1WEUA

Solution structure of phd domain in ing1-like protein bac25009
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
GSSGSSGSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords inhibitor of growth family, member 4
publication title Solution structure of PHD domain in ING1-like protein BAC25009
rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 4
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2004-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1weuA00
2LRIC 1WEQA 1T1HA 3HTKC 4WA6A 3ZNIA 1MM2A 3MHHA 1WE9A 2JMIA 1WEEA 2PNXA 5D1LB 1WEOA 1MM3A 4B7YC 2E6SA 3LQIA 5DINA 4UP0A 5KH9A 3O33A 2YQMA 2F6JA 4ZDTA 3C5KA 2VPBA 2JMDA 2EA6A 5B78A 4PPEA 1K2FA 5LKTA 4LK9A 2QIZA 4FO9A 1JM7B 3ASLA 4F52B 2C2VS 5EYAF 5LKZA 3L1XA 1WEMA 2K17A 3O7AA 1WESA 2CT2A 2ECWA 4NN2A 2Y1MA 1XWHA 2K16A 2L75A 5G05B 4FJCA 5DKAA 3IHPA 1WIMA 2Y1NA 4R2YA 3MHSA 5B8DA 3RPGB 1X4IA 4QF3A 5J3XA 4L7XA 2F6NA 3V43A 3L11A 2LGVA 4YABA 5TBNA 1JM7A 3ZYQA 3ZVYA 4A49A 1WEPA 2MD7B 1F62A 1VD4A 2YT5A 3O37A 5B75A 3KV5A 4GNDA 3N9QA 4GNGA 2YHOA 2RSDA 5FB0A 1LDKC 2HYED 5C13A 4X3GA 2LV9A 2LGKA 4V3LC 4A0CD 2OXQC 1HYJA 2K1JA 4ZQLA 2EODA 4IC2A 2G45A 2YSJA 3ZPV1 3ZPVE 3PUQA 4R8PK 4AVXA 3M62A 2KWKA 2YHNA 3C6WA 2LN0A 2VJEB 1WENA 4I7CA 2MNZA 3SOUA 5D1MB 2KWJA 3U5NA 2JRJA 4BBQA 1VYXA 2FUUA 2ECTA 1V87A 3RTRB 4WZ2A 1VFYA 2KE1A 1RMDA 2KR4A 5LCWB 4R7EA 2M3HA 4QF2A 4YBSA 4Q6FA 5G04B 2YURA 4LADB 4GNEA 4N3WA 4ZUXU 4YC9A 5H9MA 4S3OB 4IC3A 1X4JA 2YSMA 3U5MA 2C2LA 4I7DA 2VJEA 3PHDA 2L43A 4FK5A 4WZ3B 3L1ZB 5H1UA 1WILA 2YW8A 3GV4A 2EGPA 5TRBA 2F42A 2G6QA 4UP5A 4MSXA 2RI7A 3KV6A 2QICA 4LJNA 2LXPC 3N9NA 2M85A 3O36A 3N9OA 3SOXA 2L0BA 4YAXA 1LDJB 5JG6A 4C9ZA 4CA1A 4V3KC 2I50A 2M1RA 2M6MA 2LGGA 2YQLA 5FEYA 4YADA 2MUMA 2L80A 3T6RA 2XEUA 5KH7A 2CSYA 2YU4A 2AN6A 2MT5A 5D1KB 2KREA 2LDRA 5FB1A 1WFKA 3ZTGA 3KNVA 1WEVA 3N9LA 2VNFA 2G43A 5I3LA 1Z6UA 4O64A 1WGMA 2VPEA 3O70A 2L5UA 1JOCA 3VK6A 1FP0A 5KH3A 3U5PA 3LQJA 5H1VA 3SHBA 3KQIA 3PURA 2DX8A 4BHWA 2ECNA 5TDRA 2KGIA 1U6GB 3DQVR 3T7LA 5LKUA 4I7BA 4TKPB 2BAYA 5TDWA 4MVTA 2ECGA 2LGLA 2UZGA 2PUYA 3N9MA 2CKLB 1HYIA 2H0DB 2VJFB 4AP4A 4AYCA 3O35A 3EB6A 4L58A 3U5OA 3DPLR 2VPGA 4N4FA 2LXHC 2YREA 3I2DA 2Y43A 5TABA 2KFTA 2MNYA 2ECIA 2IDAA 1BORA 3EB5A 3M63A 3O34A 2ZETC 4W4UA 2KWNA 5G0FA 2ECJA 2KYUA 2K4DA 3N9PA 2VPDA 4XI1A 1DVPA 5LKXA 4CCGX 2HDPA 5AITA 3LRQA 5B79A 4PTBA 3M99A 4FIPA 1N87A 4LKAA 2FUIA 2NAAA 