2H0DA

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
TRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B lymphoma Mo-MLV insertion region
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/ligase
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dA00
1X4UA 4YATA 1HYJA 3KQIA 3O70A 5C11A 3L1XA 5DKAA 4W4UA 3V43A 2JMJA 2LQ6A 2JMDA 1MM3A 2G45A 2KWJA 1XWHA 3VK6A 2LRIC 3M63A 2IDAA 3SOWA 4R7EA 1Z6UA 2PUYA 2L75A 2HDPA 2ECJA 2CSYA 5H9MA 2UZGA 3O36A 2VJEB 2EODA 2QJ0A 4UP5A 2VPBA 3O37A 2MD7B 2KWNA 2KU3A 5KH7A 3O7AA 3U5OA 4A49A 2KE1A 3ASLA 4AYCB 2I50A 3O33A 5DINA 4GB0A 1JOCA 4QF2A 3U5PA 1WEPA 2L0BA 3SOXA 4YBMA 2M1RA 2VPEA 2MIQA 3SOUA 2M6MA 2RSDA 3HCTA 3DPLR 3C6WA 2K1JA 1Z60A 3GL6A 2MUMA 4TKPB 4YC9A 4FIPA 1IYMA 1G25A 2KGIA 1WEMA 2YQLA 3L11A 3N9QA 1U6GB 4YABA 3U5NA 4WZ2A 4CA1A 5B78A 2CSZA 2C2LA 4LK9A 3NG2A 2FUIA 1WEEA 1WIMA 1T1HA 2F6JA 4YAXA 5G05B 5G04B 4LLBA 4BHWA 4FK5A 2VPGA 1WEOA 3N9NA 5I3LA 3N9PA 5TDRA 4ZDTA 1K2FA 2LGVA 5B77A 3T6RA 2LXPC 2PNXA 3L1ZB 3KNVA 4P5OB 2ECTA 2YQMA 2MT5A 2VPDA 4AP4A 5C13A 1DVPA 4V3KC 1MM2A 2NAAA 3I2DA 1VYXA 5FEYA 2LV9A 5J3XA 2M3HA 4BBQA 2E6RA 2Y1MA 2YUCA 2MD8C 4GNGA 3RTRB 2JRJA 2YHNA 4R8PK 3C5KA 2G43A 4WZ0A 5FB1A 1VFYA 3U5MA 1WE9A 1WEVA 5D1LB 3KV6A 2L5UA 4GNFA 5D1KB 3EB6A 1WFKA 2XB1A 4O64A 2ECGA 1BORA 2MNZA 4UP0A 5TABA 3O35A 4XI1A 4LADB 3SHBA 1HYIA 4I7DA 2KIZA 4F52B 2ZETC 1FP0A 2KWKA 3M62A 2KYUA 2LGKA 2CKLB 5LKZA 3ZVZB 1WGMA 2OXQC 2YSJA 5D1MB 4C9ZA 5LKTA 2EA6A 1JM7B 4WA6A 3LQIA 3MHHA 2QIZA 3N9OA 2D8SA 4S3OB 5LKXA 1Z2QA 2YHOA 4LKAA 3GV4A 1FBVA 1LDKC 3QZVA 4B86C 5B75A 4MVTA 2Y43A 5H1VA 4L7XA 1X4JA 4N3WA 4GNDA 2BAYA 4ZQLA 5AITA 3EB5A 2C2VS 2ECIA 2KGGA 1ZBDB 2VJEA 2YW8A 4UI9B 3ZPVE 5TDWA 3RPGB 2LXHC 2YREA 5G0FA 2K4DA 2LGGA 3IHPA 2KFTA 4PPEA 5LKUA 4YBSA 4YADA 3HCSA 2H0DB 2ECVA 4AYCA 1CHCA 2MA6A 2EGPA 2DX8A 3LQHA 2YT5A 1WILA 4S3OC 5TRBA 2G6QA 2VJFB 2QICA 2MNYA 2VNFA 4B7YC 3O34A 1V87A 4FO9A 4A4BA 4QF3A 2KR4A 3DQVR 1WEUA 1X4IA 5JG6A 5B76A 3T7LA 1JM7A 2AN6A 1WEWA 3ZPV1 4L58A 2F42A 3N9LA 3RPGC 2MA5A 2CT2A 4IC2A 3HCUA 4A0CD 4YBTA 5KH9A 1F62A 3HTKC 3N9MA 3FL2A 4NN2A 4R2YA 4V3LC 1WESA 5LCWB 5B8DA 2L43A 2HYED 4I7BA 3LRQA 2ECWA 5TBNA 1WENA 2H0DA 1WEQA 2M85A 3KV5A 3ZNIA 3LQJA 2K17A 4Q6FA 2LGLA 4FJCA 3M99A 2KWOA 4X3GA 2ECNA 2VJFA 4CCGX 4GNEA 2FSAA 2FUUA 2YURA 2F6NA 4LJNA 1E4UA 2KREA 1VD4A 2YU4A 2JMIA 2LN0A 2LDRA 5EYAF 5B79A 3PHDA 4I7CA 3PURA 3ZTGA 5FERA 5H1TA 4ZUXU 1N87A 1LDJB 2K16A 5FB0A 1RMDA 3ZYQA 5KH3A 2VP7A 3MHSA 5H1UA 3ZVYA 4A4CA 4AVXA 2Y1NA 2YYRA 4WZ3B 4MSXA 3PUQA 2L80A 5AIUA 2RI7A 2YSMA 2XEUA 4N4FA 2E6SA 4PTBA 4AUQB 4IC3A 2CKLA
