2H0DA

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
TRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/ligase
molecule keywords B lymphoma Mo-MLV insertion region
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dA00
3LQJA 1X4UA 1Z6UA 3N9PA 4A0CD 2CT2A 3O36A 4BBQA 4P5OB 3EB6A 3I2DA 4QF2A 1DVPA 2IDAA 4LKAA 2YT5A 5C11A 5C13A 1WEQA 3T7LA 5LCWB 4FIPA 3PHDA 3C5KA 4LLBA 2Y1MA 1X4JA 3L1ZB 2VP7A 4B7YC 1IYMA 3NG2A 2D8SA 4LK9A 3N9NA 2ECIA 4IC3A 3U5MA 2YURA 2KFTA 2YW8A 1WIMA 2L75A 4GNDA 2EGPA 1E4UA 2RSDA 3N9OA 1WFKA 2UZGA 3HTKC 1WEOA 2LGGA 5FEYA 4R7EA 4I7CA 2K4DA 4I7DA 2NAAA 4YBMA 1WEEA 2VPDA 1N87A 2YSMA 3PURA 2VJFB 2XEUA 2KR4A 1LDJB 5G0FA 2YQLA 5DINA 1LDKC 4A4BA 1U6GB 2F42A 4S3OB 2CKLB 1MM3A 2CKLA 3V43A 4FJCA 4XI1A 5J3XA 2PUYA 3ASLA 4IC2A 4W4UA 2M3HA 4A4CA 2RI7A 4PTBA 4GB0A 3SOWA 4AUQB 5H1UA 2KWJA 3DQVR 2K17A 4I7BA 2JMJA 2YHOA 2PNXA 4FK5A 1JM7A 2YU4A 1JM7B 4V3KC 1WGMA 3O35A 3O34A 2VPGA 2E6SA 3C6WA 3PUQA 3DPLR 3U5OA 5DKAA 1XWHA 4YATA 4CCGX 3FL2A 4YC9A 1WEWA 4NN2A 3M63A 5AIUA 3GL6A 4B86C 1VYXA 2Y1NA 2M1RA 1X4IA 2DX8A 2VJFA 1HYIA 2L43A 4X3GA 2MA6A 1WE9A 5LKTA 2MIQA 3IHPA 4GNGA 2K1JA 1G25A 5KH7A 2MUMA 4A49A 3O33A 2KWOA 4UI9B 1ZBDB 2MA5A 2E6RA 2Y43A 3GV4A 4YABA 5JG6A 3KQIA 4GNFA 1HYJA 4WZ0A 1V87A 3O37A 1WENA 3LQIA 4UP5A 2HDPA 4N3WA 5G04B 2ECJA 5D1LB 4ZUXU 4ZDTA 4WA6A 2JMDA 5D1MB 3RPGC 3LQHA 3ZVYA 2L80A 3O7AA 2LGVA 2MNZA 2LQ6A 3RTRB 3N9QA 2L5UA 2EODA 4AYCA 1K2FA 4AYCB 3QZVA 1VD4A 3ZTGA 2KGGA 2LDRA 2VNFA 3ZVZB 2F6JA 3ZPV1 2YUCA 4MSXA 2KE1A 2MT5A 2VJEB 5FB1A 1WEMA 2ECNA 5LKUA 3L11A 4YBTA 4YADA 1FBVA 5D1KB 5KH3A 3LRQA 2HYED 2LV9A 3KV5A 4AVXA 2LN0A 4FO9A 4V3LC 1F62A 4L7XA 5H9MA 1Z2QA 2QJ0A 3MHHA 4S3OC 2YREA 2OXQC 2G6QA 3SOXA 2VPBA 2MNYA 3N9LA 3RPGB 2YHNA 4CA1A 2ECWA 3ZPVE 1WILA 3T6RA 1WEPA 2FSAA 2KREA 2G45A 5FERA 2BAYA 3EB5A 4LJNA 2KU3A 4MVTA 5TABA 2QICA 5KH9A 2CSZA 3ZYQA 2ZETC 3L1XA 1WEVA 2ECTA 1CHCA 2KGIA 4YBSA 5EYAF 4F52B 1JOCA 2G43A 2L0BA 2M6MA 1Z60A 5G05B 2M85A 4WZ3B 2KWKA 4PPEA 3O70A 3HCSA 2LXHC 2FUIA 4AP4A 2LGLA 4UP0A 2H0DB 5I3LA 2KWNA 2LGKA 3ZNIA 3HCUA 4QF3A 4Q6FA 4R8PK 4O64A 1WEUA 5FB0A 2C2LA 5LKXA 5H1VA 2KIZA 3HCTA 2CSYA 4YAXA 5TDRA 3SHBA 1BORA 2I50A 3VK6A 1WESA 2EA6A 2JMIA 2LXPC 4C9ZA 2FUUA 3SOUA 4L58A 2VPEA 4LADB 4ZQLA 4TKPB 1RMDA 5B78A 2MD8C 5LKZA 5B75A 2ECVA 2KYUA 3MHSA 5TDWA 1VFYA 2QIZA 2ECGA 2VJEA 4GNEA 1FP0A 5AITA 2LRIC 2YYRA 2YQMA 5B8DA 3U5NA 5TRBA 5B79A 2YSJA 2H0DA 1T1HA 4WZ2A 3N9MA 2F6NA 5B77A 4N4FA 2JRJA 3M99A 5B76A 3M62A 2AN6A 2K16A 5H1TA 2C2VS 5TBNA 1MM2A 4BHWA 3KV6A 2MD7B 3KNVA 4R2YA 2XB1A 3U5PA
