2H0DA

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
TRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B lymphoma Mo-MLV insertion region
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/ligase
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dA00
4F52B 1WILA 5AITA 2L43A 2PNXA 2MA5A 2M85A 3U5PA 4L7XA 4YADA 3LQJA 3N9QA 3EB5A 3N9LA 4MVTA 4YAXA 2KE1A 2KWNA 5DINA 4UI9B 3ZPVE 2M6MA 2ECNA 3MHSA 2VJEA 5LCWB 1WEPA 3ZVYA 2ECVA 4LK9A 2K4DA 3N9PA 4QF2A 4P5OB 2XEUA 5G05B 3FL2A 5B75A 5B79A 2KWJA 2KREA 4AYCA 5LKZA 2K16A 4I7CA 1VFYA 2MA6A 4S3OC 2LXHC 3GV4A 3V43A 4YBTA 3KNVA 1V87A 1WEOA 2I50A 4I7DA 4FIPA 3N9OA 4A49A 2L5UA 1U6GB 3HTKC 2LV9A 5B77A 4LKAA 2G43A 3O70A 4R8PK 3U5OA 1HYJA 2ZETC 2CKLA 2DX8A 1G25A 5G04B 4A4CA 3O33A 5KH9A 3N9MA 3RTRB 3LQIA 1WENA 3MHHA 2YSMA 2LGGA 1WEUA 1Z2QA 2LXPC 2KGGA 3VK6A 5H1UA 5TDWA 4IC3A 2XB1A 2FUIA 2M1RA 5KH3A 4V3KC 4B7YC 2VPEA 2YW8A 3NG2A 5C11A 3HCTA 5D1LB 5LKTA 2VPDA 1HYIA 5TABA 4AUQB 4Q6FA 3L11A 1E4UA 5LKUA 2KU3A 2ECWA 2ECIA 2F42A 3M63A 2VNFA 3LRQA 4MSXA 3O34A 1MM3A 4UP5A 1K2FA 3IHPA 4W4UA 5B78A 1Z6UA 2YU4A 1X4UA 3SOWA 4LADB 3L1XA 4FK5A 2VJFA 3RPGB 2M3HA 3KQIA 5H1TA 4BBQA 4AVXA 5B76A 4CA1A 1WESA 3SHBA 2JMDA 4WA6A 4QF3A 2LGKA 4XI1A 4L58A 2PUYA 3M62A 2BAYA 2VJEB 1VD4A 1WEQA 1FP0A 4YATA 2YURA 1JM7A 1VYXA 3O35A 3O7AA 4GNGA 2RI7A 2MIQA 4N3WA 5TBNA 2IDAA 2EGPA 2YHNA 2K17A 5I3LA 4B86C 5G0FA 4R2YA 3U5MA 4FJCA 4GB0A 4AP4A 4AYCB 5FERA 2LQ6A 2RSDA 1MM2A 3QZVA 2F6JA 2LGLA 3PHDA 4NN2A 3HCSA 2H0DA 5D1KB 2Y1MA 4LLBA 2L80A 2YSJA 4ZUXU 3ZPV1 2LGVA 2YYRA 2AN6A 1XWHA 4FO9A 3SOUA 2LRIC 2LN0A 3C5KA 2MNYA 3O37A 2KYUA 2CKLB 4A0CD 3SOXA 3RPGC 1X4JA 5C13A 2QJ0A 3PUQA 1ZBDB 3HCUA 2YHOA 5D1MB 5JG6A 2VP7A 2MNZA 3I2DA 3U5NA 2KWOA 3GL6A 4C9ZA 2KGIA 4S3OB 3ZTGA 2FUUA 2YQMA 1DVPA 2YQLA 2CSYA 2QIZA 1IYMA 4ZQLA 1CHCA 3PURA 1WEEA 1X4IA 5H1VA 2G45A 2MD8C 4YC9A 1RMDA 3LQHA 4I7BA 3T7LA 3DPLR 3KV5A 2EA6A 1WFKA 5EYAF 5KH7A 2YREA 1WEWA 1BORA 1WEVA 4GNDA 2ECGA 3N9NA 1JOCA 2C2LA 3L1ZB 2VJFB 2VPGA 2C2VS 2NAAA 5FEYA 3ZVZB 4N4FA 2VPBA 2KFTA 3ASLA 2CSZA 2CT2A 2HDPA 4PTBA 2HYED 5DKAA 4A4BA 3ZNIA 2D8SA 2FSAA 5TRBA 5B8DA 2E6SA 1WIMA 4YBSA 1WGMA 2ECTA 2MT5A 2OXQC 2YT5A 2MUMA 1JM7B 5J3XA 5FB1A 2L75A 4R7EA 2L0BA 2JMJA 2F6NA 4CCGX 2KIZA 5LKXA 3O36A 2Y43A 4WZ3B 4GNEA 2JMIA 2KR4A 2QICA 4WZ0A 3EB6A 2KWKA 2E6RA 4O64A 1WE9A 4TKPB 2H0DB 2UZGA 1LDKC 2JRJA 2ECJA 3M99A 2LDRA 3KV6A 5TDRA 4GNFA 5AIUA 1LDJB 4UP0A 4ZDTA 5H9MA 4YBMA 4PPEA 2YUCA 2K1JA 1F62A 4X3GA 1FBVA 3C6WA 4V3LC 4YABA 3T6RA 3ZYQA 4IC2A 4LJNA 1N87A 2G6QA 1WEMA 5FB0A 3DQVR 4WZ2A 2Y1NA 4BHWA 2MD7B 1T1HA 2EODA 1Z60A