1ZBDB 2CSZA 3HCUA 5AIUA 2CKLA 3GL6A 2H0DA 2VJFA 2YUCA 2MA5A 2KIZA 2QJ0A 5B76A 1CHCA 2YYRA 4A4BA 1G25A 2FSAA 2MD8C 4AUQB 1Z2QA 4GNFA 4S3OC 4A4CA 2KU3A 4B86C 2MA6A 2JMJA 4P5OB 3FL2A 3LQHA 3QZVA 2ECVA 2KWOA 2XB1A 4WZ0A 2MIQA 1WEUA 4AYCB 2E6RA 5H1TA 5B77A 4GB0A 1X4UA 1WEWA 5FERA 4UI9B 4YBTA 2KGGA 3RPGC 2VP7A 1FBVA 2D8SA 4YBMA 3ZVZB 5C11A 3NG2A 3HCTA 3SOWA 4YATA 3HCSA 4LLBA 1E4UA 2LQ6A 1IYMA 1Z60A
chains in the Genus database with same CATH superfamily
2LRIC 1WEQA 1T1HA 3HTKC 4WA6A 3ZNIA 1MM2A 3MHHA 1WE9A 2JMIA 1WEEA 5SVYA 2PNXA 3FM8C 5D1LB 1WEOA 1MM3A 4B7YC 2E6SA 3LQIA 5DINA 4UP0A 2DSMA 5KH9A 3LDYA 3O33A 2YQMA 2DJAA 2F6JA 2D8UA 4ZDTA 3C5KA 2VPBA 4O62A 2JMDA 2LAUA 2EA6A 5B78A 4PPEA 3SUBA 1K2FA 5LKTA 4LK9A 2QIZA 4FO9A 1JM7B 3ASLA 4F52B 2C2VS 2M13A 5EYAF 5LKZA 3L1XA 1WEMA 2K17A 3O7AA 1WESA 2CT2A 2ECWA 4NN2A 2Y1MA 1XWHA 2K16A 2L75A 5G05B 4FJCA 5DKAA 5SVIB 4F1PA 3IHPA 3FANA 1WIMA 2Y1NA 4R2YA 2KKYA 3MHSA 5B8DA 3RPGB 1X4IA 4QF3A 5J3XA 4L7XA 2F6NA 3MDBC 3V43A 3LJUX 3L11A 2LGVA 2MKEA 4YABA 5TBNA 1JM7A 3ZYQA 3ZVYA 4A49A 1WEPA 2MD7B 1F62A 1VD4A 2YT5A 3O37A 5B75A 3KV5A 4GNDA 2JUNA 3N9QA 3JUEA 2KKXA 4GNGA 1DCQA 2YHOA 2RSDA 5FB0A 1LDKC 2HYED 5SVIA 5C13A 4X3GA 2RR4A 2LV9A 2LGKA 4V3LC 3DWDA 4A0CD 2P57A 2OXQC 1HYJA 2K1JA 4ZQLA 2EODA 4IC2A 2G45A 2XOYA 2YSJA 3ZPV1 3ZPVE 3PUQA 4R8PK 4AVXA 2IQJA 3M62A 2KWKA 2YHNA 3C6WA 2LN0A 3LVQE 2JM3A 2VJEB 1WENA 2XOCA 4I7CA 2MNZA 3SOUA 2FFWA 5D1MB 2KWJA 3U5NA 2JRJA 3M7KA 4BBQA 1VYXA 2FUUA 2ECTA 1V87A 2XP0A 4WZ2A 1VFYA 2KE1A 1RMDA 3RTRB 2KR4A 5LCWB 4R7EA 2M3HA 4H9DA 4QF2A 4YBSA 4Q6FA 2CRWA 5G04B 2YURA 3Q1DA 4LADB 4GNEA 4N3WA 4ZUXU 4YC9A 5H9MA 4S3OB 4IC3A 1X4JA 2YSMA 3KDEC 3U5MA 2C2LA 4I7DA 2VJEA 3PHDA 2L43A 4FK5A 4WZ3B 2B0OE 2E61A 3L1ZB 5H1UA 3DDTA 1WILA 2YW8A 3GV4A 3T9KA 2EGPA 5TRBA 2F42A 2G6QA 4UP5A 4MSXA 2RI7A 3KV6A 2QICA 4LJNA 2LXPC 4QQ4A 3N9NA 1MBMA 2XOZA 2M85A 3O36A 3N9OA 3SOXA 2L0BA 4YAXA 1LDJB 5JG6A 4C9ZA 4CA1A 4V3KC 2I50A 2M1RA 2M6MA 2LGGA 2YQLA 5FEYA 4YADA 2MUMA 2YVRA 2L80A 3T6RA 2XEUA 5KH7A 2CSYA 2YU4A 2AN6A 2MT5A 5D1KB 2KREA 2LDRA 5FB1A 1WFKA 3ZTGA 4Z0OA 2CSVA 2EXUA 3KNVA 3N9LA 4OGEA 1WEVA 5SVXA 2VNFA 2G43A 5I3LA 1Z6UA 4O64A 1WGMA 2VPEA 3O70A 2L5UA 4Z0RA 1JOCA 3VK6A 1FP0A 4OGCA 5KH3A 3E2DA 3U5PA 3LQJA 2EGMA 3PLWA 5H1VA 3LVRE 3SHBA 3KQIA 3PURA 2DX8A 2CONA 2ECNA 4BHWA 5TDRA 2KGIA 1U6GB 3DQVR 3T7LA 5LKUA 4I7BA 4TKPB 2BAYA 5TDWA 4MVTA 2ECGA 2LGLA 2UZGA 