2H0DA

Structure of a bmi-1-ring1b polycomb group ubiquitin ligase complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
TRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/ligase
molecule keywords B lymphoma Mo-MLV insertion region
publication title Structure of a Bmi-1-Ring1B Polycomb Group Ubiquitin Ligase Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2006-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2h0dA00
3KV6A 4FK5A 4A4CA 5B78A 2KYUA 4UP5A 2MIQA 3O34A 3IHPA 2LXHC 5D1KB 5B76A 1XWHA 2C2LA 3DPLR 4A0CD 2ECWA 1U6GB 1WEPA 3N9OA 4O64A 2F6NA 5EYAF 4LADB 3NG2A 2ECTA 2RI7A 3ASLA 2LQ6A 2M85A 4ZDTA 2L80A 2YUCA 2M3HA 2KWNA 1WE9A 2ECNA 3ZNIA 4AUQB 4A4BA 2CKLA 5B8DA 1FP0A 2KFTA 4AYCB 1FBVA 1WEOA 2G6QA 2KGIA 4B7YC 2CSYA 3N9QA 3U5NA 5H1VA 1IYMA 2K17A 1LDKC 2VPBA 4PPEA 2E6RA 4R7EA 5H9MA 3RTRB 3O35A 5AITA 5LCWB 5B75A 3M99A 1MM2A 2JMJA 4WZ3B 1X4JA 2KE1A 1K2FA 1VFYA 2VJEB 4I7CA 5FB1A 4R8PK 2ECIA 4YABA 1VYXA 4YBMA 2YSJA 2PUYA 5TABA 3ZVYA 2QJ0A 2VJFB 1T1HA 2LN0A 1LDJB 1JM7A 2HYED 4V3KC 5B79A 2BAYA 4NN2A 2LGKA 2KWJA 4S3OB 4GNEA 5FEYA 2PNXA 2YREA 2YHNA 4B86C 2LGLA 3O37A 3SOUA 3MHSA 4GNGA 2QIZA 1VD4A 4WZ0A 1WILA 1WEUA 3I2DA 2VNFA 2H0DB 5KH7A 5D1MB 2I50A 2KREA 2E6SA 5C11A 3VK6A 1RMDA 5TDWA 4LJNA 2MNZA 1HYIA 2ECJA 1F62A 2YURA 3O33A 2LDRA 5G05B 3PHDA 2IDAA 3L1ZB 4WZ2A 3EB6A 4AVXA 2Y43A 2YYRA 3C5KA 4GB0A 3KV5A 3LQIA 5LKTA 3U5MA 2K16A 4YBTA 4I7DA 1HYJA 2L75A 3ZPVE 4N3WA 4L58A 5KH9A 2YHOA 4YBSA 2QICA 4YADA 3ZTGA 5JG6A 2MD8C 2CT2A 3GV4A 2EGPA 1Z2QA 2KU3A 4F52B 2L0BA 4TKPB 2KWOA 3EB5A 2M6MA 3RPGC 2NAAA 4FJCA 4PTBA 3T6RA 1ZBDB 4S3OC 4P5OB 2LRIC 5G0FA 5DINA 2ECVA 2ZETC 4GNFA 4N4FA 5KH3A 4W4UA 2G45A 1MM3A 1WGMA 3HCSA 4X3GA 3HCUA 2YT5A 3M63A 5FERA 3RPGB 5H1TA 2VP7A 4AYCA 1WESA 4BHWA 3SHBA 2XEUA 1WEEA 2UZGA 3QZVA 2XB1A 5LKUA 2Y1NA 2C2VS 3N9LA 4MVTA 2YW8A 5FB0A 4MSXA 4LLBA 4IC3A 1E4UA 2FUUA 4LK9A 5TRBA 1G25A 4AP4A 2K4DA 2Y1MA 4Q6FA 2YQMA 3O36A 4XI1A 4YC9A 2HDPA 1JOCA 4CCGX 3ZVZB 2YU4A 4YATA 2VJEA 2CKLB 2YQLA 3MHHA 3M62A 5AIUA 4ZQLA 2EA6A 4FO9A 4L7XA 2EODA 3C6WA 5J3XA 2G43A 2VJFA 3HCTA 4I7BA 3N9MA 2F6JA 5I3LA 2MD7B 1DVPA 3SOXA 5B77A 4GNDA 2KIZA 4UP0A 3V43A 2D8SA 1WENA 4IC2A 3L11A 3ZYQA 1WEMA 2KGGA 2VPEA 3PURA 5C13A 4LKAA 3GL6A 1X4IA 4R2YA 2K1JA 4UI9B 1JM7B 2MA5A 2H0DA 2L5UA 3LQHA 1WFKA 3KNVA 2RSDA 2KWKA 5D1LB 4QF3A 1WEQA 4ZUXU 1X4UA 3ZPV1 3LQJA 1CHCA 5LKZA 4V3LC 3FL2A 2ECGA 