chains in the Genus database with same CATH superfamily
2XOCA 4F52B 1WILA 2FD4A 5AITA 2L43A 2PNXA 2MA5A 2M85A 3U5PA 4L7XA 4YADA 3LQJA 3N9QA 3EB5A 3N9LA 4MVTA 4YAXA 2KE1A 2KWNA 4OGCA 5DINA 4UI9B 3ZPVE 2M6MA 5K3QA 2ECNA 3MHSA 2VJEA 2RR4A 4O62A 5LCWB 1WEPA 3ZVYA 2ECVA 4LK9A 2K4DA 3N9PA 4QF2A 3FM8C 4P5OB 2XEUA 5G05B 3FL2A 3JUEA 5SVXA 5B75A 5B79A 2XOYA 2KWJA 2KREA 2OWAA 4AYCA 5LKZA 2K16A 4I7CA 3LJUX 4QQ4A 1VFYA 2MA6A 4S3OC 2LXHC 3GV4A 3LVQE 3Q1DA 3V43A 4YBTA 3KNVA 1V87A 1WEOA 2I50A 4I7DA 4FIPA 3N9OA 4A49A 2L5UA 1U6GB 3HTKC 2LV9A 5B77A 4LKAA 2G43A 3O70A 4R8PK 3U5OA 1HYJA 2ZETC 2KKYA 2CKLA 2DX8A 1G25A 5G04B 4A4CA 4Z0OA 3O33A 5KH9A 3N9MA 3RTRB 3LQIA 1WENA 3MHHA 2YSMA 2LGGA 1WEUA 1Z2QA 2LXPC 2KGGA 3VK6A 5H1UA 3KDEC 5TDWA 3SUBA 4IC3A 2XB1A 2FUIA 2M1RA 5KH3A 4V3KC 4B7YC 2VPEA 2YW8A 2P57A 3NG2A 5C11A 2D8UA 3HCTA 2L7PA 5D1LB 5LKTA 2VPDA 1HYIA 5TABA 4AUQB 4Q6FA 3L11A 2DSMA 2CRWA 1E4UA 5LKUA 2KU3A 2ECWA 2YVRA 2ECIA 2F42A 3M63A 2VNFA 3LRQA 4MSXA 3T9KA 3O34A 2JUNA 1MM3A 4UP5A 1K2FA 3IHPA 4W4UA 5B78A 1Z6UA 2YU4A 1X4UA 3SOWA 4LADB 3L1XA 4FK5A 2VJFA 1DCQA 3RPGB 2M3HA 3KQIA 5H1TA 4BBQA 4AVXA 5B76A 4CA1A 1WESA 3SHBA 2JMDA 4WA6A 4QF3A 2LGKA 4XI1A 4L58A 2PUYA 3M62A 2BAYA 2VJEB 1VD4A 4OGEA 1WEQA 2IQJA 1FP0A 4YATA 2YURA 1JM7A 1VYXA 3O35A 3O7AA 4GNGA 2RI7A 2MIQA 4N3WA 5TBNA 2IDAA 2EGPA 2YHNA 2K17A 5I3LA 4B86C 5G0FA 4R2YA 3U5MA 4FJCA 4GB0A 1MBMA 4AP4A 4AYCB 2LAUA 5FERA 2XOZA 2LQ6A 2RSDA 1MM2A 3QZVA 2F6JA 2LGLA 3PHDA 4NN2A 3HCSA 2H0DA 5D1KB 2Y1MA 4LLBA 2L80A 2YSJA 4ZUXU 3ZPV1 2LGVA 2YYRA 2AN6A 1XWHA 4FO9A 3SOUA 2LRIC 2LN0A 3C5KA 2MNYA 3O37A 2KYUA 3PLWA 2CKLB 4A0CD 3SOXA 3RPGC 3DWDA 1X4JA 5C13A 2QJ0A 3PUQA 2CONA 1ZBDB 5SVYA 3HCUA 2YHOA 5D1MB 5JG6A 2VP7A 2MNZA 3I2DA 3U5NA 2KWOA 5SVIA 3GL6A 4C9ZA 2B0OE 2KGIA 4S3OB 3ZTGA 2FUUA 2YQMA 3O47A 1DVPA 2YQLA 2CSYA 2QIZA 3FEHA 1IYMA 2EXUA 2KKXA 4ZQLA 1CHCA 3PURA 1WEEA 1X4IA 2MKEA 5H1VA 2G45A 2MD8C 3DDTA 4YC9A 1RMDA 3LQHA 4I7BA 3T7LA 3FAOA 3DPLR 3KV5A 2EA6A 1WFKA 2E61A 5EYAF 4F1PA 3M7KA 5KH7A 3LDYA 2YREA 2CSVA 2DJAA 1WEWA 1BORA 1WEVA 4GNDA 2ECGA 3N9NA 1JOCA 2C2LA 3L1ZB 2VJFB 2VPGA 2C2VS 2NAAA 5FEYA 3ZVZB 2XP0A 4N4FA 2VPBA 2KFTA 