chains in the Genus database with same CATH superfamily
3LQJA 1X4UA 1Z6UA 3N9PA 4A0CD 2CT2A 3O36A 4BBQA 4P5OB 2P57A 3M7KA 3EB6A 3I2DA 4QF2A 1DVPA 2IDAA 4LKAA 2YT5A 5C11A 3LJUX 5C13A 4OGCA 2CRRA 1WEQA 3T7LA 5LCWB 4FIPA 3PHDA 2MKEA 3LDYA 3C5KA 4LLBA 2Y1MA 4Z0RA 1X4JA 3L1ZB 2VP7A 4B7YC 1IYMA 3NG2A 2D8SA 4LK9A 3N9NA 2ECIA 4IC3A 1DCQA 3U5MA 2YURA 2KFTA 2YVRA 2YW8A 1WIMA 2L75A 3DDTA 4GNDA 2B0OE 2EGPA 1E4UA 2RSDA 3SUBA 2E61A 3N9OA 1WFKA 2UZGA 3HTKC 1WEOA 2LGGA 2CSVA 1MBMA 5FEYA 4R7EA 5SVXA 3FAOA 4I7CA 2K4DA 4I7DA 2NAAA 4YBMA 1WEEA 2VPDA 1N87A 3O47A 2YSMA 3PURA 3E2DA 2XOCA 2VJFB 3KDEC 2XEUA 2KR4A 1LDJB 5G0FA 2YQLA 5DINA 5SVIA 5SVIB 1LDKC 4A4BA 1U6GB 2F42A 4S3OB 2CKLB 1MM3A 2CKLA 3V43A 5SVYA 4FJCA 4XI1A 5J3XA 2PUYA 3ASLA 4IC2A 4W4UA 2M3HA 4A4CA 2RI7A 4PTBA 4GB0A 3SOWA 2JM3A 4AUQB 5H1UA 2KWJA 2FD4A 3DQVR 2KKXA 2K17A 4I7BA 2JMJA 2YHOA 2PNXA 4FK5A 1JM7A 2YU4A 1JM7B 4V3KC 1WGMA 3O35A 3O34A 2VPGA 2E6SA 2JUNA 3C6WA 3DPLR 3PUQA 3U5OA 5DKAA 1XWHA 4YATA 4CCGX 2D8UA 3FL2A 4YC9A 1WEWA 4NN2A 3M63A 5AIUA 3GL6A 4B86C 2CRWA 1VYXA 2Y1NA 2M1RA 1X4IA 2DX8A 2VJFA 1HYIA 2L43A 2EXUA 4X3GA 2MA6A 1WE9A 5LKTA 2MIQA 3IHPA 4GNGA 2K1JA 1G25A 5KH7A 2MUMA 4A49A 3O33A 2FFWA 2KWOA 4UI9B 1ZBDB 3T9KA 2MA5A 2E6RA 2Y43A 3GV4A 4YABA 5JG6A 3KQIA 4GNFA 1HYJA 4O62A 4WZ0A 1V87A 2XP0A 1WENA 3LQIA 3O37A 4UP5A 2HDPA 4N3WA 5G04B 2ECJA 5D1LB 4ZUXU 4ZDTA 4WA6A 2JMDA 2XOZA 5D1MB 3RPGC 3LQHA 3ZVYA 2L80A 3O7AA 2LGVA 2MNZA 2LQ6A 3RTRB 3N9QA 2L5UA 2EODA 4AYCA 1K2FA 3LVRE 4AYCB 3QZVA 3FM8C 1VD4A 3ZTGA 2KGGA 2LDRA 2VNFA 3PLWA 2F6JA 3ZVZB 3ZPV1 2CONA 2YUCA 4MSXA 2KE1A 2MT5A 2VJEB 5FB1A 1WEMA 2ECNA 5LKUA 3L11A 4YBTA 4YADA 1FBVA 5D1KB 5KH3A 3LRQA 2HYED 2LV9A 3KV5A 4AVXA 2LN0A 4FO9A 4V3LC 1F62A 4L7XA 5H9MA 1Z2QA 2QJ0A 3MHHA 3FANA 4S3OC 4F1PA 2YREA 2OXQC 2G6QA 3SOXA 2VPBA 2M13A 2OWAA 2MNYA 2KKYA 3N9LA 3RPGB 2YHNA 3H7HA 4CA1A 2ECWA 3ZPVE 1WILA 3T6RA 4H9DA 1WEPA 2FSAA 3JUEA 2KREA 2G45A 5FERA 2BAYA 3EB5A 4LJNA 2KU3A 4MVTA 5TABA 2QICA 5KH9A 2CSZA 3ZYQA 2ZETC 3L1XA 1WEVA 2ECTA 1CHCA 2KGIA 4YBSA 5EYAF 4F52B 2G43A 1JOCA 2L0BA 2M6MA 1Z60A 5G05B 2M85A 2IQJA 4WZ3B 2KWKA 4PPEA 3O70A 3HCSA 2LXHC 2EGMA 2L7PA 4Z0OA 2FUIA 4AP4A 4OGEA 2LGLA 4UP0A 