2JRJA 2DX8A 1WEWA 3L1XA 2LV9A 2MA6A 4A49A 3KQIA 3SOWA 3LRQA 2CSZA 3U5PA 2KR4A 5LKXA 2MUMA 1Z6UA 2JMIA 2OXQC 3U5OA 1Z60A 5TDRA 4BBQA 5DKAA 3T7LA 2LGVA 3O7AA 2L43A 4QF2A 3O70A 5TBNA 2AN6A 1N87A 3PUQA 3N9NA 2LGGA 2YSMA 3HTKC 1WEVA 2FSAA 4C9ZA 2JMDA 2M1RA 2MT5A 4YAXA 2VPGA 2VPDA 4WA6A 3DQVR 1BORA 2F42A 2MNYA 2FUIA 5H1UA 4FIPA 4CA1A 1WIMA 3N9PA 5G04B 2LXPC 1V87A
chains in the Genus database with same CATH superfamily
3KV6A 4FK5A 4A4CA 5B78A 2KYUA 4UP5A 2MIQA 3O34A 3IHPA 2LXHC 5D1KB 5B76A 1XWHA 2C2LA 3DPLR 4A0CD 2ECWA 1U6GB 1WEPA 3N9OA 4O64A 3Q1DA 2F6NA 5EYAF 3PLWA 4LADB 3NG2A 2ECTA 2JUNA 2RI7A 3ASLA 2LQ6A 2M85A 4ZDTA 2L80A 2YUCA 2M3HA 2KWNA 1WE9A 2ECNA 4F1PA 3ZNIA 4AUQB 4A4BA 2CKLA 5B8DA 1FP0A 2KFTA 5K3QA 4AYCB 1FBVA 1WEOA 2G6QA 2KGIA 4B7YC 3LDYA 2CSYA 3N9QA 2EXUA 2XP0A 3U5NA 5H1VA 1IYMA 2K17A 1LDKC 2VPBA 4PPEA 2E6RA 2M13A 2DJAA 4R7EA 5H9MA 3RTRB 3O35A 5AITA 3FAOA 5LCWB 5B75A 3M99A 1MM2A 2JMJA 4WZ3B 1X4JA 2KE1A 1K2FA 1VFYA 2VJEB 4I7CA 5FB1A 4R8PK 2ECIA 4YABA 1VYXA 4YBMA 2YSJA 2PUYA 5TABA 3ZVYA 2KKYA 2QJ0A 2VJFB 2EGMA 1T1HA 2LN0A 1LDJB 2B0OE 1JM7A 2CONA 2HYED 4V3KC 5B79A 2BAYA 4NN2A 2LGKA 2KWJA 4S3OB 4GNEA 5FEYA 2PNXA 2YREA 2YHNA 4B86C 2LGLA 3O37A 3SOUA 3MHSA 4GNGA 2RR4A 2QIZA 1VD4A 4WZ0A 4Z0RA 1WILA 1WEUA 3I2DA 2XOCA 4OGEA 2OWAA 2VNFA 2H0DB 5KH7A 5D1MB 2I50A 2KREA 2DSMA 2E6SA 5C11A 3VK6A 1RMDA 5TDWA 4LJNA 4H9DA 2MNZA 1HYIA 2ECJA 1DCQA 1F62A 3MDBC 2YURA 3O33A 2LDRA 5G05B 3PHDA 2IDAA 3L1ZB 4WZ2A 3EB6A 5SVIB 4AVXA 2Y43A 2YYRA 3C5KA 2IQJA 4GB0A 3KV5A 3LQIA 5LKTA 3U5MA 2K16A 3E2DA 4YBTA 4I7DA 1HYJA 2L75A 3ZPVE 3FJUB 4N3WA 4L58A 5KH9A 2YHOA 4YBSA 2QICA 4YADA 3ZTGA 5JG6A 2MD8C 2CT2A 3GV4A 2EGPA 2FD4A 1Z2QA 2KU3A 2JM3A 4F52B 2L0BA 4TKPB 2KWOA 3EB5A 2M6MA 3RPGC 3DDTA 2NAAA 4FJCA 4PTBA 5SVYA 3T6RA 1ZBDB 4S3OC 4P5OB 2LRIC 5G0FA 5DINA 2FFWA 2ECVA 2ZETC 4GNFA 4N4FA 4QQ4A 4W4UA 5KH3A 2G45A 1MM3A 2LAUA 1WGMA 3HCSA 4X3GA 3HCUA 2YT5A 3M63A 5FERA 3RPGB 5H1TA 2VP7A 4AYCA 1WESA 4BHWA 3SHBA 2XEUA 1WEEA 2UZGA 3QZVA 2XB1A 5LKUA 2Y1NA 2C2VS 3FM8C 3FEHA 3M7KA 3N9LA 4MVTA 1MBMA 2YW8A 5FB0A 4MSXA 4LLBA 4IC3A 1E4UA 3LJUX 2FUUA 4LK9A 5TRBA 1G25A 4AP4A 2K4DA 2Y1MA 4Q6FA 2YQMA 5SVXA 3O36A 4XI1A 4YC9A 2HDPA 1JOCA 2YVRA 3ZVZB 4CCGX 2YU4A 4YATA 2VJEA 2L7PA 2CKLB 2YQLA 3MHHA 3M62A 5AIUA 4ZQLA 2XOYA 2EA6A 4FO9A 4L7XA 2E61A 2EODA 3C6WA 5J3XA 3LVRE 3H7HA 2G43A 2VJFA 3HCTA 3KDEC 4I7BA 3N9MA 2F6JA 5I3LA 2MD7B 