3ASLA 2CSZA 2CT2A 2HDPA 4PTBA 2HYED 5DKAA 4A4BA 2CRRA 3ZNIA 2D8SA 2FSAA 5TRBA 5B8DA 2E6SA 1WIMA 4YBSA 1WGMA 2ECTA 2MT5A 2OXQC 2YT5A 2MUMA 1JM7B 2EGMA 5J3XA 5FB1A 2L75A 4R7EA 2L0BA 2JMJA 2F6NA 4CCGX 4H9DA 2KIZA 5LKXA 3O36A 2JM3A 2Y43A 4WZ3B 4GNEA 2JMIA 2KR4A 2FFWA 2QICA 3H7HA 4WZ0A 3EB6A 2KWKA 2E6RA 4O64A 3MDBC 1WE9A 4TKPB 3FANA 2H0DB 2UZGA 1LDKC 2JRJA 2ECJA 3M99A 2LDRA 3FJUB 3KV6A 5TDRA 4GNFA 5AIUA 1LDJB 4UP0A 4ZDTA 3E2DA 5H9MA 4YBMA 4PPEA 3LVRE 2YUCA 2K1JA 1F62A 4X3GA 1FBVA 3C6WA 4V3LC 4YABA 3T6RA 3ZYQA 4Z0RA 4IC2A 2M13A 4LJNA 1N87A 2G6QA 1WEMA 5FB0A 3DQVR 4WZ2A 2Y1NA 4BHWA 2MD7B 1T1HA 2EODA 1Z60A 5SVIB
chains in the Genus database with same CATH topology
4F52B 1WILA 5AITA 2L43A 2PNXA 2MA5A 2M85A 3U5PA 4L7XA 4YADA 3LQJA 3N9QA 3EB5A 3N9LA 4MVTA 4YAXA 2KE1A 2KWNA 5DINA 4UI9B 3ZPVE 2M6MA 2ECNA 3MHSA 2VJEA 5LCWB 1WEPA 3ZVYA 2ECVA 4LK9A 2K4DA 3N9PA 4QF2A 4P5OB 2XEUA 5G05B 3FL2A 5B75A 5B79A 2KWJA 2KREA 4AYCA 5LKZA 2K16A 4I7CA 1VFYA 2MA6A 4S3OC 2LXHC 3GV4A 3V43A 4YBTA 3KNVA 1V87A 1WEOA 2I50A 4I7DA 4FIPA 3N9OA 4A49A 2L5UA 1U6GB 3HTKC 2LV9A 5B77A 4LKAA 2G43A 3O70A 4R8PK 3U5OA 1HYJA 2ZETC 2CKLA 2DX8A 1G25A 5G04B 4A4CA 3O33A 5KH9A 3N9MA 3RTRB 3LQIA 1WENA 3MHHA 2YSMA 2LGGA 1WEUA 1Z2QA 2LXPC 2KGGA 3VK6A 5H1UA 5TDWA 4IC3A 2XB1A 2FUIA 2M1RA 5KH3A 4V3KC 4B7YC 2VPEA 2YW8A 3NG2A 5C11A 3HCTA 5D1LB 5LKTA 2VPDA 1HYIA 5TABA 4AUQB 4Q6FA 3L11A 1E4UA 5LKUA 2KU3A 2ECWA 2ECIA 2F42A 3M63A 2VNFA 3LRQA 4MSXA 3O34A 1MM3A 4UP5A 1K2FA 3IHPA 4W4UA 5B78A 1Z6UA 2YU4A 1X4UA 3SOWA 4LADB 3L1XA 4FK5A 2VJFA 3RPGB 2M3HA 3KQIA 5H1TA 4BBQA 4AVXA 5B76A 4CA1A 1WESA 3SHBA 2JMDA 4WA6A 4QF3A 2LGKA 4XI1A 4L58A 2PUYA 3M62A 2BAYA 2VJEB 1VD4A 1WEQA 1FP0A 4YATA 2YURA 1JM7A 1VYXA 3O35A 3O7AA 4GNGA 2RI7A 2MIQA 4N3WA 5TBNA 2IDAA 2EGPA 2YHNA 2K17A 5I3LA 4B86C 5G0FA 4R2YA 3U5MA 4FJCA 4GB0A 4AP4A 4AYCB 5FERA 2LQ6A 2RSDA 1MM2A 3QZVA 2F6JA 2LGLA 3PHDA 4NN2A 3HCSA 2H0DA 5D1KB 2Y1MA 4LLBA 2L80A 2YSJA 4ZUXU 3ZPV1 2LGVA 2YYRA 2AN6A 1XWHA 4FO9A 3SOUA 2LRIC 2LN0A 3C5KA 2MNYA 3O37A 2KYUA 2CKLB 4A0CD 3SOXA 3RPGC 1X4JA 5C13A 2QJ0A 3PUQA 1ZBDB 3HCUA 2YHOA 5D1MB 5JG6A 2VP7A 2MNZA 3I2DA 3U5NA 2KWOA 3GL6A 4C9ZA 2KGIA 4S3OB 3ZTGA 2FUUA 2YQMA 1DVPA 2YQLA 2CSYA 2QIZA 1IYMA 4ZQLA 1CHCA 3PURA 1WEEA 1X4IA 5H1VA 2G45A 2MD8C 4YC9A 1RMDA 3LQHA 4I7BA 3T7LA 3DPLR 3KV5A 2EA6A 1WFKA 5EYAF 5KH7A 2YREA 1WEWA 1BORA 1WEVA 4GNDA 2ECGA 3N9NA 