chains in the Genus database with same CATH superfamily
1X4UA 4YATA 4Z0OA 2CRRA 1HYJA 3KQIA 3O70A 5C11A 3L1XA 3LVQE 5DKAA 4W4UA 2XOZA 3V43A 2JMJA 2LQ6A 2JMDA 1MM3A 2G45A 2KWJA 1XWHA 3VK6A 2LRIC 3FANA 3PLWA 3M63A 2IDAA 3SOWA 4R7EA 1Z6UA 3Q1DA 2PUYA 2KKYA 2L75A 2HDPA 2ECJA 2CSYA 5H9MA 2UZGA 3O36A 2VJEB 2EODA 2QJ0A 3FAOA 4UP5A 2VPBA 3O37A 2MD7B 2JUNA 2KWNA 2KU3A 5KH7A 3O7AA 3U5OA 3E2DA 4A49A 2KE1A 3ASLA 3LVRE 4AYCB 2I50A 3O33A 5DINA 4GB0A 1JOCA 2CONA 4QF2A 3U5PA 2L7PA 1WEPA 2L0BA 3SOXA 4YBMA 2M1RA 2VPEA 2MIQA 3SOUA 2M6MA 4OGEA 2RSDA 3HCTA 3DPLR 3C6WA 2K1JA 1Z60A 2RR4A 3GL6A 2MUMA 4TKPB 4YC9A 4FIPA 1IYMA 1G25A 3T9KA 2KGIA 1WEMA 2YQLA 3L11A 3N9QA 3DWDA 1U6GB 4YABA 3U5NA 4WZ2A 4CA1A 5B78A 2CSZA 2C2LA 4LK9A 3NG2A 2CSVA 2FUIA 1WEEA 1WIMA 1T1HA 2F6JA 4YAXA 5G05B 5G04B 4LLBA 5SVIB 4BHWA 4FK5A 2VPGA 1WEOA 3N9NA 5I3LA 3N9PA 3JUEA 5TDRA 4ZDTA 1K2FA 2LGVA 4OGCA 5B77A 3T6RA 2LXPC 2PNXA 3L1ZB 3KNVA 4P5OB 5SVXA 2P57A 2ECTA 2YQMA 2MT5A 2VPDA 4AP4A 5C13A 1DVPA 4V3KC 3KDEC 1MM2A 2NAAA 3I2DA 1VYXA 5FEYA 2LV9A 5J3XA 2M3HA 4BBQA 2E6RA 2Y1MA 2YUCA 2MD8C 4GNGA 3RTRB 2JRJA 2YHNA 4R8PK 3C5KA 2G43A 5SVYA 4WZ0A 5FB1A 1VFYA 3M7KA 3U5MA 1WE9A 1WEVA 5D1LB 3KV6A 2L5UA 2EGMA 4GNFA 5D1KB 3EB6A 1WFKA 3O47A 3SUBA 2XOCA 2XB1A 4O64A 2ECGA 1BORA 2MNZA 4UP0A 5TABA 3O35A 4XI1A 4LADB 5SVIA 3SHBA 1HYIA 4I7DA 2JM3A 2DJAA 2KIZA 4F52B 2ZETC 1FP0A 2KWKA 3M62A 2KYUA 2LGKA 2CKLB 5LKZA 3ZVZB 1WGMA 5K3QA 2OXQC 2YSJA 5D1MB 4C9ZA 5LKTA 2EA6A 1JM7B 4WA6A 2KKXA 3LQIA 3MHHA 2QIZA 3N9OA 2D8SA 4S3OB 2FFWA 5LKXA 1Z2QA 2YHOA 4LKAA 3GV4A 1FBVA 1LDKC 4O62A 3QZVA 4B86C 3FEHA 4MVTA 2Y43A 5B75A 5H1VA 4L7XA 1X4JA 4N3WA 4GNDA 2BAYA 4ZQLA 5AITA 3EB5A 2C2VS 2ECIA 2KGGA 1ZBDB 2VJEA 2YW8A 4UI9B 3ZPVE 5TDWA 2CRWA 3RPGB 2LXHC 2YREA 5G0FA 2K4DA 2EXUA 2LGGA 3DDTA 3IHPA 2KFTA 4PPEA 5LKUA 4YBSA 4YADA 3HCSA 2H0DB 2ECVA 4AYCA 1CHCA 2MA6A 2EGPA 2DX8A 3LQHA 2YT5A 1WILA 4S3OC 5TRBA 2G6QA 2VJFB 2QICA 2MNYA 2VNFA 4B7YC 4H9DA 3O34A 1V87A 4FO9A 4A4BA 4QF3A 2KR4A 3DQVR 4F1PA 1WEUA 1X4IA 5JG6A 2D8UA 2OWAA 5B76A 3T7LA 1JM7A 4Z0RA 2MKEA 2AN6A 1WEWA 3ZPV1 4L58A 2F42A 3N9LA 3RPGC 2MA5A 2CT2A 4IC2A 3HCUA 4A0CD 4YBTA 5KH9A 1F62A 3HTKC 