1DVPA 3SOXA 5B77A 4GNDA 2KIZA 4UP0A 3V43A 2D8SA 2D8UA 1WENA 4IC2A 2MKEA 3L11A 3ZYQA 1WEMA 2KGGA 2P57A 2VPEA 3PURA 2KKXA 5C13A 4LKAA 3GL6A 3O47A 1X4IA 4O62A 4R2YA 2K1JA 4OGCA 4UI9B 1JM7B 2MA5A 2H0DA 2L5UA 3LQHA 1WFKA 3KNVA 2RSDA 2KWKA 5D1LB 4QF3A 1WEQA 4ZUXU 1X4UA 3ZPV1 3DWDA 3LQJA 1CHCA 5LKZA 5SVIA 4V3LC 3FL2A 2ECGA 2JRJA 4Z0OA 2DX8A 1WEWA 3L1XA 2LV9A 2MA6A 4A49A 3KQIA 3SOWA 2CSVA 2CSZA 3LRQA 3U5PA 2KR4A 5LKXA 2MUMA 1Z6UA 2JMIA 2OXQC 3LVQE 1Z60A 5TDRA 3U5OA 4BBQA 5DKAA 3T7LA 2LGVA 3O7AA 2L43A 4QF2A 3O70A 5TBNA 2AN6A 1N87A 3PUQA 2XOZA 3N9NA 2LGGA 2YSMA 3HTKC 1WEVA 2FSAA 4C9ZA 2JMDA 2M1RA 2MT5A 4YAXA 2VPGA 2VPDA 4WA6A 3DQVR 1BORA 2F42A 3T9KA 2MNYA 2CRRA 2FUIA 5H1UA 3FANA 3JUEA 4FIPA 4CA1A 1WIMA 2CRWA 3N9PA 3SUBA 5G04B 2LXPC 1V87A
chains in the Genus database with same CATH topology
3KV6A 4FK5A 4A4CA 5B78A 2KYUA 4UP5A 2MIQA 3O34A 3IHPA 2LXHC 5D1KB 5B76A 1XWHA 2C2LA 3DPLR 4A0CD 2ECWA 1U6GB 1WEPA 3N9OA 4O64A 2F6NA 5EYAF 4LADB 3NG2A 2ECTA 2RI7A 3ASLA 2LQ6A 2M85A 4ZDTA 2L80A 2YUCA 2M3HA 2KWNA 1WE9A 2ECNA 3ZNIA 4AUQB 4A4BA 2CKLA 5B8DA 1FP0A 2KFTA 4AYCB 1FBVA 1WEOA 2G6QA 2KGIA 4B7YC 2CSYA 3N9QA 3U5NA 5H1VA 1IYMA 2K17A 1LDKC 2VPBA 4PPEA 2E6RA 4R7EA 5H9MA 3RTRB 3O35A 5AITA 5LCWB 5B75A 3M99A 1MM2A 2JMJA 4WZ3B 1X4JA 2KE1A 1K2FA 1VFYA 2VJEB 4I7CA 5FB1A 4R8PK 2ECIA 4YABA 1VYXA 4YBMA 2YSJA 2PUYA 5TABA 3ZVYA 2QJ0A 2VJFB 1T1HA 2LN0A 1LDJB 1JM7A 2HYED 4V3KC 5B79A 2BAYA 4NN2A 2LGKA 2KWJA 4S3OB 4GNEA 5FEYA 2PNXA 2YREA 2YHNA 4B86C 2LGLA 3O37A 3SOUA 3MHSA 4GNGA 2QIZA 1VD4A 4WZ0A 1WILA 1WEUA 3I2DA 2VNFA 2H0DB 5KH7A 5D1MB 2I50A 2KREA 2E6SA 5C11A 3VK6A 1RMDA 5TDWA 4LJNA 2MNZA 1HYIA 2ECJA 1F62A 2YURA 3O33A 2LDRA 5G05B 3PHDA 2IDAA 3L1ZB 4WZ2A 3EB6A 4AVXA 2Y43A 2YYRA 3C5KA 4GB0A 3KV5A 3LQIA 5LKTA 3U5MA 2K16A 4YBTA 4I7DA 1HYJA 2L75A 3ZPVE 4N3WA 4L58A 5KH9A 2YHOA 4YBSA 2QICA 4YADA 3ZTGA 5JG6A 2MD8C 2CT2A 3GV4A 2EGPA 1Z2QA 2KU3A 4F52B 2L0BA 4TKPB 2KWOA 3EB5A 2M6MA 3RPGC 2NAAA 4FJCA 4PTBA 3T6RA 1ZBDB 4S3OC 4P5OB 2LRIC 5G0FA 5DINA 2ECVA 2ZETC 4GNFA 4N4FA 5KH3A 4W4UA 2G45A 1MM3A 1WGMA 3HCSA 4X3GA 3HCUA 2YT5A 3M63A 5FERA 3RPGB 5H1TA 2VP7A 4AYCA 1WESA 4BHWA 3SHBA 2XEUA 1WEEA 2UZGA 3QZVA 2XB1A 5LKUA 2Y1NA 2C2VS 3N9LA 4MVTA 2YW8A 5FB0A 4MSXA 4LLBA 4IC3A 1E4UA 2FUUA 4LK9A 5TRBA 1G25A 4AP4A 2K4DA 2Y1MA 4Q6FA 2YQMA 3O36A 4XI1A 4YC9A 2HDPA 1JOCA 4CCGX 3ZVZB 2YU4A 4YATA 2VJEA 2CKLB 2YQLA 3MHHA 3M62A 5AIUA 4ZQLA 