1FP0A

Solution structure of the phd domain from the kap-1 corepressor
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
88
structure length
88
Chain Sequence
MRGSHHHHHHGSDIIDEFGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDVDLQACKLN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KAP-1 COREPRESSOR
publication title Solution structure of the PHD domain from the KAP-1 corepressor: structural determinants for PHD, RING and LIM zinc-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1fp0A00
2LGVA 3ZNIA 2CSZA 2ECIA 3L11A 4C9ZA 2YW8A 5C13A 3QZVA 2VPEA 2H0DB 4YAXA 5B79A 3ASLA 2VPBA 3L1ZB 3HCTA 1IYMA 4AYCB 1WEEA 1WEUA 3KV5A 1VYXA 2KGIA 2L75A 1WIMA 2XEUA 3LQIA 2JRJA 2YHNA 5LCWB 2EGPA 4FK5A 4BHWA 2Y1MA 3PUQA 1X4JA 1X4UA 2BAYA 3O37A 4MSXA 3MHSA 3DPLR 2EODA 1FP0A 1MM2A 4S3OC 4UP0A 1BORA 2H0DA 3L1XA 3NG2A 1WENA 2M85A 2Y1NA 1WE9A 3ZPVE 4LJNA 4R7EA 2F6NA 4LADB 5FERA 2VPGA 5AIUA 4AYCA 2MT5A 3RPGB 5H1VA 5TDWA 4I7BA 3KQIA 4B86C 2MD8C 4B7YC 1MM3A 2ECTA 5G0FA 4WZ2A 4AVXA 2QIZA 3C5KA 4R2YA 1FBVA 4WA6A 4F52B 2G45A 2C2LA 2JMIA 2JMJA 4W4UA 1WEPA 2QJ0A 4UP5A 4FIPA 1N87A 2KFTA 2EA6A 3I2DA 2C2VS 2CKLB 4FJCA 2YREA 4P5OB 5FEYA 4WZ3B 1CHCA 4ZDTA 1WESA 4QF3A 3RPGC 3N9QA 2HDPA 1U6GB 4TKPB 3O70A 2YSJA 3IHPA 3O35A 2YSMA 4GNDA 5TABA 4A4CA 5B75A 3U5MA 1E4UA 3O34A 4I7CA 2AN6A 2KIZA 4I7DA 3HTKC 4NN2A 1LDJB 4S3OB 2KR4A 4A4BA 4WZ0A 3PURA 2ECJA 2YQMA 5FB1A 1ZBDB 5H1UA 2KWNA 4QF2A 4A0CD 2JMDA 3ZVYA 1WEWA 2CSYA 2CKLA 1V87A 1WILA 3HCUA 5DINA 5D1MB 1RMDA 3U5OA 4YBTA 2G6QA 3EB6A 3ZYQA 1WEOA 2VJFA 2LXHC 3KV6A 2LGGA 2KWKA 1G25A 2LGLA 2M6MA 3M99A 4GNGA 2QICA 4YBMA 2KGGA 4YABA 5D1KB 4LKAA 4IC3A 5TBNA 3PHDA 4R8PK 3N9LA 2E6RA 2ECNA 3SOWA 1LDKC 5G04B 3ZPV1 3GV4A 3N9PA 2FUIA 2HYED 2VNFA 2D8SA 3GL6A 3LRQA 4V3LC 4FO9A 4PTBA 4YADA 1HYJA 2Y43A 4IC2A 5AITA 2K4DA 2M3HA 5KH7A 3SHBA 4AP4A 1JOCA 3O36A 3U5PA 4L58A 1WEQA 1Z2QA 1VFYA 4MVTA 2RSDA 2YT5A 4LK9A 4V3KC 2RI7A 2VJFB 2LQ6A 2PNXA 3ZVZB 5TRBA 4L7XA 2VJEA 2ECVA 4GNFA 4X3GA 5J3XA 3ZTGA 4GB0A 4N4FA 4AUQB 3M62A 3T6RA 2LN0A 3M63A 1Z60A 2L0BA 5LKXA 1WGMA 5LKZA 5TDRA 2YURA 1VD4A 2E6SA 2MNZA 5G05B 4YBSA 5LKUA 3O7AA 2YQLA 3N9OA 2K1JA 3LQHA 2MUMA 2L43A 2KWJA 5EYAF 5FB0A 2IDAA 1JM7A 5H1TA 2LV9A 2F6JA 2KE1A 4PPEA 5H9MA 5B8DA 5C11A 2MA6A 3DQVR 3C6WA 2ECGA 2MD7B 2M1RA 3MHHA 5DKAA 2VP7A 4Q6FA 2ECWA 2LDRA 2LRIC 1T1HA 3EB5A 2K16A 3U5NA 2G43A 4CA1A 2KYUA 2LXPC 4YATA 2VJEB 3N9MA 4LLBA 1WFKA 1WEMA 1HYIA 5B77A 1Z6UA 5KH9A 4BBQA 1DVPA 4CCGX 2CT2A 3HCSA 2PUYA 2KREA 3RTRB 2MNYA 3KNVA 2L5UA 1X4IA 5I3LA 2NAAA 2FUUA 3SOUA 3V43A 5LKTA 1JM7B 4XI1A 5B76A 2UZGA 2L80A 4ZQLA 4A49A 1WEVA 3T7LA 2OXQC 2KU3A 2MIQA 5D1LB 2K17A 4YC9A 4UI9B 2XB1A 2FSAA 2YHOA 2KWOA 5B78A 5JG6A 2MA5A 3LQJA 2YUCA 1F62A 1XWHA 2I50A 2YU4A 5KH3A 3O33A 4GNEA 2LGKA 2VPDA 3N9NA 1K2FA 3VK6A 4N3WA 4ZUXU 2F42A 2DX8A 3FL2A 2ZETC 4O64A 3SOXA 2YYRA