3N9MA 3FL2A 3FM8C 4NN2A 4R2YA 4V3LC 3LJUX 1WESA 2YVRA 5LCWB 3H7HA 5B8DA 2L43A 2HYED 4QQ4A 2XOYA 2XP0A 1DCQA 3LRQA 2ECWA 4I7BA 5TBNA 3LDYA 1WENA 2H0DA 1WEQA 2M85A 3KV5A 3ZNIA 3LQJA 2K17A 4Q6FA 2LGLA 4FJCA 3M99A 2KWOA 2M13A 2DSMA 4X3GA 2ECNA 2VJFA 4CCGX 4GNEA 2FSAA 2FD4A 2FUUA 2YURA 2F6NA 4LJNA 1E4UA 2E61A 2KREA 1VD4A 1MBMA 2YU4A 2JMIA 2LN0A 2LDRA 5EYAF 5B79A 3PHDA 4I7CA 3PURA 3MDBC 3ZTGA 5FERA 5H1TA 4ZUXU 1N87A 1LDJB 2K16A 5FB0A 1RMDA 3ZYQA 2IQJA 5KH3A 2VP7A 3MHSA 5H1UA 3ZVYA 4A4CA 2B0OE 4AVXA 2Y1NA 2YYRA 4WZ3B 4MSXA 3PUQA 2L80A 5AIUA 2RI7A 2YSMA 2XEUA 4N4FA 2E6SA 4PTBA 4AUQB 2LAUA 3FJUB 4IC3A 2CKLA
chains in the Genus database with same CATH topology
1X4UA 4YATA 1HYJA 3KQIA 3O70A 5C11A 3L1XA 5DKAA 4W4UA 3V43A 2JMJA 2LQ6A 2JMDA 1MM3A 2G45A 2KWJA 1XWHA 3VK6A 2LRIC 3M63A 2IDAA 3SOWA 4R7EA 1Z6UA 2PUYA 2L75A 2HDPA 2ECJA 2CSYA 5H9MA 2UZGA 3O36A 2VJEB 2EODA 2QJ0A 4UP5A 2VPBA 3O37A 2MD7B 2KWNA 2KU3A 5KH7A 3O7AA 3U5OA 4A49A 2KE1A 3ASLA 4AYCB 2I50A 3O33A 5DINA 4GB0A 1JOCA 4QF2A 3U5PA 1WEPA 2L0BA 3SOXA 4YBMA 2M1RA 2VPEA 2MIQA 3SOUA 2M6MA 2RSDA 3HCTA 3DPLR 3C6WA 2K1JA 1Z60A 3GL6A 2MUMA 4TKPB 4YC9A 4FIPA 1IYMA 1G25A 2KGIA 1WEMA 2YQLA 3L11A 3N9QA 1U6GB 4YABA 3U5NA 4WZ2A 4CA1A 5B78A 2CSZA 2C2LA 4LK9A 3NG2A 2FUIA 1WEEA 1WIMA 1T1HA 2F6JA 4YAXA 5G05B 5G04B 4LLBA 4BHWA 4FK5A 2VPGA 1WEOA 3N9NA 5I3LA 3N9PA 5TDRA 4ZDTA 1K2FA 2LGVA 5B77A 3T6RA 2LXPC 2PNXA 3L1ZB 3KNVA 4P5OB 2ECTA 2YQMA 2MT5A 2VPDA 4AP4A 5C13A 1DVPA 4V3KC 1MM2A 2NAAA 3I2DA 1VYXA 5FEYA 2LV9A 5J3XA 2M3HA 4BBQA 2E6RA 2Y1MA 2YUCA 2MD8C 4GNGA 3RTRB 2JRJA 2YHNA 4R8PK 3C5KA 2G43A 4WZ0A 5FB1A 1VFYA 3U5MA 1WE9A 1WEVA 5D1LB 3KV6A 2L5UA 4GNFA 5D1KB 3EB6A 1WFKA 2XB1A 4O64A 2ECGA 1BORA 2MNZA 4UP0A 5TABA 3O35A 4XI1A 4LADB 3SHBA 1HYIA 4I7DA 2KIZA 4F52B 2ZETC 1FP0A 2KWKA 3M62A 2KYUA 2LGKA 2CKLB 5LKZA 3ZVZB 1WGMA 2OXQC 2YSJA 5D1MB 4C9ZA 5LKTA 2EA6A 1JM7B 4WA6A 3LQIA 3MHHA 2QIZA 3N9OA 2D8SA 4S3OB 5LKXA 1Z2QA 2YHOA 4LKAA 3GV4A 1FBVA 1LDKC 3QZVA 4B86C 5B75A 4MVTA 2Y43A 5H1VA 4L7XA 1X4JA 4N3WA 4GNDA 2BAYA 4ZQLA 5AITA 3EB5A 2C2VS 2ECIA 2KGGA 1ZBDB 2VJEA 2YW8A 4UI9B 3ZPVE 5TDWA 3RPGB 2LXHC 2YREA 5G0FA 2K4DA 2LGGA 3IHPA 2KFTA 4PPEA 5LKUA 4YBSA 4YADA 3HCSA 2H0DB 2ECVA 4AYCA 1CHCA 2MA6A 2EGPA 2DX8A 3LQHA 2YT5A 1WILA 4S3OC 5TRBA 2G6QA 2VJFB 2QICA 2MNYA 2VNFA 4B7YC 3O34A 1V87A 4FO9A 4A4BA 4QF3A 2KR4A 3DQVR 1WEUA 1X4IA 5JG6A 5B76A 