1JOCA 2C2LA 3L1ZB 2VJFB 2VPGA 2C2VS 2NAAA 5FEYA 3ZVZB 4N4FA 2VPBA 2KFTA 3ASLA 2CSZA 2CT2A 2HDPA 4PTBA 2HYED 5DKAA 4A4BA 3ZNIA 2D8SA 2FSAA 5TRBA 5B8DA 2E6SA 1WIMA 4YBSA 1WGMA 2ECTA 2MT5A 2OXQC 2YT5A 2MUMA 1JM7B 5J3XA 5FB1A 2L75A 4R7EA 2L0BA 2JMJA 2F6NA 4CCGX 2KIZA 5LKXA 3O36A 2Y43A 4WZ3B 4GNEA 2JMIA 2KR4A 2QICA 4WZ0A 3EB6A 2KWKA 2E6RA 4O64A 1WE9A 4TKPB 2H0DB 2UZGA 1LDKC 2JRJA 2ECJA 3M99A 2LDRA 3KV6A 5TDRA 4GNFA 5AIUA 1LDJB 4UP0A 4ZDTA 5H9MA 4YBMA 4PPEA 2YUCA 2K1JA 1F62A 4X3GA 1FBVA 3C6WA 4V3LC 4YABA 3T6RA 3ZYQA 4IC2A 4LJNA 1N87A 2G6QA 1WEMA 5FB0A 3DQVR 4WZ2A 2Y1NA 4BHWA 2MD7B 1T1HA 2EODA 1Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F52 B;  1WIL A;  5AIT A;  2L43 A;  2PNX A;  2MA5 A;  2M85 A;  3U5P A;  4L7X A;  4YAD A;  3LQJ A;  3N9Q A;  3EB5 A;  3N9L A;  4MVT A;  4YAX A;  2KE1 A;  2KWN A;  5DIN A;  4UI9 B;  3ZPV E;  2M6M A;  2ECN A;  3MHS A;  2VJE A;  5LCW B;  1WEP A;  3ZVY A;  2ECV A;  4LK9 A;  2K4D A;  3N9P A;  4QF2 A;  4P5O B;  2XEU A;  5G05 B;  3FL2 A;  5B75 A;  5B79 A;  2KWJ A;  2KRE A;  4AYC A;  5LKZ A;  2K16 A;  4I7C A;  1VFY A;  2MA6 A;  4S3O C;  2LXH C;  3GV4 A;  3V43 A;  4YBT A;  3KNV A;  1V87 A;  1WEO A;  2I50 A;  4I7D A;  4FIP A;  3N9O A;  4A49 A;  2L5U A;  1U6G B;  3HTK C;  2LV9 A;  5B77 A;  4LKA A;  2G43 A;  3O70 A;  4R8P K;  3U5O A;  1HYJ A;  2ZET C;  2CKL A;  2DX8 A;  1G25 A;  5G04 B;  4A4C A;  3O33 A;  5KH9 A;  3N9M A;  3RTR B;  3LQI A;  1WEN A;  3MHH A;  2YSM A;  2LGG A;  1WEU A;  1Z2Q A;  2LXP C;  2KGG A;  3VK6 A;  5H1U A;  5TDW A;  4IC3 A;  2XB1 A;  2FUI A;  2M1R A;  5KH3 A;  4V3K C;  4B7Y C;  2VPE A;  2YW8 A;  3NG2 A;  5C11 A;  3HCT A;  5D1L B;  5LKT A;  2VPD A;  1HYI A;  5TAB A;  4AUQ B;  4Q6F A;  3L11 A;  1E4U A;  5LKU A;  2KU3 A;  2ECW A;  2ECI A;  2F42 A;  3M63 A;  2VNF A;  3LRQ A;  4MSX A;  3O34 A;  1MM3 A;  4UP5 A;  1K2F A;  3IHP A;  4W4U A;  5B78 A;  1Z6U A;  2YU4 A;  1X4U A;  3SOW A;  4LAD B;  3L1X A;  4FK5 A;  2VJF A;  3RPG B;  2M3H A;  3KQI A;  5H1T A;  4BBQ A;  4AVX A;  5B76 A;  4CA1 A;  1WES A;  3SHB A;  2JMD A;  4WA6 A;  4QF3 A;  2LGK A;  4XI1 A;  4L58 A;  2PUY A;  3M62 A;  2BAY A;  2VJE B;  1VD4 A;  1WEQ A;  1FP0 A;  4YAT A;  2YUR A;  1JM7 A;  1VYX A;  3O35 A;  3O7A A;  4GNG A;  2RI7 A;  2MIQ A;  4N3W A;  5TBN A;  2IDA A;  2EGP A;  2YHN A;  2K17 A;  5I3L A;  4B86 C;  5G0F A;  4R2Y A;  3U5M A;  4FJC