2EA6A 4FO9A 4L7XA 2EODA 3C6WA 5J3XA 2G43A 2VJFA 3HCTA 4I7BA 3N9MA 2F6JA 5I3LA 2MD7B 1DVPA 3SOXA 5B77A 4GNDA 2KIZA 4UP0A 3V43A 2D8SA 1WENA 4IC2A 3L11A 3ZYQA 1WEMA 2KGGA 2VPEA 3PURA 5C13A 4LKAA 3GL6A 1X4IA 4R2YA 2K1JA 4UI9B 1JM7B 2MA5A 2H0DA 2L5UA 3LQHA 1WFKA 3KNVA 2RSDA 2KWKA 5D1LB 4QF3A 1WEQA 4ZUXU 1X4UA 3ZPV1 3LQJA 1CHCA 5LKZA 4V3LC 3FL2A 2ECGA 2JRJA 2DX8A 1WEWA 3L1XA 2LV9A 2MA6A 4A49A 3KQIA 3SOWA 3LRQA 2CSZA 3U5PA 2KR4A 5LKXA 2MUMA 1Z6UA 2JMIA 2OXQC 3U5OA 1Z60A 5TDRA 4BBQA 5DKAA 3T7LA 2LGVA 3O7AA 2L43A 4QF2A 3O70A 5TBNA 2AN6A 1N87A 3PUQA 3N9NA 2LGGA 2YSMA 3HTKC 1WEVA 2FSAA 4C9ZA 2JMDA 2M1RA 2MT5A 4YAXA 2VPGA 2VPDA 4WA6A 3DQVR 1BORA 2F42A 2MNYA 2FUIA 5H1UA 4FIPA 4CA1A 1WIMA 3N9PA 5G04B 2LXPC 1V87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KV6 A;  4FK5 A;  4A4C A;  5B78 A;  2KYU A;  4UP5 A;  2MIQ A;  3O34 A;  3IHP A;  2LXH C;  5D1K B;  5B76 A;  1XWH A;  2C2L A;  3DPL R;  4A0C D;  2ECW A;  1U6G B;  1WEP A;  3N9O A;  4O64 A;  2F6N A;  5EYA F;  4LAD B;  3NG2 A;  2ECT A;  2RI7 A;  3ASL A;  2LQ6 A;  2M85 A;  4ZDT A;  2L80 A;  2YUC A;  2M3H A;  2KWN A;  1WE9 A;  2ECN A;  3ZNI A;  4AUQ B;  4A4B A;  2CKL A;  5B8D A;  1FP0 A;  2KFT A;  4AYC B;  1FBV A;  1WEO A;  2G6Q A;  2KGI A;  4B7Y C;  2CSY A;  3N9Q A;  3U5N A;  5H1V A;  1IYM A;  2K17 A;  1LDK C;  2VPB A;  4PPE A;  2E6R A;  4R7E A;  5H9M A;  3RTR B;  3O35 A;  5AIT A;  5LCW B;  5B75 A;  3M99 A;  1MM2 A;  2JMJ A;  4WZ3 B;  1X4J A;  2KE1 A;  1K2F A;  1VFY A;  2VJE B;  4I7C A;  5FB1 A;  4R8P K;  2ECI A;  4YAB A;  1VYX A;  4YBM A;  2YSJ A;  2PUY A;  5TAB A;  3ZVY A;  2QJ0 A;  2VJF B;  1T1H A;  2LN0 A;  1LDJ B;  1JM7 A;  2HYE D;  4V3K C;  5B79 A;  2BAY A;  4NN2 A;  2LGK A;  2KWJ A;  4S3O B;  4GNE A;  5FEY A;  2PNX A;  2YRE A;  2YHN A;  4B86 C;  2LGL A;  3O37 A;  3SOU A;  3MHS A;  4GNG A;  2QIZ A;  1VD4 A;  4WZ0 A;  1WIL A;  1WEU A;  3I2D A;  2VNF A;  2H0D B;  5KH7 A;  5D1M B;  2I50 A;  2KRE A;  2E6S A;  5C11 A;  3VK6 A;  1RMD A;  5TDW A;  4LJN A;  2MNZ A;  1HYI A;  2ECJ A;  1F62 A;  2YUR A;  3O33 A;  2LDR A;  5G05 B;  3PHD A;  2IDA A;  3L1Z B;  4WZ2 A;  3EB6 A;  4AVX A;  2Y43 A;  2YYR A;  3C5K A;  4GB0 A;  3KV5 A;  3LQI A;  5LKT A;  3U5M A;  2K16 A;  4YBT A;  4I7D A;  1HYJ A;  2L75 A;  3ZPV E;  4N3W A;  4L58 A;  5KH9 A;  2YHO A;  4YBS A;  2QIC A;  4YAD A;  3ZTG A;  5JG6 A;  2MD8 C;  2CT2 A;  3GV4 A;  2EGP A;  1Z2Q