2H0DB 2DSMA 5I3LA 2KWNA 2LGKA 3ZNIA 3HCUA 3FJUB 4QF3A 4Q6FA 3FEHA 4R8PK 4O64A 1WEUA 5FB0A 2C2LA 5LKXA 5H1VA 2KIZA 3HCTA 2CSYA 4YAXA 3Q1DA 5TDRA 3SHBA 1BORA 5K3QA 2I50A 2XOYA 3VK6A 1WESA 2EA6A 2JMIA 2LXPC 4C9ZA 2FUUA 2DJAA 3SOUA 4L58A 2VPEA 3DWDA 4LADB 4ZQLA 4TKPB 1RMDA 5B78A 2MD8C 5LKZA 5B75A 2ECVA 2KYUA 3MHSA 5TDWA 3LVQE 4QQ4A 2RR4A 1VFYA 2LAUA 2QIZA 2ECGA 2VJEA 3MDBC 4GNEA 1FP0A 5AITA 2LRIC 2YYRA 2YQMA 5B8DA 3U5NA 5TRBA 5B79A 2YSJA 2H0DA 1T1HA 4WZ2A 3N9MA 2F6NA 5B77A 4N4FA 2JRJA 3M99A 5B76A 3M62A 2AN6A 2K16A 5H1TA 2C2VS 5TBNA 1MM2A 4BHWA 3KV6A 2MD7B 3KNVA 4R2YA 2XB1A 3U5PA
chains in the Genus database with same CATH topology
3LQJA 1X4UA 1Z6UA 3N9PA 4A0CD 2CT2A 3O36A 4BBQA 4P5OB 3EB6A 3I2DA 4QF2A 1DVPA 2IDAA 4LKAA 2YT5A 5C11A 5C13A 1WEQA 3T7LA 5LCWB 4FIPA 3PHDA 3C5KA 4LLBA 2Y1MA 1X4JA 3L1ZB 2VP7A 4B7YC 1IYMA 3NG2A 2D8SA 4LK9A 3N9NA 2ECIA 4IC3A 3U5MA 2YURA 2KFTA 2YW8A 1WIMA 2L75A 4GNDA 2EGPA 1E4UA 2RSDA 3N9OA 1WFKA 2UZGA 3HTKC 1WEOA 2LGGA 5FEYA 4R7EA 4I7CA 2K4DA 4I7DA 2NAAA 4YBMA 1WEEA 2VPDA 1N87A 2YSMA 3PURA 2VJFB 2XEUA 2KR4A 1LDJB 5G0FA 2YQLA 5DINA 1LDKC 4A4BA 1U6GB 2F42A 4S3OB 2CKLB 1MM3A 2CKLA 3V43A 4FJCA 4XI1A 5J3XA 2PUYA 3ASLA 4IC2A 4W4UA 2M3HA 4A4CA 2RI7A 4PTBA 4GB0A 3SOWA 4AUQB 5H1UA 2KWJA 3DQVR 2K17A 4I7BA 2JMJA 2YHOA 2PNXA 4FK5A 1JM7A 2YU4A 1JM7B 4V3KC 1WGMA 3O35A 3O34A 2VPGA 2E6SA 3C6WA 3PUQA 3DPLR 3U5OA 5DKAA 1XWHA 4YATA 4CCGX 3FL2A 4YC9A 1WEWA 4NN2A 3M63A 5AIUA 3GL6A 4B86C 1VYXA 2Y1NA 2M1RA 1X4IA 2DX8A 2VJFA 1HYIA 2L43A 4X3GA 2MA6A 1WE9A 5LKTA 2MIQA 3IHPA 4GNGA 2K1JA 1G25A 5KH7A 2MUMA 4A49A 3O33A 2KWOA 4UI9B 1ZBDB 2MA5A 2E6RA 2Y43A 3GV4A 4YABA 5JG6A 3KQIA 4GNFA 1HYJA 4WZ0A 1V87A 3O37A 1WENA 3LQIA 4UP5A 2HDPA 4N3WA 5G04B 2ECJA 5D1LB 4ZUXU 4ZDTA 4WA6A 2JMDA 5D1MB 3RPGC 3LQHA 3ZVYA 2L80A 3O7AA 2LGVA 2MNZA 2LQ6A 3RTRB 3N9QA 2L5UA 2EODA 4AYCA 1K2FA 4AYCB 3QZVA 1VD4A 3ZTGA 2KGGA 2LDRA 2VNFA 3ZVZB 2F6JA 3ZPV1 2YUCA 4MSXA 2KE1A 2MT5A 2VJEB 5FB1A 1WEMA 2ECNA 5LKUA 3L11A 4YBTA 4YADA 1FBVA 5D1KB 5KH3A 3LRQA 2HYED 2LV9A 3KV5A 4AVXA 2LN0A 4FO9A 4V3LC 1F62A 4L7XA 5H9MA 1Z2QA 2QJ0A 3MHHA 4S3OC 2YREA 2OXQC 2G6QA 3SOXA 2VPBA 2MNYA 3N9LA 3RPGB 2YHNA 4CA1A 2ECWA 3ZPVE 1WILA 3T6RA 1WEPA 2FSAA 2KREA 2G45A 5FERA 2BAYA 3EB5A 4LJNA 2KU3A 4MVTA 5TABA 2QICA 5KH9A 2CSZA 3ZYQA 2ZETC 3L1XA 1WEVA 2ECTA 1CHCA 2KGIA 4YBSA 5EYAF 4F52B 1JOCA 2G43A 2L0BA 2M6MA 