A;  4GB0 A;  4AP4 A;  4AYC B;  5FER A;  2LQ6 A;  2RSD A;  1MM2 A;  3QZV A;  2F6J A;  2LGL A;  3PHD A;  4NN2 A;  3HCS A;  2H0D A;  5D1K B;  2Y1M A;  4LLB A;  2L80 A;  2YSJ A;  4ZUX U;  3ZPV 1;  2LGV A;  2YYR A;  2AN6 A;  1XWH A;  4FO9 A;  3SOU A;  2LRI C;  2LN0 A;  3C5K A;  2MNY A;  3O37 A;  2KYU A;  2CKL B;  4A0C D;  3SOX A;  3RPG C;  1X4J A;  5C13 A;  2QJ0 A;  3PUQ A;  1ZBD B;  3HCU A;  2YHO A;  5D1M B;  5JG6 A;  2VP7 A;  2MNZ A;  3I2D A;  3U5N A;  2KWO A;  3GL6 A;  4C9Z A;  2KGI A;  4S3O B;  3ZTG A;  2FUU A;  2YQM A;  1DVP A;  2YQL A;  2CSY A;  2QIZ A;  1IYM A;  4ZQL A;  1CHC A;  3PUR A;  1WEE A;  1X4I A;  5H1V A;  2G45 A;  2MD8 C;  4YC9 A;  1RMD A;  3LQH A;  4I7B A;  3T7L A;  3DPL R;  3KV5 A;  2EA6 A;  1WFK A;  5EYA F;  5KH7 A;  2YRE A;  1WEW A;  1BOR A;  1WEV A;  4GND A;  2ECG A;  3N9N A;  1JOC A;  2C2L A;  3L1Z B;  2VJF B;  2VPG A;  2C2V S;  2NAA A;  5FEY A;  3ZVZ B;  4N4F A;  2VPB A;  2KFT A;  3ASL A;  2CSZ A;  2CT2 A;  2HDP A;  4PTB A;  2HYE D;  5DKA A;  4A4B A;  3ZNI A;  2D8S A;  2FSA A;  5TRB A;  5B8D A;  2E6S A;  1WIM A;  4YBS A;  1WGM A;  2ECT A;  2MT5 A;  2OXQ C;  2YT5 A;  2MUM A;  1JM7 B;  5J3X A;  5FB1 A;  2L75 A;  4R7E A;  2L0B A;  2JMJ A;  2F6N A;  4CCG X;  2KIZ A;  5LKX A;  3O36 A;  2Y43 A;  4WZ3 B;  4GNE A;  2JMI A;  2KR4 A;  2QIC A;  4WZ0 A;  3EB6 A;  2KWK A;  2E6R A;  4O64 A;  1WE9 A;  4TKP B;  2H0D B;  2UZG A;  1LDK C;  2JRJ A;  2ECJ A;  3M99 A;  2LDR A;  3KV6 A;  5TDR A;  4GNF A;  5AIU A;  1LDJ B;  4UP0 A;  4ZDT A;  5H9M A;  4YBM A;  4PPE A;  2YUC A;  2K1J A;  1F62 A;  4X3G A;  1FBV A;  3C6W A;  4V3L C;  4YAB A;  3T6R A;  3ZYQ A;  4IC2 A;  4LJN A;  1N87 A;  2G6Q A;  1WEM A;  5FB0 A;  3DQV R;  4WZ2 A;  2Y1N A;  4BHW A;  2MD7 B;  1T1H A;  2EOD A;  1Z60 A; 
#chains in the Genus database with same CATH topology
 2XOC A;  4F52 B;  1WIL A;  2FD4 A;  5AIT A;  2L43 A;  2PNX A;  2MA5 A;  2M85 A;  3U5P A;  4L7X A;  4YAD A;  3LQJ A;  3N9Q A;  3EB5 A;  3N9L A;  4MVT A;  4YAX A;  2KE1 A;  2KWN A;  4OGC A;  5DIN A;  4UI9 B;  3ZPV E;  2M6M A;  5K3Q A;  2ECN A;  3MHS A;  2VJE A;  2RR4 A;  4O62 A;  5LCW B;  1WEP A;  3ZVY A;  2ECV A;  4LK9 A;  2K4D A;  3N9P A;  4QF2 A;  3FM8 C;  4P5O B;  2XEU A;  5G05 B;  3FL2 A;  3JUE A;  5SVX A;  5B75 A;  5B79 A;  2XOY A;  2KWJ A;  2KRE A;  2OWA A;  4AYC A;  5LKZ A;  2K16 A;  4I7C A;  3LJU X;  4QQ4 A;  1VFY