2PUYA 3N9MA 2CKLB 1HYIA 2H0DB 2VJFB 4AP4A 3FEHA 4AYCA 3O35A 3EB6A 4L58A 3U5OA 3DPLR 2VPGA 4N4FA 2LXHC 2YREA 2L7PA 3I2DA 2Y43A 5TABA 2KFTA 2MNYA 2ECIA 2IDAA 1BORA 3EB5A 3M63A 3O34A 2ZETC 4W4UA 2KWNA 5G0FA 2ECJA 2KYUA 2CRRA 2K4DA 3N9PA 2VPDA 4XI1A 1DVPA 5LKXA 4CCGX 2HDPA 5AITA 3LRQA 5B79A 4PTBA 3M99A 3FAOA 4FIPA 1N87A 4LKAA 2FUIA 2NAAA 1ZBDB 2CSZA 3HCUA 5AIUA 2CKLA 3GL6A 2H0DA 2VJFA 2OWAA 2YUCA 2MA5A 2KIZA 2QJ0A 5B76A 1CHCA 2YYRA 4A4BA 1G25A 2FSAA 2FD4A 2MD8C 4AUQB 5K3QA 1Z2QA 3O47A 4GNFA 4S3OC 4A4CA 2KU3A 4B86C 2MA6A 2JMJA 4P5OB 3FL2A 3LQHA 3QZVA 2ECVA 2KWOA 2XB1A 4WZ0A 2MIQA 1WEUA 4AYCB 2E6RA 5H1TA 5B77A 4GB0A 1X4UA 1WEWA 5FERA 4UI9B 4YBTA 2KGGA 3RPGC 2VP7A 1FBVA 2D8SA 4YBMA 3ZVZB 5C11A 3NG2A 3HCTA 3SOWA 4YATA 3HCSA 4LLBA 3H7HA 1E4UA 3FJUB 2LQ6A 1IYMA 1Z60A
chains in the Genus database with same CATH topology
2LRIC 1WEQA 1T1HA 3HTKC 4WA6A 3ZNIA 1MM2A 3MHHA 1WE9A 2JMIA 1WEEA 2PNXA 5D1LB 1WEOA 1MM3A 4B7YC 2E6SA 3LQIA 5DINA 4UP0A 5KH9A 3O33A 2YQMA 2F6JA 4ZDTA 3C5KA 2VPBA 2JMDA 2EA6A 5B78A 4PPEA 1K2FA 5LKTA 4LK9A 2QIZA 4FO9A 1JM7B 3ASLA 4F52B 2C2VS 5EYAF 5LKZA 3L1XA 1WEMA 2K17A 3O7AA 1WESA 2CT2A 2ECWA 4NN2A 2Y1MA 1XWHA 2K16A 2L75A 5G05B 4FJCA 5DKAA 3IHPA 1WIMA 2Y1NA 4R2YA 3MHSA 5B8DA 3RPGB 1X4IA 4QF3A 5J3XA 4L7XA 2F6NA 3V43A 3L11A 2LGVA 4YABA 5TBNA 1JM7A 3ZYQA 3ZVYA 4A49A 1WEPA 2MD7B 1F62A 1VD4A 2YT5A 3O37A 5B75A 3KV5A 4GNDA 3N9QA 4GNGA 2YHOA 2RSDA 5FB0A 1LDKC 2HYED 5C13A 4X3GA 2LV9A 2LGKA 4V3LC 4A0CD 2OXQC 1HYJA 2K1JA 4ZQLA 2EODA 4IC2A 2G45A 2YSJA 3ZPV1 3ZPVE 3PUQA 4R8PK 4AVXA 3M62A 2KWKA 2YHNA 3C6WA 2LN0A 2VJEB 1WENA 4I7CA 2MNZA 3SOUA 5D1MB 2KWJA 3U5NA 2JRJA 4BBQA 1VYXA 2FUUA 2ECTA 1V87A 3RTRB 4WZ2A 1VFYA 2KE1A 1RMDA 2KR4A 5LCWB 4R7EA 2M3HA 4QF2A 4YBSA 4Q6FA 5G04B 2YURA 4LADB 4GNEA 4N3WA 4ZUXU 4YC9A 5H9MA 4S3OB 4IC3A 1X4JA 2YSMA 3U5MA 2C2LA 4I7DA 2VJEA 3PHDA 2L43A 4FK5A 4WZ3B 3L1ZB 5H1UA 1WILA 2YW8A 3GV4A 2EGPA 5TRBA 2F42A 2G6QA 4UP5A 4MSXA 2RI7A 3KV6A 2QICA 4LJNA 2LXPC 3N9NA 2M85A 3O36A 3N9OA 3SOXA 2L0BA 4YAXA 1LDJB 5JG6A 4C9ZA 4CA1A 4V3KC 2I50A 2M1RA 2M6MA 2LGGA 2YQLA 5FEYA 4YADA 2MUMA 2L80A 3T6RA 2XEUA 5KH7A 2CSYA 2YU4A 2AN6A 2MT5A 5D1KB 2KREA 2LDRA 5FB1A 1WFKA 3ZTGA 3KNVA 1WEVA 3N9LA 2VNFA 2G43A 5I3LA 1Z6UA 4O64A 1WGMA 2VPEA 3O70A 2L5UA 1JOCA 3VK6A 1FP0A 5KH3A 3U5PA 3LQJA 5H1VA 3SHBA 3KQIA 3PURA 2DX8A 4BHWA 2ECNA 5TDRA 2KGIA 1U6GB 3DQVR 3T7LA 5LKUA 4I7BA 4TKPB 2BAYA 