1Z60A 5G05B 2M85A 4WZ3B 2KWKA 4PPEA 3O70A 3HCSA 2LXHC 2FUIA 4AP4A 2LGLA 4UP0A 2H0DB 5I3LA 2KWNA 2LGKA 3ZNIA 3HCUA 4QF3A 4Q6FA 4R8PK 4O64A 1WEUA 5FB0A 2C2LA 5LKXA 5H1VA 2KIZA 3HCTA 2CSYA 4YAXA 5TDRA 3SHBA 1BORA 2I50A 3VK6A 1WESA 2EA6A 2JMIA 2LXPC 4C9ZA 2FUUA 3SOUA 4L58A 2VPEA 4LADB 4ZQLA 4TKPB 1RMDA 5B78A 2MD8C 5LKZA 5B75A 2ECVA 2KYUA 3MHSA 5TDWA 1VFYA 2QIZA 2ECGA 2VJEA 4GNEA 1FP0A 5AITA 2LRIC 2YYRA 2YQMA 5B8DA 3U5NA 5TRBA 5B79A 2YSJA 2H0DA 1T1HA 4WZ2A 3N9MA 2F6NA 5B77A 4N4FA 2JRJA 3M99A 5B76A 3M62A 2AN6A 2K16A 5H1TA 2C2VS 5TBNA 1MM2A 4BHWA 3KV6A 2MD7B 3KNVA 4R2YA 2XB1A 3U5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQJ A;  1X4U A;  1Z6U A;  3N9P A;  4A0C D;  2CT2 A;  3O36 A;  4BBQ A;  4P5O B;  3EB6 A;  3I2D A;  4QF2 A;  1DVP A;  2IDA A;  4LKA A;  2YT5 A;  5C11 A;  5C13 A;  1WEQ A;  3T7L A;  5LCW B;  4FIP A;  3PHD A;  3C5K A;  4LLB A;  2Y1M A;  1X4J A;  3L1Z B;  2VP7 A;  4B7Y C;  1IYM A;  3NG2 A;  2D8S A;  4LK9 A;  3N9N A;  2ECI A;  4IC3 A;  3U5M A;  2YUR A;  2KFT A;  2YW8 A;  1WIM A;  2L75 A;  4GND A;  2EGP A;  1E4U A;  2RSD A;  3N9O A;  1WFK A;  2UZG A;  3HTK C;  1WEO A;  2LGG A;  5FEY A;  4R7E A;  4I7C A;  2K4D A;  4I7D A;  2NAA A;  4YBM A;  1WEE A;  2VPD A;  1N87 A;  2YSM A;  3PUR A;  2VJF B;  2XEU A;  2KR4 A;  1LDJ B;  5G0F A;  2YQL A;  5DIN A;  1LDK C;  4A4B A;  1U6G B;  2F42 A;  4S3O B;  2CKL B;  1MM3 A;  2CKL A;  3V43 A;  4FJC A;  4XI1 A;  5J3X A;  2PUY A;  3ASL A;  4IC2 A;  4W4U A;  2M3H A;  4A4C A;  2RI7 A;  4PTB A;  4GB0 A;  3SOW A;  4AUQ B;  5H1U A;  2KWJ A;  3DQV R;  2K17 A;  4I7B A;  2JMJ A;  2YHO A;  2PNX A;  4FK5 A;  1JM7 A;  2YU4 A;  1JM7 B;  4V3K C;  1WGM A;  3O35 A;  3O34 A;  2VPG A;  2E6S A;  3C6W A;  3PUQ A;  3DPL R;  3U5O A;  5DKA A;  1XWH A;  4YAT A;  4CCG X;  3FL2 A;  4YC9 A;  1WEW A;  4NN2 A;  3M63 A;  5AIU A;  3GL6 A;  4B86 C;  1VYX A;  2Y1N A;  2M1R A;  1X4I A;  2DX8 A;  2VJF A;  1HYI A;  2L43 A;  4X3G A;  2MA6 A;  1WE9 A;  5LKT A;  2MIQ A;  3IHP A;  4GNG A;  2K1J A;  1G25 A;  5KH7 A;  2MUM A;  4A49 A;  3O33 A;  2KWO A;  4UI9 B;  1ZBD B;  2MA5 A;  2E6R A;  2Y43 A;  3GV4 A;  4YAB A;  5JG6 A;  3KQI A;  4GNF A;  1HYJ A;  4WZ0 A;  1V87 A;  3O37 A;  1WEN A;  3LQI A;  4UP5 A;  2HDP A;  4N3W A;  5G04 B;  2ECJ A;  5D1L B;  4ZUX U;  4ZDT A;  4WA6 A;  2JMD A;  5D1M B;  3RPG C;  3LQH A;  3ZVY A;  2L80 A;  3O7A A;  2LGV