A;  2MA6 A;  4S3O C;  2LXH C;  3GV4 A;  3LVQ E;  3Q1D A;  3V43 A;  4YBT A;  3KNV A;  1V87 A;  1WEO A;  2I50 A;  4I7D A;  4FIP A;  3N9O A;  4A49 A;  2L5U A;  1U6G B;  3HTK C;  2LV9 A;  5B77 A;  4LKA A;  2G43 A;  3O70 A;  4R8P K;  3U5O A;  1HYJ A;  2ZET C;  2KKY A;  2CKL A;  2DX8 A;  1G25 A;  5G04 B;  4A4C A;  4Z0O A;  3O33 A;  5KH9 A;  3N9M A;  3RTR B;  3LQI A;  1WEN A;  3MHH A;  2YSM A;  2LGG A;  1WEU A;  1Z2Q A;  2LXP C;  2KGG A;  3VK6 A;  5H1U A;  3KDE C;  5TDW A;  3SUB A;  4IC3 A;  2XB1 A;  2FUI A;  2M1R A;  5KH3 A;  4V3K C;  4B7Y C;  2VPE A;  2YW8 A;  2P57 A;  3NG2 A;  5C11 A;  2D8U A;  3HCT A;  2L7P A;  5D1L B;  5LKT A;  2VPD A;  1HYI A;  5TAB A;  4AUQ B;  4Q6F A;  3L11 A;  2DSM A;  2CRW A;  1E4U A;  5LKU A;  2KU3 A;  2ECW A;  2YVR A;  2ECI A;  2F42 A;  3M63 A;  2VNF A;  3LRQ A;  4MSX A;  3T9K A;  3O34 A;  2JUN A;  1MM3 A;  4UP5 A;  1K2F A;  3IHP A;  4W4U A;  5B78 A;  1Z6U A;  2YU4 A;  1X4U A;  3SOW A;  4LAD B;  3L1X A;  4FK5 A;  2VJF A;  1DCQ A;  3RPG B;  2M3H A;  3KQI A;  5H1T A;  4BBQ A;  4AVX A;  5B76 A;  4CA1 A;  1WES A;  3SHB A;  2JMD A;  4WA6 A;  4QF3 A;  2LGK A;  4XI1 A;  4L58 A;  2PUY A;  3M62 A;  2BAY A;  2VJE B;  1VD4 A;  4OGE A;  1WEQ A;  2IQJ A;  1FP0 A;  4YAT A;  2YUR A;  1JM7 A;  1VYX A;  3O35 A;  3O7A A;  4GNG A;  2RI7 A;  2MIQ A;  4N3W A;  5TBN A;  2IDA A;  2EGP A;  2YHN A;  2K17 A;  5I3L A;  4B86 C;  5G0F A;  4R2Y A;  3U5M A;  4FJC A;  4GB0 A;  1MBM A;  4AP4 A;  4AYC B;  2LAU A;  5FER A;  2XOZ A;  2LQ6 A;  2RSD A;  1MM2 A;  3QZV A;  2F6J A;  2LGL A;  3PHD A;  4NN2 A;  3HCS A;  2H0D A;  5D1K B;  2Y1M A;  4LLB A;  2L80 A;  2YSJ A;  4ZUX U;  3ZPV 1;  2LGV A;  2YYR A;  2AN6 A;  1XWH A;  4FO9 A;  3SOU A;  2LRI C;  2LN0 A;  3C5K A;  2MNY A;  3O37 A;  2KYU A;  3PLW A;  2CKL B;  4A0C D;  3SOX A;  3RPG C;  3DWD A;  1X4J A;  5C13 A;  2QJ0 A;  3PUQ A;  2CON A;  1ZBD B;  5SVY A;  3HCU A;  2YHO A;  5D1M B;  5JG6 A;  2VP7 A;  2MNZ A;  3I2D A;  3U5N A;  2KWO A;  5SVI A;  3GL6 A;  4C9Z A;  2B0O E;  2KGI A;  4S3O B;  3ZTG A;  2FUU A;  2YQM A;  3O47 A;  1DVP A;  2YQL A;  2CSY A;  2QIZ A;  3FEH A;  1IYM A;  2EXU A;  2KKX A;  4ZQL A;  1CHC A;  3PUR A;  1WEE A;  1X4I A;  2MKE A;  5H1V A;  2G45 A;  2MD8 C;  3DDT A;  4YC9 A;  1RMD A;  3LQH A;  4I7B A;  3T7L A;  3FAO A;  3DPL R;  3KV5 A;  2EA6 A;  1WFK A;  2E61 A;  5EYA F;  4F1P A;  3M7K A;  5KH7 