3T7LA 1JM7A 2AN6A 1WEWA 3ZPV1 4L58A 2F42A 3N9LA 3RPGC 2MA5A 2CT2A 4IC2A 3HCUA 4A0CD 4YBTA 5KH9A 1F62A 3HTKC 3N9MA 3FL2A 4NN2A 4R2YA 4V3LC 1WESA 5LCWB 5B8DA 2L43A 2HYED 4I7BA 3LRQA 2ECWA 5TBNA 1WENA 2H0DA 1WEQA 2M85A 3KV5A 3ZNIA 3LQJA 2K17A 4Q6FA 2LGLA 4FJCA 3M99A 2KWOA 4X3GA 2ECNA 2VJFA 4CCGX 4GNEA 2FSAA 2FUUA 2YURA 2F6NA 4LJNA 1E4UA 2KREA 1VD4A 2YU4A 2JMIA 2LN0A 2LDRA 5EYAF 5B79A 3PHDA 4I7CA 3PURA 3ZTGA 5FERA 5H1TA 4ZUXU 1N87A 1LDJB 2K16A 5FB0A 1RMDA 3ZYQA 5KH3A 2VP7A 3MHSA 5H1UA 3ZVYA 4A4CA 4AVXA 2Y1NA 2YYRA 4WZ3B 4MSXA 3PUQA 2L80A 5AIUA 2RI7A 2YSMA 2XEUA 4N4FA 2E6SA 4PTBA 4AUQB 4IC3A 2CKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4U A;  4YAT A;  1HYJ A;  3KQI A;  3O70 A;  5C11 A;  3L1X A;  5DKA A;  4W4U A;  3V43 A;  2JMJ A;  2LQ6 A;  2JMD A;  1MM3 A;  2G45 A;  2KWJ A;  1XWH A;  3VK6 A;  2LRI C;  3M63 A;  2IDA A;  3SOW A;  4R7E A;  1Z6U A;  2PUY A;  2L75 A;  2HDP A;  2ECJ A;  2CSY A;  5H9M A;  2UZG A;  3O36 A;  2VJE B;  2EOD A;  2QJ0 A;  4UP5 A;  2VPB A;  3O37 A;  2MD7 B;  2KWN A;  2KU3 A;  5KH7 A;  3O7A A;  3U5O A;  4A49 A;  2KE1 A;  3ASL A;  4AYC B;  2I50 A;  3O33 A;  5DIN A;  4GB0 A;  1JOC A;  4QF2 A;  3U5P A;  1WEP A;  2L0B A;  3SOX A;  4YBM A;  2M1R A;  2VPE A;  2MIQ A;  3SOU A;  2M6M A;  2RSD A;  3HCT A;  3DPL R;  3C6W A;  2K1J A;  1Z60 A;  3GL6 A;  2MUM A;  4TKP B;  4YC9 A;  4FIP A;  1IYM A;  1G25 A;  2KGI A;  1WEM A;  2YQL A;  3L11 A;  3N9Q A;  1U6G B;  4YAB A;  3U5N A;  4WZ2 A;  4CA1 A;  5B78 A;  2CSZ A;  2C2L A;  4LK9 A;  3NG2 A;  2FUI A;  1WEE A;  1WIM A;  1T1H A;  2F6J A;  4YAX A;  5G05 B;  5G04 B;  4LLB A;  4BHW A;  4FK5 A;  2VPG A;  1WEO A;  3N9N A;  5I3L A;  3N9P A;  5TDR A;  4ZDT A;  1K2F A;  2LGV A;  5B77 A;  3T6R A;  2LXP C;  2PNX A;  3L1Z B;  3KNV A;  4P5O B;  2ECT A;  2YQM A;  2MT5 A;  2VPD A;  4AP4 A;  5C13 A;  1DVP A;  4V3K C;  1MM2 A;  2NAA A;  3I2D A;  1VYX A;  5FEY A;  2LV9 A;  5J3X A;  2M3H A;  4BBQ A;  2E6R A;  2Y1M A;  2YUC A;  2MD8 C;  4GNG A;  3RTR B;  2JRJ A;  2YHN A;  4R8P K;  3C5K A;  2G43 A;  4WZ0 A;  5FB1 A;  1VFY A;  3U5M A;  1WE9 A;  1WEV A;  5D1L B;  3KV6 A;  2L5U A;  4GNF A;  5D1K B;  3EB6 A;  1WFK A;  2XB1 A;  4O64 A;  2ECG A;  1BOR A;  2MNZ A;  4UP0 A;  5TAB A;  3O35 A;  4XI1 A;  4LAD B;  3SHB A;  1HYI A;  4I7D A;  2KIZ A;  4F52 B;  2ZET C;  1FP0 A;  2KWK A;  3M62 A;  2KYU A;  2LGK A;  2CKL B;  