5TDWA 4MVTA 2ECGA 2LGLA 2UZGA 2PUYA 3N9MA 2CKLB 1HYIA 2H0DB 2VJFB 4AP4A 4AYCA 3O35A 3EB6A 4L58A 3U5OA 3DPLR 2VPGA 4N4FA 2LXHC 2YREA 3I2DA 2Y43A 5TABA 2KFTA 2MNYA 2ECIA 2IDAA 1BORA 3EB5A 3M63A 3O34A 2ZETC 4W4UA 2KWNA 5G0FA 2ECJA 2KYUA 2K4DA 3N9PA 2VPDA 4XI1A 1DVPA 5LKXA 4CCGX 2HDPA 5AITA 3LRQA 5B79A 4PTBA 3M99A 4FIPA 1N87A 4LKAA 2FUIA 2NAAA 1ZBDB 2CSZA 3HCUA 5AIUA 2CKLA 3GL6A 2H0DA 2VJFA 2YUCA 2MA5A 2KIZA 2QJ0A 5B76A 1CHCA 2YYRA 4A4BA 1G25A 2FSAA 2MD8C 4AUQB 1Z2QA 4GNFA 4S3OC 4A4CA 2KU3A 4B86C 2MA6A 2JMJA 4P5OB 3FL2A 3LQHA 3QZVA 2ECVA 2KWOA 2XB1A 4WZ0A 2MIQA 1WEUA 4AYCB 2E6RA 5H1TA 5B77A 4GB0A 1X4UA 1WEWA 5FERA 4UI9B 4YBTA 2KGGA 3RPGC 2VP7A 1FBVA 2D8SA 4YBMA 3ZVZB 5C11A 3NG2A 3HCTA 3SOWA 4YATA 3HCSA 4LLBA 1E4UA 2LQ6A 1IYMA 1Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRI C;  1WEQ A;  1T1H A;  3HTK C;  4WA6 A;  3ZNI A;  1MM2 A;  3MHH A;  1WE9 A;  2JMI A;  1WEE A;  2PNX A;  5D1L B;  1WEO A;  1MM3 A;  4B7Y C;  2E6S A;  3LQI A;  5DIN A;  4UP0 A;  5KH9 A;  3O33 A;  2YQM A;  2F6J A;  4ZDT A;  3C5K A;  2VPB A;  2JMD A;  2EA6 A;  5B78 A;  4PPE A;  1K2F A;  5LKT A;  4LK9 A;  2QIZ A;  4FO9 A;  1JM7 B;  3ASL A;  4F52 B;  2C2V S;  5EYA F;  5LKZ A;  3L1X A;  1WEM A;  2K17 A;  3O7A A;  1WES A;  2CT2 A;  2ECW A;  4NN2 A;  2Y1M A;  1XWH A;  2K16 A;  2L75 A;  5G05 B;  4FJC A;  5DKA A;  3IHP A;  1WIM A;  2Y1N A;  4R2Y A;  3MHS A;  5B8D A;  3RPG B;  1X4I A;  4QF3 A;  5J3X A;  4L7X A;  2F6N A;  3V43 A;  3L11 A;  2LGV A;  4YAB A;  5TBN A;  1JM7 A;  3ZYQ A;  3ZVY A;  4A49 A;  1WEP A;  2MD7 B;  1F62 A;  1VD4 A;  2YT5 A;  3O37 A;  5B75 A;  3KV5 A;  4GND A;  3N9Q A;  4GNG A;  2YHO A;  2RSD A;  5FB0 A;  1LDK C;  2HYE D;  5C13 A;  4X3G A;  2LV9 A;  2LGK A;  4V3L C;  4A0C D;  2OXQ C;  1HYJ A;  2K1J A;  4ZQL A;  2EOD A;  4IC2 A;  2G45 A;  2YSJ A;  3ZPV 1;  3ZPV E;  3PUQ A;  4R8P K;  4AVX A;  3M62 A;  2KWK A;  2YHN A;  3C6W A;  2LN0 A;  2VJE B;  1WEN A;  4I7C A;  2MNZ A;  3SOU A;  5D1M B;  2KWJ A;  3U5N A;  2JRJ A;  4BBQ A;  1VYX A;  2FUU A;  2ECT A;  1V87 A;  3RTR B;  4WZ2 A;  1VFY A;  2KE1 A;  1RMD A;  2KR4 A;  5LCW B;  4R7E A;  2M3H A;  4QF2 A;  4YBS A;  4Q6F A;  5G04 B;  2YUR A;  4LAD B;  4GNE A;  4N3W A;  4ZUX U;  4YC9 A;  5H9M A;  4S3O B;  4IC3 A;  1X4J A;  2YSM A;  3U5M A;  2C2L A;  4I7D A;  2VJE A;  3PHD A;  2L43 A;  4FK5 A;  4WZ3 B;  3L1Z B;  5H1U A;  1WIL A;  2YW8 A;  3GV4 A;  2EGP A;  