A;  3LDY A;  2YRE A;  2CSV A;  2DJA A;  1WEW A;  1BOR A;  1WEV A;  4GND A;  2ECG A;  3N9N A;  1JOC A;  2C2L A;  3L1Z B;  2VJF B;  2VPG A;  2C2V S;  2NAA A;  5FEY A;  3ZVZ B;  2XP0 A;  4N4F A;  2VPB A;  2KFT A;  3ASL A;  2CSZ A;  2CT2 A;  2HDP A;  4PTB A;  2HYE D;  5DKA A;  4A4B A;  2CRR A;  3ZNI A;  2D8S A;  2FSA A;  5TRB A;  5B8D A;  2E6S A;  1WIM A;  4YBS A;  1WGM A;  2ECT A;  2MT5 A;  2OXQ C;  2YT5 A;  2MUM A;  1JM7 B;  2EGM A;  5J3X A;  5FB1 A;  2L75 A;  4R7E A;  2L0B A;  2JMJ A;  2F6N A;  4CCG X;  4H9D A;  2KIZ A;  5LKX A;  3O36 A;  2JM3 A;  2Y43 A;  4WZ3 B;  4GNE A;  2JMI A;  2KR4 A;  2FFW A;  2QIC A;  3H7H A;  4WZ0 A;  3EB6 A;  2KWK A;  2E6R A;  4O64 A;  3MDB C;  1WE9 A;  4TKP B;  3FAN A;  2H0D B;  2UZG A;  1LDK C;  2JRJ A;  2ECJ A;  3M99 A;  2LDR A;  3FJU B;  3KV6 A;  5TDR A;  4GNF A;  5AIU A;  1LDJ B;  4UP0 A;  4ZDT A;  3E2D A;  5H9M A;  4YBM A;  4PPE A;  3LVR E;  2YUC A;  2K1J A;  1F62 A;  4X3G A;  1FBV A;  3C6W A;  4V3L C;  4YAB A;  3T6R A;  3ZYQ A;  4Z0R A;  4IC2 A;  2M13 A;  4LJN A;  1N87 A;  2G6Q A;  1WEM A;  5FB0 A;  3DQV R;  4WZ2 A;  2Y1N A;  4BHW A;  2MD7 B;  1T1H A;  2EOD A;  1Z60 A;  5SVI B; 
#chains in the Genus database with same CATH homology
 4F52 B;  1WIL A;  5AIT A;  2L43 A;  2PNX A;  2MA5 A;  2M85 A;  3U5P A;  4L7X A;  4YAD A;  3LQJ A;  3N9Q A;  3EB5 A;  3N9L A;  4MVT A;  4YAX A;  2KE1 A;  2KWN A;  5DIN A;  4UI9 B;  3ZPV E;  2M6M A;  2ECN A;  3MHS A;  2VJE A;  5LCW B;  1WEP A;  3ZVY A;  2ECV A;  4LK9 A;  2K4D A;  3N9P A;  4QF2 A;  4P5O B;  2XEU A;  5G05 B;  3FL2 A;  5B75 A;  5B79 A;  2KWJ A;  2KRE A;  4AYC A;  5LKZ A;  2K16 A;  4I7C A;  1VFY A;  2MA6 A;  4S3O C;  2LXH C;  3GV4 A;  3V43 A;  4YBT A;  3KNV A;  1V87 A;  1WEO A;  2I50 A;  4I7D A;  4FIP A;  3N9O A;  4A49 A;  2L5U A;  1U6G B;  3HTK C;  2LV9 A;  5B77 A;  4LKA A;  2G43 A;  3O70 A;  4R8P K;  3U5O A;  1HYJ A;  2ZET C;  2CKL A;  2DX8 A;  1G25 A;  5G04 B;  4A4C A;  3O33 A;  5KH9 A;  3N9M A;  3RTR B;  3LQI A;  1WEN A;  3MHH A;  2YSM A;  2LGG A;  1WEU A;  1Z2Q A;  2LXP C;  2KGG A;  3VK6 A;  5H1U A;  5TDW A;  4IC3 A;  2XB1 A;  2FUI A;  2M1R A;  5KH3 A;  4V3K C;  4B7Y C;  2VPE A;  2YW8 A;  3NG2 A;  5C11 A;  3HCT A;  5D1L B;  5LKT A;  2VPD A;  1HYI A;  5TAB A;  4AUQ B;  4Q6F A;  3L11 A;  1E4U A;  5LKU A;  2KU3 A;  2ECW A;  2ECI A;  2F42 A;  3M63 A;  2VNF A;  3LRQ A;  4MSX