5LKZ A;  3ZVZ B;  1WGM A;  2OXQ C;  2YSJ A;  5D1M B;  4C9Z A;  5LKT A;  2EA6 A;  1JM7 B;  4WA6 A;  3LQI A;  3MHH A;  2QIZ A;  3N9O A;  2D8S A;  4S3O B;  5LKX A;  1Z2Q A;  2YHO A;  4LKA A;  3GV4 A;  1FBV A;  1LDK C;  3QZV A;  4B86 C;  5B75 A;  4MVT A;  2Y43 A;  5H1V A;  4L7X A;  1X4J A;  4N3W A;  4GND A;  2BAY A;  4ZQL A;  5AIT A;  3EB5 A;  2C2V S;  2ECI A;  2KGG A;  1ZBD B;  2VJE A;  2YW8 A;  4UI9 B;  3ZPV E;  5TDW A;  3RPG B;  2LXH C;  2YRE A;  5G0F A;  2K4D A;  2LGG A;  3IHP A;  2KFT A;  4PPE A;  5LKU A;  4YBS A;  4YAD A;  3HCS A;  2H0D B;  2ECV A;  4AYC A;  1CHC A;  2MA6 A;  2EGP A;  2DX8 A;  3LQH A;  2YT5 A;  1WIL A;  4S3O C;  5TRB A;  2G6Q A;  2VJF B;  2QIC A;  2MNY A;  2VNF A;  4B7Y C;  3O34 A;  1V87 A;  4FO9 A;  4A4B A;  4QF3 A;  2KR4 A;  3DQV R;  1WEU A;  1X4I A;  5JG6 A;  5B76 A;  3T7L A;  1JM7 A;  2AN6 A;  1WEW A;  3ZPV 1;  4L58 A;  2F42 A;  3N9L A;  3RPG C;  2MA5 A;  2CT2 A;  4IC2 A;  3HCU A;  4A0C D;  4YBT A;  5KH9 A;  1F62 A;  3HTK C;  3N9M A;  3FL2 A;  4NN2 A;  4R2Y A;  4V3L C;  1WES A;  5LCW B;  5B8D A;  2L43 A;  2HYE D;  4I7B A;  3LRQ A;  2ECW A;  5TBN A;  1WEN A;  2H0D A;  1WEQ A;  2M85 A;  3KV5 A;  3ZNI A;  3LQJ A;  2K17 A;  4Q6F A;  2LGL A;  4FJC A;  3M99 A;  2KWO A;  4X3G A;  2ECN A;  2VJF A;  4CCG X;  4GNE A;  2FSA A;  2FUU A;  2YUR A;  2F6N A;  4LJN A;  1E4U A;  2KRE A;  1VD4 A;  2YU4 A;  2JMI A;  2LN0 A;  2LDR A;  5EYA F;  5B79 A;  3PHD A;  4I7C A;  3PUR A;  3ZTG A;  5FER A;  5H1T A;  4ZUX U;  1N87 A;  1LDJ B;  2K16 A;  5FB0 A;  1RMD A;  3ZYQ A;  5KH3 A;  2VP7 A;  3MHS A;  5H1U A;  3ZVY A;  4A4C A;  4AVX A;  2Y1N A;  2YYR A;  4WZ3 B;  4MSX A;  3PUQ A;  2L80 A;  5AIU A;  2RI7 A;  2YSM A;  2XEU A;  4N4F A;  2E6S A;  4PTB A;  4AUQ B;  4IC3 A;  2CKL A; 
#chains in the Genus database with same CATH topology
 1X4U A;  4YAT A;  4Z0O A;  2CRR A;  1HYJ A;  3KQI A;  3O70 A;  5C11 A;  3L1X A;  3LVQ E;  5DKA A;  4W4U A;  2XOZ A;  3V43 A;  2JMJ A;  2LQ6 A;  2JMD A;  1MM3 A;  2G45 A;  2KWJ A;  1XWH A;  3VK6 A;  2LRI C;  3FAN A;  3PLW A;  3M63 A;  2IDA A;  3SOW A;  4R7E A;  1Z6U A;  3Q1D A;  2PUY A;  2KKY A;  2L75 A;  2HDP A;  2ECJ A;  2CSY A;  5H9M A;  2UZG A;  3O36 A;  2VJE B;  2EOD A;  2QJ0 A;  3FAO A;  4UP5 A;  2VPB A;  3O37 A;  2MD7 B;  2JUN A;  2KWN A;  2KU3 A;  5KH7 A;  3O7A A;  3U5O A;  3E2D A;  4A49 A;  2KE1 A;  3ASL A;  3LVR