5TRB A;  2F42 A;  2G6Q A;  4UP5 A;  4MSX A;  2RI7 A;  3KV6 A;  2QIC A;  4LJN A;  2LXP C;  3N9N A;  2M85 A;  3O36 A;  3N9O A;  3SOX A;  2L0B A;  4YAX A;  1LDJ B;  5JG6 A;  4C9Z A;  4CA1 A;  4V3K C;  2I50 A;  2M1R A;  2M6M A;  2LGG A;  2YQL A;  5FEY A;  4YAD A;  2MUM A;  2L80 A;  3T6R A;  2XEU A;  5KH7 A;  2CSY A;  2YU4 A;  2AN6 A;  2MT5 A;  5D1K B;  2KRE A;  2LDR A;  5FB1 A;  1WFK A;  3ZTG A;  3KNV A;  1WEV A;  3N9L A;  2VNF A;  2G43 A;  5I3L A;  1Z6U A;  4O64 A;  1WGM A;  2VPE A;  3O70 A;  2L5U A;  1JOC A;  3VK6 A;  1FP0 A;  5KH3 A;  3U5P A;  3LQJ A;  5H1V A;  3SHB A;  3KQI A;  3PUR A;  2DX8 A;  4BHW A;  2ECN A;  5TDR A;  2KGI A;  1U6G B;  3DQV R;  3T7L A;  5LKU A;  4I7B A;  4TKP B;  2BAY A;  5TDW A;  4MVT A;  2ECG A;  2LGL A;  2UZG A;  2PUY A;  3N9M A;  2CKL B;  1HYI A;  2H0D B;  2VJF B;  4AP4 A;  4AYC A;  3O35 A;  3EB6 A;  4L58 A;  3U5O A;  3DPL R;  2VPG A;  4N4F A;  2LXH C;  2YRE A;  3I2D A;  2Y43 A;  5TAB A;  2KFT A;  2MNY A;  2ECI A;  2IDA A;  1BOR A;  3EB5 A;  3M63 A;  3O34 A;  2ZET C;  4W4U A;  2KWN A;  5G0F A;  2ECJ A;  2KYU A;  2K4D A;  3N9P A;  2VPD A;  4XI1 A;  1DVP A;  5LKX A;  4CCG X;  2HDP A;  5AIT A;  3LRQ A;  5B79 A;  4PTB A;  3M99 A;  4FIP A;  1N87 A;  4LKA A;  2FUI A;  2NAA A;  1ZBD B;  2CSZ A;  3HCU A;  5AIU A;  2CKL A;  3GL6 A;  2H0D A;  2VJF A;  2YUC A;  2MA5 A;  2KIZ A;  2QJ0 A;  5B76 A;  1CHC A;  2YYR A;  4A4B A;  1G25 A;  2FSA A;  2MD8 C;  4AUQ B;  1Z2Q A;  4GNF A;  4S3O C;  4A4C A;  2KU3 A;  4B86 C;  2MA6 A;  2JMJ A;  4P5O B;  3FL2 A;  3LQH A;  3QZV A;  2ECV A;  2KWO A;  2XB1 A;  4WZ0 A;  2MIQ A;  1WEU A;  4AYC B;  2E6R A;  5H1T A;  5B77 A;  4GB0 A;  1X4U A;  1WEW A;  5FER A;  4UI9 B;  4YBT A;  2KGG A;  3RPG C;  2VP7 A;  1FBV A;  2D8S A;  4YBM A;  3ZVZ B;  5C11 A;  3NG2 A;  3HCT A;  3SOW A;  4YAT A;  3HCS A;  4LLB A;  1E4U A;  2LQ6 A;  1IYM A;  1Z60 A; 
#chains in the Genus database with same CATH topology
 2LRI C;  1WEQ A;  1T1H A;  3HTK C;  4WA6 A;  3ZNI A;  1MM2 A;  3MHH A;  1WE9 A;  2JMI A;  1WEE A;  5SVY A;  2PNX A;  3FM8 C;  5D1L B;  1WEO A;  1MM3 A;  4B7Y C;  2E6S A;  3LQI A;  5DIN A;  4UP0 A;  2DSM A;  5KH9 A;  3LDY A;  3O33 A;  2YQM A;  2DJA A;  2F6J A;  2D8U A;  4ZDT A;  3C5K A;  2VPB A;  4O62 A;  2JMD A;  2LAU A;  2EA6 A;  5B78 A;  4PPE A;  3SUB A;  1K2F A;  5LKT A;  4LK9 A;  2QIZ A;  4FO9 A;  1JM7 B;  3ASL A;  4F52 B;  2C2V S;  2M13 