A;  2KU3 A;  4F52 B;  2L0B A;  4TKP B;  2KWO A;  3EB5 A;  2M6M A;  3RPG C;  2NAA A;  4FJC A;  4PTB A;  3T6R A;  1ZBD B;  4S3O C;  4P5O B;  2LRI C;  5G0F A;  5DIN A;  2ECV A;  2ZET C;  4GNF A;  4N4F A;  5KH3 A;  4W4U A;  2G45 A;  1MM3 A;  1WGM A;  3HCS A;  4X3G A;  3HCU A;  2YT5 A;  3M63 A;  5FER A;  3RPG B;  5H1T A;  2VP7 A;  4AYC A;  1WES A;  4BHW A;  3SHB A;  2XEU A;  1WEE A;  2UZG A;  3QZV A;  2XB1 A;  5LKU A;  2Y1N A;  2C2V S;  3N9L A;  4MVT A;  2YW8 A;  5FB0 A;  4MSX A;  4LLB A;  4IC3 A;  1E4U A;  2FUU A;  4LK9 A;  5TRB A;  1G25 A;  4AP4 A;  2K4D A;  2Y1M A;  4Q6F A;  2YQM A;  3O36 A;  4XI1 A;  4YC9 A;  2HDP A;  1JOC A;  4CCG X;  3ZVZ B;  2YU4 A;  4YAT A;  2VJE A;  2CKL B;  2YQL A;  3MHH A;  3M62 A;  5AIU A;  4ZQL A;  2EA6 A;  4FO9 A;  4L7X A;  2EOD A;  3C6W A;  5J3X A;  2G43 A;  2VJF A;  3HCT A;  4I7B A;  3N9M A;  2F6J A;  5I3L A;  2MD7 B;  1DVP A;  3SOX A;  5B77 A;  4GND A;  2KIZ A;  4UP0 A;  3V43 A;  2D8S A;  1WEN A;  4IC2 A;  3L11 A;  3ZYQ A;  1WEM A;  2KGG A;  2VPE A;  3PUR A;  5C13 A;  4LKA A;  3GL6 A;  1X4I A;  4R2Y A;  2K1J A;  4UI9 B;  1JM7 B;  2MA5 A;  2H0D A;  2L5U A;  3LQH A;  1WFK A;  3KNV A;  2RSD A;  2KWK A;  5D1L B;  4QF3 A;  1WEQ A;  4ZUX U;  1X4U A;  3ZPV 1;  3LQJ A;  1CHC A;  5LKZ A;  4V3L C;  3FL2 A;  2ECG A;  2JRJ A;  2DX8 A;  1WEW A;  3L1X A;  2LV9 A;  2MA6 A;  4A49 A;  3KQI A;  3SOW A;  3LRQ A;  2CSZ A;  3U5P A;  2KR4 A;  5LKX A;  2MUM A;  1Z6U A;  2JMI A;  2OXQ C;  3U5O A;  1Z60 A;  5TDR A;  4BBQ A;  5DKA A;  3T7L A;  2LGV A;  3O7A A;  2L43 A;  4QF2 A;  3O70 A;  5TBN A;  2AN6 A;  1N87 A;  3PUQ A;  3N9N A;  2LGG A;  2YSM A;  3HTK C;  1WEV A;  2FSA A;  4C9Z A;  2JMD A;  2M1R A;  2MT5 A;  4YAX A;  2VPG A;  2VPD A;  4WA6 A;  3DQV R;  1BOR A;  2F42 A;  2MNY A;  2FUI A;  5H1U A;  4FIP A;  4CA1 A;  1WIM A;  3N9P A;  5G04 B;  2LXP C;  1V87 A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  4FK5 A;  4A4C A;  5B78 A;  2KYU A;  4UP5 A;  2MIQ A;  3O34 A;  3IHP A;  2LXH C;  5D1K B;  5B76 A;  1XWH A;  2C2L A;  3DPL R;  4A0C D;  2ECW A;  1U6G B;  1WEP A;  3N9O A;  4O64 A;  3Q1D A;  2F6N A;  5EYA F;  3PLW A;  4LAD B;  3NG2 A;  2ECT A;  2JUN A;  2RI7 A;  3ASL A;  2LQ6 A;  2M85 A;  4ZDT A;  2L80 A;  2YUC A;  2M3H A;  2KWN A;  1WE9 A;  2ECN A;  4F1P A;  3ZNI A;  4AUQ B;  4A4B A;  2CKL A;  5B8D A;  1FP0 A;  2KFT A;  5K3Q A;  4AYC B;  1FBV A;  1WEO A;  