A;  2MNZ A;  2LQ6 A;  3RTR B;  3N9Q A;  2L5U A;  2EOD A;  4AYC A;  1K2F A;  4AYC B;  3QZV A;  1VD4 A;  3ZTG A;  2KGG A;  2LDR A;  2VNF A;  3ZVZ B;  2F6J A;  3ZPV 1;  2YUC A;  4MSX A;  2KE1 A;  2MT5 A;  2VJE B;  5FB1 A;  1WEM A;  2ECN A;  5LKU A;  3L11 A;  4YBT A;  4YAD A;  1FBV A;  5D1K B;  5KH3 A;  3LRQ A;  2HYE D;  2LV9 A;  3KV5 A;  4AVX A;  2LN0 A;  4FO9 A;  4V3L C;  1F62 A;  4L7X A;  5H9M A;  1Z2Q A;  2QJ0 A;  3MHH A;  4S3O C;  2YRE A;  2OXQ C;  2G6Q A;  3SOX A;  2VPB A;  2MNY A;  3N9L A;  3RPG B;  2YHN A;  4CA1 A;  2ECW A;  3ZPV E;  1WIL A;  3T6R A;  1WEP A;  2FSA A;  2KRE A;  2G45 A;  5FER A;  2BAY A;  3EB5 A;  4LJN A;  2KU3 A;  4MVT A;  5TAB A;  2QIC A;  5KH9 A;  2CSZ A;  3ZYQ A;  2ZET C;  3L1X A;  1WEV A;  2ECT A;  1CHC A;  2KGI A;  4YBS A;  5EYA F;  4F52 B;  1JOC A;  2G43 A;  2L0B A;  2M6M A;  1Z60 A;  5G05 B;  2M85 A;  4WZ3 B;  2KWK A;  4PPE A;  3O70 A;  3HCS A;  2LXH C;  2FUI A;  4AP4 A;  2LGL A;  4UP0 A;  2H0D B;  5I3L A;  2KWN A;  2LGK A;  3ZNI A;  3HCU A;  4QF3 A;  4Q6F A;  4R8P K;  4O64 A;  1WEU A;  5FB0 A;  2C2L A;  5LKX A;  5H1V A;  2KIZ A;  3HCT A;  2CSY A;  4YAX A;  5TDR A;  3SHB A;  1BOR A;  2I50 A;  3VK6 A;  1WES A;  2EA6 A;  2JMI A;  2LXP C;  4C9Z A;  2FUU A;  3SOU A;  4L58 A;  2VPE A;  4LAD B;  4ZQL A;  4TKP B;  1RMD A;  5B78 A;  2MD8 C;  5LKZ A;  5B75 A;  2ECV A;  2KYU A;  3MHS A;  5TDW A;  1VFY A;  2QIZ A;  2ECG A;  2VJE A;  4GNE A;  1FP0 A;  5AIT A;  2LRI C;  2YYR A;  2YQM A;  5B8D A;  3U5N A;  5TRB A;  5B79 A;  2YSJ A;  2H0D A;  1T1H A;  4WZ2 A;  3N9M A;  2F6N A;  5B77 A;  4N4F A;  2JRJ A;  3M99 A;  5B76 A;  3M62 A;  2AN6 A;  2K16 A;  5H1T A;  2C2V S;  5TBN A;  1MM2 A;  4BHW A;  3KV6 A;  2MD7 B;  3KNV A;  4R2Y A;  2XB1 A;  3U5P A; 
#chains in the Genus database with same CATH topology
 3LQJ A;  1X4U A;  1Z6U A;  3N9P A;  4A0C D;  2CT2 A;  3O36 A;  4BBQ A;  4P5O B;  2P57 A;  3M7K A;  3EB6 A;  3I2D A;  4QF2 A;  1DVP A;  2IDA A;  4LKA A;  2YT5 A;  5C11 A;  3LJU X;  5C13 A;  4OGC A;  2CRR A;  1WEQ A;  3T7L A;  5LCW B;  4FIP A;  3PHD A;  2MKE A;  3LDY A;  3C5K A;  4LLB A;  2Y1M A;  4Z0R A;  1X4J A;  3L1Z B;  2VP7 A;  4B7Y C;  1IYM A;  3NG2 A;  2D8S A;  4LK9 A;  3N9N A;  2ECI A;  4IC3 A;  1DCQ A;  3U5M A;  2YUR A;  2KFT A;  2YVR A;  2YW8 A;  1WIM A;  2L75 A;  3DDT A;  4GND A;  2B0O E;  2EGP A;  1E4U A;  2RSD A;  3SUB A;  