E;  4AYC B;  2I50 A;  3O33 A;  5DIN A;  4GB0 A;  1JOC A;  2CON A;  4QF2 A;  3U5P A;  2L7P A;  1WEP A;  2L0B A;  3SOX A;  4YBM A;  2M1R A;  2VPE A;  2MIQ A;  3SOU A;  2M6M A;  4OGE A;  2RSD A;  3HCT A;  3DPL R;  3C6W A;  2K1J A;  1Z60 A;  2RR4 A;  3GL6 A;  2MUM A;  4TKP B;  4YC9 A;  4FIP A;  1IYM A;  1G25 A;  3T9K A;  2KGI A;  1WEM A;  2YQL A;  3L11 A;  3N9Q A;  3DWD A;  1U6G B;  4YAB A;  3U5N A;  4WZ2 A;  4CA1 A;  5B78 A;  2CSZ A;  2C2L A;  4LK9 A;  3NG2 A;  2CSV A;  2FUI A;  1WEE A;  1WIM A;  1T1H A;  2F6J A;  4YAX A;  5G05 B;  5G04 B;  4LLB A;  5SVI B;  4BHW A;  4FK5 A;  2VPG A;  1WEO A;  3N9N A;  5I3L A;  3N9P A;  3JUE A;  5TDR A;  4ZDT A;  1K2F A;  2LGV A;  4OGC A;  5B77 A;  3T6R A;  2LXP C;  2PNX A;  3L1Z B;  3KNV A;  4P5O B;  5SVX A;  2P57 A;  2ECT A;  2YQM A;  2MT5 A;  2VPD A;  4AP4 A;  5C13 A;  1DVP A;  4V3K C;  3KDE C;  1MM2 A;  2NAA A;  3I2D A;  1VYX A;  5FEY A;  2LV9 A;  5J3X A;  2M3H A;  4BBQ A;  2E6R A;  2Y1M A;  2YUC A;  2MD8 C;  4GNG A;  3RTR B;  2JRJ A;  2YHN A;  4R8P K;  3C5K A;  2G43 A;  5SVY A;  4WZ0 A;  5FB1 A;  1VFY A;  3M7K A;  3U5M A;  1WE9 A;  1WEV A;  5D1L B;  3KV6 A;  2L5U A;  2EGM A;  4GNF A;  5D1K B;  3EB6 A;  1WFK A;  3O47 A;  3SUB A;  2XOC A;  2XB1 A;  4O64 A;  2ECG A;  1BOR A;  2MNZ A;  4UP0 A;  5TAB A;  3O35 A;  4XI1 A;  4LAD B;  5SVI A;  3SHB A;  1HYI A;  4I7D A;  2JM3 A;  2DJA A;  2KIZ A;  4F52 B;  2ZET C;  1FP0 A;  2KWK A;  3M62 A;  2KYU A;  2LGK A;  2CKL B;  5LKZ A;  3ZVZ B;  1WGM A;  5K3Q A;  2OXQ C;  2YSJ A;  5D1M B;  4C9Z A;  5LKT A;  2EA6 A;  1JM7 B;  4WA6 A;  2KKX A;  3LQI A;  3MHH A;  2QIZ A;  3N9O A;  2D8S A;  4S3O B;  2FFW A;  5LKX A;  1Z2Q A;  2YHO A;  4LKA A;  3GV4 A;  1FBV A;  1LDK C;  4O62 A;  3QZV A;  4B86 C;  3FEH A;  4MVT A;  2Y43 A;  5B75 A;  5H1V A;  4L7X A;  1X4J A;  4N3W A;  4GND A;  2BAY A;  4ZQL A;  5AIT A;  3EB5 A;  2C2V S;  2ECI A;  2KGG A;  1ZBD B;  2VJE A;  2YW8 A;  4UI9 B;  3ZPV E;  5TDW A;  2CRW A;  3RPG B;  2LXH C;  2YRE A;  5G0F A;  2K4D A;  2EXU A;  2LGG A;  3DDT A;  3IHP A;  2KFT A;  4PPE A;  5LKU A;  4YBS A;  4YAD A;  3HCS A;  2H0D B;  2ECV A;  4AYC A;  1CHC A;  2MA6 A;  2EGP A;  2DX8 A;  3LQH A;  2YT5 A;  1WIL A;  4S3O C;  5TRB A;  2G6Q A;  2VJF B;  2QIC A;  2MNY A;  2VNF A;  4B7Y C;  4H9D A;  3O34 A;  1V87 A;  4FO9 A;  4A4B A;  4QF3 A;  2KR4 A;  3DQV R;  4F1P A;  1WEU A;  1X4I