2G6Q A;  2KGI A;  4B7Y C;  3LDY A;  2CSY A;  3N9Q A;  2EXU A;  2XP0 A;  3U5N A;  5H1V A;  1IYM A;  2K17 A;  1LDK C;  2VPB A;  4PPE A;  2E6R A;  2M13 A;  2DJA A;  4R7E A;  5H9M A;  3RTR B;  3O35 A;  5AIT A;  3FAO A;  5LCW B;  5B75 A;  3M99 A;  1MM2 A;  2JMJ A;  4WZ3 B;  1X4J A;  2KE1 A;  1K2F A;  1VFY A;  2VJE B;  4I7C A;  5FB1 A;  4R8P K;  2ECI A;  4YAB A;  1VYX A;  4YBM A;  2YSJ A;  2PUY A;  5TAB A;  3ZVY A;  2KKY A;  2QJ0 A;  2VJF B;  2EGM A;  1T1H A;  2LN0 A;  1LDJ B;  2B0O E;  1JM7 A;  2CON A;  2HYE D;  4V3K C;  5B79 A;  2BAY A;  4NN2 A;  2LGK A;  2KWJ A;  4S3O B;  4GNE A;  5FEY A;  2PNX A;  2YRE A;  2YHN A;  4B86 C;  2LGL A;  3O37 A;  3SOU A;  3MHS A;  4GNG A;  2RR4 A;  2QIZ A;  1VD4 A;  4WZ0 A;  4Z0R A;  1WIL A;  1WEU A;  3I2D A;  2XOC A;  4OGE A;  2OWA A;  2VNF A;  2H0D B;  5KH7 A;  5D1M B;  2I50 A;  2KRE A;  2DSM A;  2E6S A;  5C11 A;  3VK6 A;  1RMD A;  5TDW A;  4LJN A;  4H9D A;  2MNZ A;  1HYI A;  2ECJ A;  1DCQ A;  1F62 A;  3MDB C;  2YUR A;  3O33 A;  2LDR A;  5G05 B;  3PHD A;  2IDA A;  3L1Z B;  4WZ2 A;  3EB6 A;  5SVI B;  4AVX A;  2Y43 A;  2YYR A;  3C5K A;  2IQJ A;  4GB0 A;  3KV5 A;  3LQI A;  5LKT A;  3U5M A;  2K16 A;  3E2D A;  4YBT A;  4I7D A;  1HYJ A;  2L75 A;  3ZPV E;  3FJU B;  4N3W A;  4L58 A;  5KH9 A;  2YHO A;  4YBS A;  2QIC A;  4YAD A;  3ZTG A;  5JG6 A;  2MD8 C;  2CT2 A;  3GV4 A;  2EGP A;  2FD4 A;  1Z2Q A;  2KU3 A;  2JM3 A;  4F52 B;  2L0B A;  4TKP B;  2KWO A;  3EB5 A;  2M6M A;  3RPG C;  3DDT A;  2NAA A;  4FJC A;  4PTB A;  5SVY A;  3T6R A;  1ZBD B;  4S3O C;  4P5O B;  2LRI C;  5G0F A;  5DIN A;  2FFW A;  2ECV A;  2ZET C;  4GNF A;  4N4F A;  4QQ4 A;  4W4U A;  5KH3 A;  2G45 A;  1MM3 A;  2LAU A;  1WGM A;  3HCS A;  4X3G A;  3HCU A;  2YT5 A;  3M63 A;  5FER A;  3RPG B;  5H1T A;  2VP7 A;  4AYC A;  1WES A;  4BHW A;  3SHB A;  2XEU A;  1WEE A;  2UZG A;  3QZV A;  2XB1 A;  5LKU A;  2Y1N A;  2C2V S;  3FM8 C;  3FEH A;  3M7K A;  3N9L A;  4MVT A;  1MBM A;  2YW8 A;  5FB0 A;  4MSX A;  4LLB A;  4IC3 A;  1E4U A;  3LJU X;  2FUU A;  4LK9 A;  5TRB A;  1G25 A;  4AP4 A;  2K4D A;  2Y1M A;  4Q6F A;  2YQM A;  5SVX A;  3O36 A;  4XI1 A;  4YC9 A;  2HDP A;  1JOC A;  2YVR A;  3ZVZ B;  4CCG X;  2YU4 A;  4YAT A;  2VJE A;  2L7P A;  2CKL B;  2YQL A;  3MHH A;  3M62 A;  5AIU A;  4ZQL A;  2XOY A;  2EA6 A;  4FO9 A;  4L7X A;  2E61 A;  2EOD A;  3C6W A;  5J3X A;  3LVR E;  3H7H A;  2G43 A;  2VJF A;  3HCT