A;  5EYA F;  5LKZ A;  3L1X A;  1WEM A;  2K17 A;  3O7A A;  1WES A;  2CT2 A;  2ECW A;  4NN2 A;  2Y1M A;  1XWH A;  2K16 A;  2L75 A;  5G05 B;  4FJC A;  5DKA A;  5SVI B;  4F1P A;  3IHP A;  3FAN A;  1WIM A;  2Y1N A;  4R2Y A;  2KKY A;  3MHS A;  5B8D A;  3RPG B;  1X4I A;  4QF3 A;  5J3X A;  4L7X A;  2F6N A;  3MDB C;  3V43 A;  3LJU X;  3L11 A;  2LGV A;  2MKE A;  4YAB A;  5TBN A;  1JM7 A;  3ZYQ A;  3ZVY A;  4A49 A;  1WEP A;  2MD7 B;  1F62 A;  1VD4 A;  2YT5 A;  3O37 A;  5B75 A;  3KV5 A;  4GND A;  2JUN A;  3N9Q A;  3JUE A;  2KKX A;  4GNG A;  1DCQ A;  2YHO A;  2RSD A;  5FB0 A;  1LDK C;  2HYE D;  5SVI A;  5C13 A;  4X3G A;  2RR4 A;  2LV9 A;  2LGK A;  4V3L C;  3DWD A;  4A0C D;  2P57 A;  2OXQ C;  1HYJ A;  2K1J A;  4ZQL A;  2EOD A;  4IC2 A;  2G45 A;  2XOY A;  2YSJ A;  3ZPV 1;  3ZPV E;  3PUQ A;  4R8P K;  4AVX A;  2IQJ A;  3M62 A;  2KWK A;  2YHN A;  3C6W A;  2LN0 A;  3LVQ E;  2JM3 A;  2VJE B;  1WEN A;  2XOC A;  4I7C A;  2MNZ A;  3SOU A;  2FFW A;  5D1M B;  2KWJ A;  3U5N A;  2JRJ A;  3M7K A;  4BBQ A;  1VYX A;  2FUU A;  2ECT A;  1V87 A;  2XP0 A;  4WZ2 A;  1VFY A;  2KE1 A;  1RMD A;  3RTR B;  2KR4 A;  5LCW B;  4R7E A;  2M3H A;  4H9D A;  4QF2 A;  4YBS A;  4Q6F A;  2CRW A;  5G04 B;  2YUR A;  3Q1D A;  4LAD B;  4GNE A;  4N3W A;  4ZUX U;  4YC9 A;  5H9M A;  4S3O B;  4IC3 A;  1X4J A;  2YSM A;  3KDE C;  3U5M A;  2C2L A;  4I7D A;  2VJE A;  3PHD A;  2L43 A;  4FK5 A;  4WZ3 B;  2B0O E;  2E61 A;  3L1Z B;  5H1U A;  3DDT A;  1WIL A;  2YW8 A;  3GV4 A;  3T9K A;  2EGP A;  5TRB A;  2F42 A;  2G6Q A;  4UP5 A;  4MSX A;  2RI7 A;  3KV6 A;  2QIC A;  4LJN A;  2LXP C;  4QQ4 A;  3N9N A;  1MBM A;  2XOZ A;  2M85 A;  3O36 A;  3N9O A;  3SOX A;  2L0B A;  4YAX A;  1LDJ B;  5JG6 A;  4C9Z A;  4CA1 A;  4V3K C;  2I50 A;  2M1R A;  2M6M A;  2LGG A;  2YQL A;  5FEY A;  4YAD A;  2MUM A;  2YVR A;  2L80 A;  3T6R A;  2XEU A;  5KH7 A;  2CSY A;  2YU4 A;  2AN6 A;  2MT5 A;  5D1K B;  2KRE A;  2LDR A;  5FB1 A;  1WFK A;  3ZTG A;  4Z0O A;  2CSV A;  2EXU A;  3KNV A;  3N9L A;  4OGE A;  1WEV A;  5SVX A;  2VNF A;  2G43 A;  5I3L A;  1Z6U A;  4O64 A;  1WGM A;  2VPE A;  3O70 A;  2L5U A;  4Z0R A;  1JOC A;  3VK6 A;  1FP0 A;  4OGC A;  5KH3 A;  3E2D A;  3U5P A;  3LQJ A;  2EGM A;  3PLW A;  5H1V A;  3LVR E;  3SHB A;  3KQI A;  3PUR A;  2DX8 A;  2CON A;  2ECN A;  4BHW A;  5TDR A;  2KGI A;  1U6G B;  3DQV R;  3T7L A;  5LKU A;  4I7B A;  4TKP B;  2BAY A;  5TDW A;  4MVT