A;  5JG6 A;  2D8U A;  2OWA A;  5B76 A;  3T7L A;  1JM7 A;  4Z0R A;  2MKE A;  2AN6 A;  1WEW A;  3ZPV 1;  4L58 A;  2F42 A;  3N9L A;  3RPG C;  2MA5 A;  2CT2 A;  4IC2 A;  3HCU A;  4A0C D;  4YBT A;  5KH9 A;  1F62 A;  3HTK C;  3N9M A;  3FL2 A;  3FM8 C;  4NN2 A;  4R2Y A;  4V3L C;  3LJU X;  1WES A;  2YVR A;  5LCW B;  3H7H A;  5B8D A;  2L43 A;  2HYE D;  4QQ4 A;  2XOY A;  2XP0 A;  1DCQ A;  3LRQ A;  2ECW A;  4I7B A;  5TBN A;  3LDY A;  1WEN A;  2H0D A;  1WEQ A;  2M85 A;  3KV5 A;  3ZNI A;  3LQJ A;  2K17 A;  4Q6F A;  2LGL A;  4FJC A;  3M99 A;  2KWO A;  2M13 A;  2DSM A;  4X3G A;  2ECN A;  2VJF A;  4CCG X;  4GNE A;  2FSA A;  2FD4 A;  2FUU A;  2YUR A;  2F6N A;  4LJN A;  1E4U A;  2E61 A;  2KRE A;  1VD4 A;  1MBM A;  2YU4 A;  2JMI A;  2LN0 A;  2LDR A;  5EYA F;  5B79 A;  3PHD A;  4I7C A;  3PUR A;  3MDB C;  3ZTG A;  5FER A;  5H1T A;  4ZUX U;  1N87 A;  1LDJ B;  2K16 A;  5FB0 A;  1RMD A;  3ZYQ A;  2IQJ A;  5KH3 A;  2VP7 A;  3MHS A;  5H1U A;  3ZVY A;  4A4C A;  2B0O E;  4AVX A;  2Y1N A;  2YYR A;  4WZ3 B;  4MSX A;  3PUQ A;  2L80 A;  5AIU A;  2RI7 A;  2YSM A;  2XEU A;  4N4F A;  2E6S A;  4PTB A;  4AUQ B;  2LAU A;  3FJU B;  4IC3 A;  2CKL A; 
#chains in the Genus database with same CATH homology
 1X4U A;  4YAT A;  1HYJ A;  3KQI A;  3O70 A;  5C11 A;  3L1X A;  5DKA A;  4W4U A;  3V43 A;  2JMJ A;  2LQ6 A;  2JMD A;  1MM3 A;  2G45 A;  2KWJ A;  1XWH A;  3VK6 A;  2LRI C;  3M63 A;  2IDA A;  3SOW A;  4R7E A;  1Z6U A;  2PUY A;  2L75 A;  2HDP A;  2ECJ A;  2CSY A;  5H9M A;  2UZG A;  3O36 A;  2VJE B;  2EOD A;  2QJ0 A;  4UP5 A;  2VPB A;  3O37 A;  2MD7 B;  2KWN A;  2KU3 A;  5KH7 A;  3O7A A;  3U5O A;  4A49 A;  2KE1 A;  3ASL A;  4AYC B;  2I50 A;  3O33 A;  5DIN A;  4GB0 A;  1JOC A;  4QF2 A;  3U5P A;  1WEP A;  2L0B A;  3SOX A;  4YBM A;  2M1R A;  2VPE A;  2MIQ A;  3SOU A;  2M6M A;  2RSD A;  3HCT A;  3DPL R;  3C6W A;  2K1J A;  1Z60 A;  3GL6 A;  2MUM A;  4TKP B;  4YC9 A;  4FIP A;  1IYM A;  1G25 A;  2KGI A;  1WEM A;  2YQL A;  3L11 A;  3N9Q A;  1U6G B;  4YAB A;  3U5N A;  4WZ2 A;  4CA1 A;  5B78 A;  2CSZ A;  2C2L A;  4LK9 A;  3NG2 A;  2FUI A;  1WEE A;  1WIM A;  1T1H A;  2F6J A;  4YAX A;  5G05 B;  5G04 B;  4LLB A;  4BHW A;  4FK5 A;  2VPG A;  1WEO A;  3N9N A;  5I3L A;  3N9P A;  5TDR A;  4ZDT A;  1K2F A;  2LGV A;  5B77 A;  3T6R A;  2LXP C;  2PNX A;  3L1Z B;  3KNV A;  4P5O B;  2ECT A;  2YQM A;  2MT5 A;  2VPD