;  1N87 A;  2L75 A;  3PUQ A;  2YQL A;  4QF3 A;  1Z6U A;  2MUM A;  4I7D A;  1WEV A;  3FL2 A;  2Y1M A;  5EYA F;  2KRE A;  1G25 A;  2CKL A;  5D1K B;  3RTR B;  3O33 A;  2VJF A;  5D1M B;  2L43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...