A;  3O34 A;  1MM3 A;  4UP5 A;  1K2F A;  3IHP A;  4W4U A;  5B78 A;  1Z6U A;  2YU4 A;  1X4U A;  3SOW A;  4LAD B;  3L1X A;  4FK5 A;  2VJF A;  3RPG B;  2M3H A;  3KQI A;  5H1T A;  4BBQ A;  4AVX A;  5B76 A;  4CA1 A;  1WES A;  3SHB A;  2JMD A;  4WA6 A;  4QF3 A;  2LGK A;  4XI1 A;  4L58 A;  2PUY A;  3M62 A;  2BAY A;  2VJE B;  1VD4 A;  1WEQ A;  1FP0 A;  4YAT A;  2YUR A;  1JM7 A;  1VYX A;  3O35 A;  3O7A A;  4GNG A;  2RI7 A;  2MIQ A;  4N3W A;  5TBN A;  2IDA A;  2EGP A;  2YHN A;  2K17 A;  5I3L A;  4B86 C;  5G0F A;  4R2Y A;  3U5M A;  4FJC A;  4GB0 A;  4AP4 A;  4AYC B;  5FER A;  2LQ6 A;  2RSD A;  1MM2 A;  3QZV A;  2F6J A;  2LGL A;  3PHD A;  4NN2 A;  3HCS A;  2H0D A;  5D1K B;  2Y1M A;  4LLB A;  2L80 A;  2YSJ A;  4ZUX U;  3ZPV 1;  2LGV A;  2YYR A;  2AN6 A;  1XWH A;  4FO9 A;  3SOU A;  2LRI C;  2LN0 A;  3C5K A;  2MNY A;  3O37 A;  2KYU A;  2CKL B;  4A0C D;  3SOX A;  3RPG C;  1X4J A;  5C13 A;  2QJ0 A;  3PUQ A;  1ZBD B;  3HCU A;  2YHO A;  5D1M B;  5JG6 A;  2VP7 A;  2MNZ A;  3I2D A;  3U5N A;  2KWO A;  3GL6 A;  4C9Z A;  2KGI A;  4S3O B;  3ZTG A;  2FUU A;  2YQM A;  1DVP A;  2YQL A;  2CSY A;  2QIZ A;  1IYM A;  4ZQL A;  1CHC A;  3PUR A;  1WEE A;  1X4I A;  5H1V A;  2G45 A;  2MD8 C;  4YC9 A;  1RMD A;  3LQH A;  4I7B A;  3T7L A;  3DPL R;  3KV5 A;  2EA6 A;  1WFK A;  5EYA F;  5KH7 A;  2YRE A;  1WEW A;  1BOR A;  1WEV A;  4GND A;  2ECG A;  3N9N A;  1JOC A;  2C2L A;  3L1Z B;  2VJF B;  2VPG A;  2C2V S;  2NAA A;  5FEY A;  3ZVZ B;  4N4F A;  2VPB A;  2KFT A;  3ASL A;  2CSZ A;  2CT2 A;  2HDP A;  4PTB A;  2HYE D;  5DKA A;  4A4B A;  3ZNI A;  2D8S A;  2FSA A;  5TRB A;  5B8D A;  2E6S A;  1WIM A;  4YBS A;  1WGM A;  2ECT A;  2MT5 A;  2OXQ C;  2YT5 A;  2MUM A;  1JM7 B;  5J3X A;  5FB1 A;  2L75 A;  4R7E A;  2L0B A;  2JMJ A;  2F6N A;  4CCG X;  2KIZ A;  5LKX A;  3O36 A;  2Y43 A;  4WZ3 B;  4GNE A;  2JMI A;  2KR4 A;  2QIC A;  4WZ0 A;  3EB6 A;  2KWK A;  2E6R A;  4O64 A;  1WE9 A;  4TKP B;  2H0D B;  2UZG A;  1LDK C;  2JRJ A;  2ECJ A;  3M99 A;  2LDR A;  3KV6 A;  5TDR A;  4GNF A;  5AIU A;  1LDJ B;  4UP0 A;  4ZDT A;  5H9M A;  4YBM A;  4PPE A;  2YUC A;  2K1J A;  1F62 A;  4X3G A;  1FBV A;  3C6W A;  4V3L C;  4YAB A;  3T6R A;  3ZYQ A;  4IC2 A;  4LJN A;  1N87 A;  2G6Q A;  1WEM A;  5FB0 A;  3DQV R;  4WZ2 A;  2Y1N A;  4BHW A;  2MD7 B;  1T1H A;  2EOD A;  1Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...