A;  4AP4 A;  5C13 A;  1DVP A;  4V3K C;  1MM2 A;  2NAA A;  3I2D A;  1VYX A;  5FEY A;  2LV9 A;  5J3X A;  2M3H A;  4BBQ A;  2E6R A;  2Y1M A;  2YUC A;  2MD8 C;  4GNG A;  3RTR B;  2JRJ A;  2YHN A;  4R8P K;  3C5K A;  2G43 A;  4WZ0 A;  5FB1 A;  1VFY A;  3U5M A;  1WE9 A;  1WEV A;  5D1L B;  3KV6 A;  2L5U A;  4GNF A;  5D1K B;  3EB6 A;  1WFK A;  2XB1 A;  4O64 A;  2ECG A;  1BOR A;  2MNZ A;  4UP0 A;  5TAB A;  3O35 A;  4XI1 A;  4LAD B;  3SHB A;  1HYI A;  4I7D A;  2KIZ A;  4F52 B;  2ZET C;  1FP0 A;  2KWK A;  3M62 A;  2KYU A;  2LGK A;  2CKL B;  5LKZ A;  3ZVZ B;  1WGM A;  2OXQ C;  2YSJ A;  5D1M B;  4C9Z A;  5LKT A;  2EA6 A;  1JM7 B;  4WA6 A;  3LQI A;  3MHH A;  2QIZ A;  3N9O A;  2D8S A;  4S3O B;  5LKX A;  1Z2Q A;  2YHO A;  4LKA A;  3GV4 A;  1FBV A;  1LDK C;  3QZV A;  4B86 C;  5B75 A;  4MVT A;  2Y43 A;  5H1V A;  4L7X A;  1X4J A;  4N3W A;  4GND A;  2BAY A;  4ZQL A;  5AIT A;  3EB5 A;  2C2V S;  2ECI A;  2KGG A;  1ZBD B;  2VJE A;  2YW8 A;  4UI9 B;  3ZPV E;  5TDW A;  3RPG B;  2LXH C;  2YRE A;  5G0F A;  2K4D A;  2LGG A;  3IHP A;  2KFT A;  4PPE A;  5LKU A;  4YBS A;  4YAD A;  3HCS A;  2H0D B;  2ECV A;  4AYC A;  1CHC A;  2MA6 A;  2EGP A;  2DX8 A;  3LQH A;  2YT5 A;  1WIL A;  4S3O C;  5TRB A;  2G6Q A;  2VJF B;  2QIC A;  2MNY A;  2VNF A;  4B7Y C;  3O34 A;  1V87 A;  4FO9 A;  4A4B A;  4QF3 A;  2KR4 A;  3DQV R;  1WEU A;  1X4I A;  5JG6 A;  5B76 A;  3T7L A;  1JM7 A;  2AN6 A;  1WEW A;  3ZPV 1;  4L58 A;  2F42 A;  3N9L A;  3RPG C;  2MA5 A;  2CT2 A;  4IC2 A;  3HCU A;  4A0C D;  4YBT A;  5KH9 A;  1F62 A;  3HTK C;  3N9M A;  3FL2 A;  4NN2 A;  4R2Y A;  4V3L C;  1WES A;  5LCW B;  5B8D A;  2L43 A;  2HYE D;  4I7B A;  3LRQ A;  2ECW A;  5TBN A;  1WEN A;  2H0D A;  1WEQ A;  2M85 A;  3KV5 A;  3ZNI A;  3LQJ A;  2K17 A;  4Q6F A;  2LGL A;  4FJC A;  3M99 A;  2KWO A;  4X3G A;  2ECN A;  2VJF A;  4CCG X;  4GNE A;  2FSA A;  2FUU A;  2YUR A;  2F6N A;  4LJN A;  1E4U A;  2KRE A;  1VD4 A;  2YU4 A;  2JMI A;  2LN0 A;  2LDR A;  5EYA F;  5B79 A;  3PHD A;  4I7C A;  3PUR A;  3ZTG A;  5FER A;  5H1T A;  4ZUX U;  1N87 A;  1LDJ B;  2K16 A;  5FB0 A;  1RMD A;  3ZYQ A;  5KH3 A;  2VP7 A;  3MHS A;  5H1U A;  3ZVY A;  4A4C A;  4AVX A;  2Y1N A;  2YYR A;  4WZ3 B;  4MSX A;  3PUQ A;  2L80 A;  5AIU A;  2RI7 A;  2YSM A;  2XEU A;  4N4F A;  2E6S A;  4PTB A;  4AUQ B;  4IC3 A;  2CKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...