2E61 A;  3N9O A;  1WFK A;  2UZG A;  3HTK C;  1WEO A;  2LGG A;  2CSV A;  1MBM A;  5FEY A;  4R7E A;  5SVX A;  3FAO A;  4I7C A;  2K4D A;  4I7D A;  2NAA A;  4YBM A;  1WEE A;  2VPD A;  1N87 A;  3O47 A;  2YSM A;  3PUR A;  3E2D A;  2XOC A;  2VJF B;  3KDE C;  2XEU A;  2KR4 A;  1LDJ B;  5G0F A;  2YQL A;  5DIN A;  5SVI A;  5SVI B;  1LDK C;  4A4B A;  1U6G B;  2F42 A;  4S3O B;  2CKL B;  1MM3 A;  2CKL A;  3V43 A;  5SVY A;  4FJC A;  4XI1 A;  5J3X A;  2PUY A;  3ASL A;  4IC2 A;  4W4U A;  2M3H A;  4A4C A;  2RI7 A;  4PTB A;  4GB0 A;  3SOW A;  2JM3 A;  4AUQ B;  5H1U A;  2KWJ A;  2FD4 A;  3DQV R;  2KKX A;  2K17 A;  4I7B A;  2JMJ A;  2YHO A;  2PNX A;  4FK5 A;  1JM7 A;  2YU4 A;  1JM7 B;  4V3K C;  1WGM A;  3O35 A;  3O34 A;  2VPG A;  2E6S A;  2JUN A;  3C6W A;  3DPL R;  3PUQ A;  3U5O A;  5DKA A;  1XWH A;  4YAT A;  4CCG X;  2D8U A;  3FL2 A;  4YC9 A;  1WEW A;  4NN2 A;  3M63 A;  5AIU A;  3GL6 A;  4B86 C;  2CRW A;  1VYX A;  2Y1N A;  2M1R A;  1X4I A;  2DX8 A;  2VJF A;  1HYI A;  2L43 A;  2EXU A;  4X3G A;  2MA6 A;  1WE9 A;  5LKT A;  2MIQ A;  3IHP A;  4GNG A;  2K1J A;  1G25 A;  5KH7 A;  2MUM A;  4A49 A;  3O33 A;  2FFW A;  2KWO A;  4UI9 B;  1ZBD B;  3T9K A;  2MA5 A;  2E6R A;  2Y43 A;  3GV4 A;  4YAB A;  5JG6 A;  3KQI A;  4GNF A;  1HYJ A;  4O62 A;  4WZ0 A;  1V87 A;  2XP0 A;  1WEN A;  3LQI A;  3O37 A;  4UP5 A;  2HDP A;  4N3W A;  5G04 B;  2ECJ A;  5D1L B;  4ZUX U;  4ZDT A;  4WA6 A;  2JMD A;  2XOZ A;  5D1M B;  3RPG C;  3LQH A;  3ZVY A;  2L80 A;  3O7A A;  2LGV A;  2MNZ A;  2LQ6 A;  3RTR B;  3N9Q A;  2L5U A;  2EOD A;  4AYC A;  1K2F A;  3LVR E;  4AYC B;  3QZV A;  3FM8 C;  1VD4 A;  3ZTG A;  2KGG A;  2LDR A;  2VNF A;  3PLW A;  2F6J A;  3ZVZ B;  3ZPV 1;  2CON A;  2YUC A;  4MSX A;  2KE1 A;  2MT5 A;  2VJE B;  5FB1 A;  1WEM A;  2ECN A;  5LKU A;  3L11 A;  4YBT A;  4YAD A;  1FBV A;  5D1K B;  5KH3 A;  3LRQ A;  2HYE D;  2LV9 A;  3KV5 A;  4AVX A;  2LN0 A;  4FO9 A;  4V3L C;  1F62 A;  4L7X A;  5H9M A;  1Z2Q A;  2QJ0 A;  3MHH A;  3FAN A;  4S3O C;  4F1P A;  2YRE A;  2OXQ C;  2G6Q A;  3SOX A;  2VPB A;  2M13 A;  2OWA A;  2MNY A;  2KKY A;  3N9L A;  3RPG B;  2YHN A;  3H7H A;  4CA1 A;  2ECW A;  3ZPV E;  1WIL A;  3T6R A;  4H9D A;  1WEP A;  2FSA A;  3JUE A;  2KRE A;  2G45 A;  5FER A;  2BAY A;  3EB5 A;  4LJN A;  2KU3 A;  4MVT A;  5TAB A;  2QIC A;  5KH9 A;  2CSZ A;  3ZYQ A;  2ZET C;  3L1X A;  1WEV A;  2ECT