A;  3KDE C;  4I7B A;  3N9M A;  2F6J A;  5I3L A;  2MD7 B;  1DVP A;  3SOX A;  5B77 A;  4GND A;  2KIZ A;  4UP0 A;  3V43 A;  2D8S A;  2D8U A;  1WEN A;  4IC2 A;  2MKE A;  3L11 A;  3ZYQ A;  1WEM A;  2KGG A;  2P57 A;  2VPE A;  3PUR A;  2KKX A;  5C13 A;  4LKA A;  3GL6 A;  3O47 A;  1X4I A;  4O62 A;  4R2Y A;  2K1J A;  4OGC A;  4UI9 B;  1JM7 B;  2MA5 A;  2H0D A;  2L5U A;  3LQH A;  1WFK A;  3KNV A;  2RSD A;  2KWK A;  5D1L B;  4QF3 A;  1WEQ A;  4ZUX U;  1X4U A;  3ZPV 1;  3DWD A;  3LQJ A;  1CHC A;  5LKZ A;  5SVI A;  4V3L C;  3FL2 A;  2ECG A;  2JRJ A;  4Z0O A;  2DX8 A;  1WEW A;  3L1X A;  2LV9 A;  2MA6 A;  4A49 A;  3KQI A;  3SOW A;  2CSV A;  2CSZ A;  3LRQ A;  3U5P A;  2KR4 A;  5LKX A;  2MUM A;  1Z6U A;  2JMI A;  2OXQ C;  3LVQ E;  1Z60 A;  5TDR A;  3U5O A;  4BBQ A;  5DKA A;  3T7L A;  2LGV A;  3O7A A;  2L43 A;  4QF2 A;  3O70 A;  5TBN A;  2AN6 A;  1N87 A;  3PUQ A;  2XOZ A;  3N9N A;  2LGG A;  2YSM A;  3HTK C;  1WEV A;  2FSA A;  4C9Z A;  2JMD A;  2M1R A;  2MT5 A;  4YAX A;  2VPG A;  2VPD A;  4WA6 A;  3DQV R;  1BOR A;  2F42 A;  3T9K A;  2MNY A;  2CRR A;  2FUI A;  5H1U A;  3FAN A;  3JUE A;  4FIP A;  4CA1 A;  1WIM A;  2CRW A;  3N9P A;  3SUB A;  5G04 B;  2LXP C;  1V87 A; 
#chains in the Genus database with same CATH homology
 3KV6 A;  4FK5 A;  4A4C A;  5B78 A;  2KYU A;  4UP5 A;  2MIQ A;  3O34 A;  3IHP A;  2LXH C;  5D1K B;  5B76 A;  1XWH A;  2C2L A;  3DPL R;  4A0C D;  2ECW A;  1U6G B;  1WEP A;  3N9O A;  4O64 A;  2F6N A;  5EYA F;  4LAD B;  3NG2 A;  2ECT A;  2RI7 A;  3ASL A;  2LQ6 A;  2M85 A;  4ZDT A;  2L80 A;  2YUC A;  2M3H A;  2KWN A;  1WE9 A;  2ECN A;  3ZNI A;  4AUQ B;  4A4B A;  2CKL A;  5B8D A;  1FP0 A;  2KFT A;  4AYC B;  1FBV A;  1WEO A;  2G6Q A;  2KGI A;  4B7Y C;  2CSY A;  3N9Q A;  3U5N A;  5H1V A;  1IYM A;  2K17 A;  1LDK C;  2VPB A;  4PPE A;  2E6R A;  4R7E A;  5H9M A;  3RTR B;  3O35 A;  5AIT A;  5LCW B;  5B75 A;  3M99 A;  1MM2 A;  2JMJ A;  4WZ3 B;  1X4J A;  2KE1 A;  1K2F A;  1VFY A;  2VJE B;  4I7C A;  5FB1 A;  4R8P K;  2ECI A;  4YAB A;  1VYX A;  4YBM A;  2YSJ A;  2PUY A;  5TAB A;  3ZVY A;  2QJ0 A;  2VJF B;  1T1H A;  2LN0 A;  1LDJ B;  1JM7 A;  2HYE D;  4V3K C;  5B79 A;  2BAY A;  4NN2 A;  2LGK A;  2KWJ A;  4S3O B;  4GNE A;  5FEY A;  2PNX A;  2YRE A;  2YHN A;  4B86 C;  2LGL A;  3O37 A;  3SOU A;  3MHS A;  4GNG A;  2QIZ A;  1VD4 A;  4WZ0 A;  1WIL A;  1WEU A;  3I2D A;  2VNF A;  2H0D B;  5KH7 