A;  2ECG A;  2LGL A;  2UZG A;  2PUY A;  3N9M A;  2CKL B;  1HYI A;  2H0D B;  2VJF B;  4AP4 A;  3FEH A;  4AYC A;  3O35 A;  3EB6 A;  4L58 A;  3U5O A;  3DPL R;  2VPG A;  4N4F A;  2LXH C;  2YRE A;  2L7P A;  3I2D A;  2Y43 A;  5TAB A;  2KFT A;  2MNY A;  2ECI A;  2IDA A;  1BOR A;  3EB5 A;  3M63 A;  3O34 A;  2ZET C;  4W4U A;  2KWN A;  5G0F A;  2ECJ A;  2KYU A;  2CRR A;  2K4D A;  3N9P A;  2VPD A;  4XI1 A;  1DVP A;  5LKX A;  4CCG X;  2HDP A;  5AIT A;  3LRQ A;  5B79 A;  4PTB A;  3M99 A;  3FAO A;  4FIP A;  1N87 A;  4LKA A;  2FUI A;  2NAA A;  1ZBD B;  2CSZ A;  3HCU A;  5AIU A;  2CKL A;  3GL6 A;  2H0D A;  2VJF A;  2OWA A;  2YUC A;  2MA5 A;  2KIZ A;  2QJ0 A;  5B76 A;  1CHC A;  2YYR A;  4A4B A;  1G25 A;  2FSA A;  2FD4 A;  2MD8 C;  4AUQ B;  5K3Q A;  1Z2Q A;  3O47 A;  4GNF A;  4S3O C;  4A4C A;  2KU3 A;  4B86 C;  2MA6 A;  2JMJ A;  4P5O B;  3FL2 A;  3LQH A;  3QZV A;  2ECV A;  2KWO A;  2XB1 A;  4WZ0 A;  2MIQ A;  1WEU A;  4AYC B;  2E6R A;  5H1T A;  5B77 A;  4GB0 A;  1X4U A;  1WEW A;  5FER A;  4UI9 B;  4YBT A;  2KGG A;  3RPG C;  2VP7 A;  1FBV A;  2D8S A;  4YBM A;  3ZVZ B;  5C11 A;  3NG2 A;  3HCT A;  3SOW A;  4YAT A;  3HCS A;  4LLB A;  3H7H A;  1E4U A;  3FJU B;  2LQ6 A;  1IYM A;  1Z60 A; 
#chains in the Genus database with same CATH homology
 2LRI C;  1WEQ A;  1T1H A;  3HTK C;  4WA6 A;  3ZNI A;  1MM2 A;  3MHH A;  1WE9 A;  2JMI A;  1WEE A;  2PNX A;  5D1L B;  1WEO A;  1MM3 A;  4B7Y C;  2E6S A;  3LQI A;  5DIN A;  4UP0 A;  5KH9 A;  3O33 A;  2YQM A;  2F6J A;  4ZDT A;  3C5K A;  2VPB A;  2JMD A;  2EA6 A;  5B78 A;  4PPE A;  1K2F A;  5LKT A;  4LK9 A;  2QIZ A;  4FO9 A;  1JM7 B;  3ASL A;  4F52 B;  2C2V S;  5EYA F;  5LKZ A;  3L1X A;  1WEM A;  2K17 A;  3O7A A;  1WES A;  2CT2 A;  2ECW A;  4NN2 A;  2Y1M A;  1XWH A;  2K16 A;  2L75 A;  5G05 B;  4FJC A;  5DKA A;  3IHP A;  1WIM A;  2Y1N A;  4R2Y A;  3MHS A;  5B8D A;  3RPG B;  1X4I A;  4QF3 A;  5J3X A;  4L7X A;  2F6N A;  3V43 A;  3L11 A;  2LGV A;  4YAB A;  5TBN A;  1JM7 A;  3ZYQ A;  3ZVY A;  4A49 A;  1WEP A;  2MD7 B;  1F62 A;  1VD4 A;  2YT5 A;  3O37 A;  5B75 A;  3KV5 A;  4GND A;  3N9Q A;  4GNG A;  2YHO A;  2RSD A;  5FB0 A;  1LDK C;  2HYE D;  5C13 A;  4X3G A;  2LV9 A;  2LGK A;  4V3L C;  4A0C D;  2OXQ C;  1HYJ A;  2K1J A;  4ZQL A;  2EOD A;  4IC2 A;  2G45 A;  2YSJ A;  3ZPV 1;  3ZPV E;  3PUQ A;  4R8P K;  4AVX A;  3M62 A;  2KWK A;  2YHN A;  3C6W A;  2LN0 A;  2VJE B;  1WEN