A;  1CHC A;  2KGI A;  4YBS A;  5EYA F;  4F52 B;  2G43 A;  1JOC A;  2L0B A;  2M6M A;  1Z60 A;  5G05 B;  2M85 A;  2IQJ A;  4WZ3 B;  2KWK A;  4PPE A;  3O70 A;  3HCS A;  2LXH C;  2EGM A;  2L7P A;  4Z0O A;  2FUI A;  4AP4 A;  4OGE A;  2LGL A;  4UP0 A;  2H0D B;  2DSM A;  5I3L A;  2KWN A;  2LGK A;  3ZNI A;  3HCU A;  3FJU B;  4QF3 A;  4Q6F A;  3FEH A;  4R8P K;  4O64 A;  1WEU A;  5FB0 A;  2C2L A;  5LKX A;  5H1V A;  2KIZ A;  3HCT A;  2CSY A;  4YAX A;  3Q1D A;  5TDR A;  3SHB A;  1BOR A;  5K3Q A;  2I50 A;  2XOY A;  3VK6 A;  1WES A;  2EA6 A;  2JMI A;  2LXP C;  4C9Z A;  2FUU A;  2DJA A;  3SOU A;  4L58 A;  2VPE A;  3DWD A;  4LAD B;  4ZQL A;  4TKP B;  1RMD A;  5B78 A;  2MD8 C;  5LKZ A;  5B75 A;  2ECV A;  2KYU A;  3MHS A;  5TDW A;  3LVQ E;  4QQ4 A;  2RR4 A;  1VFY A;  2LAU A;  2QIZ A;  2ECG A;  2VJE A;  3MDB C;  4GNE A;  1FP0 A;  5AIT A;  2LRI C;  2YYR A;  2YQM A;  5B8D A;  3U5N A;  5TRB A;  5B79 A;  2YSJ A;  2H0D A;  1T1H A;  4WZ2 A;  3N9M A;  2F6N A;  5B77 A;  4N4F A;  2JRJ A;  3M99 A;  5B76 A;  3M62 A;  2AN6 A;  2K16 A;  5H1T A;  2C2V S;  5TBN A;  1MM2 A;  4BHW A;  3KV6 A;  2MD7 B;  3KNV A;  4R2Y A;  2XB1 A;  3U5P A; 
#chains in the Genus database with same CATH homology
 3LQJ A;  1X4U A;  1Z6U A;  3N9P A;  4A0C D;  2CT2 A;  3O36 A;  4BBQ A;  4P5O B;  3EB6 A;  3I2D A;  4QF2 A;  1DVP A;  2IDA A;  4LKA A;  2YT5 A;  5C11 A;  5C13 A;  1WEQ A;  3T7L A;  5LCW B;  4FIP A;  3PHD A;  3C5K A;  4LLB A;  2Y1M A;  1X4J A;  3L1Z B;  2VP7 A;  4B7Y C;  1IYM A;  3NG2 A;  2D8S A;  4LK9 A;  3N9N A;  2ECI A;  4IC3 A;  3U5M A;  2YUR A;  2KFT A;  2YW8 A;  1WIM A;  2L75 A;  4GND A;  2EGP A;  1E4U A;  2RSD A;  3N9O A;  1WFK A;  2UZG A;  3HTK C;  1WEO A;  2LGG A;  5FEY A;  4R7E A;  4I7C A;  2K4D A;  4I7D A;  2NAA A;  4YBM A;  1WEE A;  2VPD A;  1N87 A;  2YSM A;  3PUR A;  2VJF B;  2XEU A;  2KR4 A;  1LDJ B;  5G0F A;  2YQL A;  5DIN A;  1LDK C;  4A4B A;  1U6G B;  2F42 A;  4S3O B;  2CKL B;  1MM3 A;  2CKL A;  3V43 A;  4FJC A;  4XI1 A;  5J3X A;  2PUY A;  3ASL A;  4IC2 A;  4W4U A;  2M3H A;  4A4C A;  2RI7 A;  4PTB A;  4GB0 A;  3SOW A;  4AUQ B;  5H1U A;  2KWJ A;  3DQV R;  2K17 A;  4I7B A;  2JMJ A;  2YHO A;  2PNX A;  4FK5 A;  1JM7 A;  2YU4 A;  1JM7 B;  4V3K C;  1WGM A;  3O35 A;  3O34 A;  2VPG A;  2E6S A;  3C6W A;  3PUQ A;  3DPL R;  3U5O A;  5DKA A;  1XWH A;  4YAT A;  4CCG X;  3FL2 A;  4YC9 A;  