A;  5D1M B;  2I50 A;  2KRE A;  2E6S A;  5C11 A;  3VK6 A;  1RMD A;  5TDW A;  4LJN A;  2MNZ A;  1HYI A;  2ECJ A;  1F62 A;  2YUR A;  3O33 A;  2LDR A;  5G05 B;  3PHD A;  2IDA A;  3L1Z B;  4WZ2 A;  3EB6 A;  4AVX A;  2Y43 A;  2YYR A;  3C5K A;  4GB0 A;  3KV5 A;  3LQI A;  5LKT A;  3U5M A;  2K16 A;  4YBT A;  4I7D A;  1HYJ A;  2L75 A;  3ZPV E;  4N3W A;  4L58 A;  5KH9 A;  2YHO A;  4YBS A;  2QIC A;  4YAD A;  3ZTG A;  5JG6 A;  2MD8 C;  2CT2 A;  3GV4 A;  2EGP A;  1Z2Q A;  2KU3 A;  4F52 B;  2L0B A;  4TKP B;  2KWO A;  3EB5 A;  2M6M A;  3RPG C;  2NAA A;  4FJC A;  4PTB A;  3T6R A;  1ZBD B;  4S3O C;  4P5O B;  2LRI C;  5G0F A;  5DIN A;  2ECV A;  2ZET C;  4GNF A;  4N4F A;  5KH3 A;  4W4U A;  2G45 A;  1MM3 A;  1WGM A;  3HCS A;  4X3G A;  3HCU A;  2YT5 A;  3M63 A;  5FER A;  3RPG B;  5H1T A;  2VP7 A;  4AYC A;  1WES A;  4BHW A;  3SHB A;  2XEU A;  1WEE A;  2UZG A;  3QZV A;  2XB1 A;  5LKU A;  2Y1N A;  2C2V S;  3N9L A;  4MVT A;  2YW8 A;  5FB0 A;  4MSX A;  4LLB A;  4IC3 A;  1E4U A;  2FUU A;  4LK9 A;  5TRB A;  1G25 A;  4AP4 A;  2K4D A;  2Y1M A;  4Q6F A;  2YQM A;  3O36 A;  4XI1 A;  4YC9 A;  2HDP A;  1JOC A;  4CCG X;  3ZVZ B;  2YU4 A;  4YAT A;  2VJE A;  2CKL B;  2YQL A;  3MHH A;  3M62 A;  5AIU A;  4ZQL A;  2EA6 A;  4FO9 A;  4L7X A;  2EOD A;  3C6W A;  5J3X A;  2G43 A;  2VJF A;  3HCT A;  4I7B A;  3N9M A;  2F6J A;  5I3L A;  2MD7 B;  1DVP A;  3SOX A;  5B77 A;  4GND A;  2KIZ A;  4UP0 A;  3V43 A;  2D8S A;  1WEN A;  4IC2 A;  3L11 A;  3ZYQ A;  1WEM A;  2KGG A;  2VPE A;  3PUR A;  5C13 A;  4LKA A;  3GL6 A;  1X4I A;  4R2Y A;  2K1J A;  4UI9 B;  1JM7 B;  2MA5 A;  2H0D A;  2L5U A;  3LQH A;  1WFK A;  3KNV A;  2RSD A;  2KWK A;  5D1L B;  4QF3 A;  1WEQ A;  4ZUX U;  1X4U A;  3ZPV 1;  3LQJ A;  1CHC A;  5LKZ A;  4V3L C;  3FL2 A;  2ECG A;  2JRJ A;  2DX8 A;  1WEW A;  3L1X A;  2LV9 A;  2MA6 A;  4A49 A;  3KQI A;  3SOW A;  3LRQ A;  2CSZ A;  3U5P A;  2KR4 A;  5LKX A;  2MUM A;  1Z6U A;  2JMI A;  2OXQ C;  3U5O A;  1Z60 A;  5TDR A;  4BBQ A;  5DKA A;  3T7L A;  2LGV A;  3O7A A;  2L43 A;  4QF2 A;  3O70 A;  5TBN A;  2AN6 A;  1N87 A;  3PUQ A;  3N9N A;  2LGG A;  2YSM A;  3HTK C;  1WEV A;  2FSA A;  4C9Z A;  2JMD A;  2M1R A;  2MT5 A;  4YAX A;  2VPG A;  2VPD A;  4WA6 A;  3DQV R;  1BOR A;  2F42 A;  2MNY A;  2FUI A;  5H1U A;  4FIP A;  4CA1 A;  1WIM A;  3N9P A;  5G04 B;  2LXP C;  1V87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...