A;  4I7C A;  2MNZ A;  3SOU A;  5D1M B;  2KWJ A;  3U5N A;  2JRJ A;  4BBQ A;  1VYX A;  2FUU A;  2ECT A;  1V87 A;  3RTR B;  4WZ2 A;  1VFY A;  2KE1 A;  1RMD A;  2KR4 A;  5LCW B;  4R7E A;  2M3H A;  4QF2 A;  4YBS A;  4Q6F A;  5G04 B;  2YUR A;  4LAD B;  4GNE A;  4N3W A;  4ZUX U;  4YC9 A;  5H9M A;  4S3O B;  4IC3 A;  1X4J A;  2YSM A;  3U5M A;  2C2L A;  4I7D A;  2VJE A;  3PHD A;  2L43 A;  4FK5 A;  4WZ3 B;  3L1Z B;  5H1U A;  1WIL A;  2YW8 A;  3GV4 A;  2EGP A;  5TRB A;  2F42 A;  2G6Q A;  4UP5 A;  4MSX A;  2RI7 A;  3KV6 A;  2QIC A;  4LJN A;  2LXP C;  3N9N A;  2M85 A;  3O36 A;  3N9O A;  3SOX A;  2L0B A;  4YAX A;  1LDJ B;  5JG6 A;  4C9Z A;  4CA1 A;  4V3K C;  2I50 A;  2M1R A;  2M6M A;  2LGG A;  2YQL A;  5FEY A;  4YAD A;  2MUM A;  2L80 A;  3T6R A;  2XEU A;  5KH7 A;  2CSY A;  2YU4 A;  2AN6 A;  2MT5 A;  5D1K B;  2KRE A;  2LDR A;  5FB1 A;  1WFK A;  3ZTG A;  3KNV A;  1WEV A;  3N9L A;  2VNF A;  2G43 A;  5I3L A;  1Z6U A;  4O64 A;  1WGM A;  2VPE A;  3O70 A;  2L5U A;  1JOC A;  3VK6 A;  1FP0 A;  5KH3 A;  3U5P A;  3LQJ A;  5H1V A;  3SHB A;  3KQI A;  3PUR A;  2DX8 A;  4BHW A;  2ECN A;  5TDR A;  2KGI A;  1U6G B;  3DQV R;  3T7L A;  5LKU A;  4I7B A;  4TKP B;  2BAY A;  5TDW A;  4MVT A;  2ECG A;  2LGL A;  2UZG A;  2PUY A;  3N9M A;  2CKL B;  1HYI A;  2H0D B;  2VJF B;  4AP4 A;  4AYC A;  3O35 A;  3EB6 A;  4L58 A;  3U5O A;  3DPL R;  2VPG A;  4N4F A;  2LXH C;  2YRE A;  3I2D A;  2Y43 A;  5TAB A;  2KFT A;  2MNY A;  2ECI A;  2IDA A;  1BOR A;  3EB5 A;  3M63 A;  3O34 A;  2ZET C;  4W4U A;  2KWN A;  5G0F A;  2ECJ A;  2KYU A;  2K4D A;  3N9P A;  2VPD A;  4XI1 A;  1DVP A;  5LKX A;  4CCG X;  2HDP A;  5AIT A;  3LRQ A;  5B79 A;  4PTB A;  3M99 A;  4FIP A;  1N87 A;  4LKA A;  2FUI A;  2NAA A;  1ZBD B;  2CSZ A;  3HCU A;  5AIU A;  2CKL A;  3GL6 A;  2H0D A;  2VJF A;  2YUC A;  2MA5 A;  2KIZ A;  2QJ0 A;  5B76 A;  1CHC A;  2YYR A;  4A4B A;  1G25 A;  2FSA A;  2MD8 C;  4AUQ B;  1Z2Q A;  4GNF A;  4S3O C;  4A4C A;  2KU3 A;  4B86 C;  2MA6 A;  2JMJ A;  4P5O B;  3FL2 A;  3LQH A;  3QZV A;  2ECV A;  2KWO A;  2XB1 A;  4WZ0 A;  2MIQ A;  1WEU A;  4AYC B;  2E6R A;  5H1T A;  5B77 A;  4GB0 A;  1X4U A;  1WEW A;  5FER A;  4UI9 B;  4YBT A;  2KGG A;  3RPG C;  2VP7 A;  1FBV A;  2D8S A;  4YBM A;  3ZVZ B;  5C11 A;  3NG2 A;  3HCT A;  3SOW A;  4YAT A;  3HCS A;  4LLB A;  1E4U A;  2LQ6 A;  1IYM A;  1Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...