1WEW A;  4NN2 A;  3M63 A;  5AIU A;  3GL6 A;  4B86 C;  1VYX A;  2Y1N A;  2M1R A;  1X4I A;  2DX8 A;  2VJF A;  1HYI A;  2L43 A;  4X3G A;  2MA6 A;  1WE9 A;  5LKT A;  2MIQ A;  3IHP A;  4GNG A;  2K1J A;  1G25 A;  5KH7 A;  2MUM A;  4A49 A;  3O33 A;  2KWO A;  4UI9 B;  1ZBD B;  2MA5 A;  2E6R A;  2Y43 A;  3GV4 A;  4YAB A;  5JG6 A;  3KQI A;  4GNF A;  1HYJ A;  4WZ0 A;  1V87 A;  3O37 A;  1WEN A;  3LQI A;  4UP5 A;  2HDP A;  4N3W A;  5G04 B;  2ECJ A;  5D1L B;  4ZUX U;  4ZDT A;  4WA6 A;  2JMD A;  5D1M B;  3RPG C;  3LQH A;  3ZVY A;  2L80 A;  3O7A A;  2LGV A;  2MNZ A;  2LQ6 A;  3RTR B;  3N9Q A;  2L5U A;  2EOD A;  4AYC A;  1K2F A;  4AYC B;  3QZV A;  1VD4 A;  3ZTG A;  2KGG A;  2LDR A;  2VNF A;  3ZVZ B;  2F6J A;  3ZPV 1;  2YUC A;  4MSX A;  2KE1 A;  2MT5 A;  2VJE B;  5FB1 A;  1WEM A;  2ECN A;  5LKU A;  3L11 A;  4YBT A;  4YAD A;  1FBV A;  5D1K B;  5KH3 A;  3LRQ A;  2HYE D;  2LV9 A;  3KV5 A;  4AVX A;  2LN0 A;  4FO9 A;  4V3L C;  1F62 A;  4L7X A;  5H9M A;  1Z2Q A;  2QJ0 A;  3MHH A;  4S3O C;  2YRE A;  2OXQ C;  2G6Q A;  3SOX A;  2VPB A;  2MNY A;  3N9L A;  3RPG B;  2YHN A;  4CA1 A;  2ECW A;  3ZPV E;  1WIL A;  3T6R A;  1WEP A;  2FSA A;  2KRE A;  2G45 A;  5FER A;  2BAY A;  3EB5 A;  4LJN A;  2KU3 A;  4MVT A;  5TAB A;  2QIC A;  5KH9 A;  2CSZ A;  3ZYQ A;  2ZET C;  3L1X A;  1WEV A;  2ECT A;  1CHC A;  2KGI A;  4YBS A;  5EYA F;  4F52 B;  1JOC A;  2G43 A;  2L0B A;  2M6M A;  1Z60 A;  5G05 B;  2M85 A;  4WZ3 B;  2KWK A;  4PPE A;  3O70 A;  3HCS A;  2LXH C;  2FUI A;  4AP4 A;  2LGL A;  4UP0 A;  2H0D B;  5I3L A;  2KWN A;  2LGK A;  3ZNI A;  3HCU A;  4QF3 A;  4Q6F A;  4R8P K;  4O64 A;  1WEU A;  5FB0 A;  2C2L A;  5LKX A;  5H1V A;  2KIZ A;  3HCT A;  2CSY A;  4YAX A;  5TDR A;  3SHB A;  1BOR A;  2I50 A;  3VK6 A;  1WES A;  2EA6 A;  2JMI A;  2LXP C;  4C9Z A;  2FUU A;  3SOU A;  4L58 A;  2VPE A;  4LAD B;  4ZQL A;  4TKP B;  1RMD A;  5B78 A;  2MD8 C;  5LKZ A;  5B75 A;  2ECV A;  2KYU A;  3MHS A;  5TDW A;  1VFY A;  2QIZ A;  2ECG A;  2VJE A;  4GNE A;  1FP0 A;  5AIT A;  2LRI C;  2YYR A;  2YQM A;  5B8D A;  3U5N A;  5TRB A;  5B79 A;  2YSJ A;  2H0D A;  1T1H A;  4WZ2 A;  3N9M A;  2F6N A;  5B77 A;  4N4F A;  2JRJ A;  3M99 A;  5B76 A;  3M62 A;  2AN6 A;  2K16 A;  5H1T A;  2C2V S;  5TBN A;  1MM2 A;  4BHW A;  3KV6 A;  2MD7 B;  3KNV A;  4R2Y A;  2XB1 A;  3U5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...