chains in the Genus database with same CATH superfamily
2LGVA 3ZNIA 2CSZA 2ECIA 3L11A 4C9ZA 2YW8A 5C13A 3QZVA 2VPEA 2CSVA 2JUNA 2H0DB 4YAXA 5B79A 3ASLA 2VPBA 2KKXA 3L1ZB 3HCTA 1IYMA 3FM8C 4AYCB 1WEEA 1WEUA 3KV5A 1VYXA 2KGIA 5SVYA 2FFWA 2L75A 1WIMA 2M13A 2XEUA 3LQIA 2JRJA 2YHNA 5LCWB 2EGPA 4FK5A 4BHWA 2Y1MA 2LAUA 3PUQA 4Z0OA 1X4JA 1X4UA 2BAYA 3LJUX 3O37A 4MSXA 3M7KA 3MHSA 3DPLR 2EODA 3PLWA 1FP0A 1MM2A 4S3OC 4UP0A 1BORA 2H0DA 3L1XA 3NG2A 1WENA 2M85A 2Y1NA 1WE9A 3ZPVE 4LJNA 4R7EA 2F6NA 4LADB 5FERA 2VPGA 5AIUA 4AYCA 2MT5A 3RPGB 5H1VA 5TDWA 4F1PA 4I7BA 3KQIA 4B86C 2MD8C 4OGEA 4B7YC 1MM3A 2ECTA 5G0FA 2YVRA 4WZ2A 4AVXA 2QIZA 2RR4A 3C5KA 4R2YA 3E2DA 1FBVA 4WA6A 4F52B 3FANA 2DJAA 2G45A 2C2LA 2JMIA 2JMJA 4OGCA 1WEPA 2OWAA 2QJ0A 4W4UA 3T9KA 4FIPA 4UP5A 1N87A 2KFTA 2EA6A 3I2DA 2C2VS 2CKLB 4FJCA 2YREA 4P5OB 5FEYA 4WZ3B 1CHCA 4ZDTA 1WESA 4QF3A 3RPGC 3N9QA 2HDPA 1U6GB 4TKPB 3O70A 2YSJA 3IHPA 3O35A 2YSMA 4GNDA 3LVRE 5TABA 4A4CA 5B75A 2XOCA 3U5MA 1E4UA 3O34A 4I7CA 2AN6A 2KIZA 4I7DA 3HTKC 4NN2A 1LDJB 2KKYA 4S3OB 2KR4A 4A4BA 4WZ0A 3PURA 2ECJA 4Z0RA 3FAOA 2YQMA 5FB1A 1ZBDB 5H1UA 2KWNA 4QF2A 4A0CD 2JMDA 3ZVYA 1WEWA 2CSYA 2CKLA 1V87A 1WILA 3HCUA 5DINA 2XOYA 5D1MB 1RMDA 3U5OA 4YBTA 2G6QA 3EB6A 3ZYQA 1WEOA 2VJFA 2LXHC 3KV6A 2CONA 2LGGA 2KWKA 1G25A 2LGLA 2M6MA 1DCQA 3M99A 3DWDA 4GNGA 2QICA 4YBMA 2KGGA 4YABA 5D1KB 4LKAA 4IC3A 5TBNA 3FEHA 3PHDA 4R8PK 4O62A 3N9LA 2E6RA 2ECNA 3SOWA 1LDKC 5G04B 3ZPV1 4QQ4A 2E61A 3GV4A 3N9PA 2FUIA 2HYED 2VNFA 2D8SA 3GL6A 3LRQA 4V3LC 4FO9A 4PTBA 4YADA 3SUBA 1HYJA 2Y43A 4IC2A 5AITA 2K4DA 2M3HA 5KH7A 3O47A 3SHBA 4AP4A 1JOCA 3O36A 3U5PA 2EGMA 4L58A 1WEQA 1Z2QA 1VFYA 2IQJA 3LDYA 5K3QA 4MVTA 2RSDA 3FJUB 2YT5A 3Q1DA 4LK9A 4V3KC 2RI7A 2VJFB 2CRWA 2LQ6A 2PNXA 3ZVZB 5TRBA 4L7XA 2D8UA 2VJEA 2ECVA 4GNFA 4X3GA 5J3XA 3ZTGA 4GB0A 4N4FA 4AUQB 3M62A 3T6RA 2LN0A 2XP0A 2MKEA 3M63A 1Z60A 2L0BA 5LKXA 1WGMA 5LKZA 5TDRA 2YURA 1VD4A 2E6SA 2MNZA 5G05B 4YBSA 5LKUA 3O7AA 2YQLA 3N9OA 2K1JA 3LQHA 2MUMA 2L43A 2KWJA 2CRRA 5EYAF 5FB0A 2IDAA 1JM7A 5H1TA 2LV9A 2F6JA 2KE1A 4PPEA 5H9MA 3H7HA 5B8DA 5C11A 2MA6A 2JM3A 3DQVR 3C6WA 2ECGA 5SVIB 3LVQE 2MD7B 2M1RA 3MHHA 4H9DA 5DKAA 3DDTA 2VP7A 4Q6FA 3MDBC 2ECWA 2LDRA 2LRIC 2DSMA 1T1HA 3EB5A 2K16A 2FD4A 3U5NA 2G43A 4CA1A 2KYUA 2LXPC 4YATA 2VJEB 3N9MA 4LLBA 1WFKA 1WEMA 1HYIA 2B0OE 5B77A 1Z6UA 5KH9A 4BBQA 1DVPA 4CCGX 2CT2A 3HCSA 2PUYA 2KREA 3RTRB 2MNYA 3KNVA 2L5UA 1X4IA 2EXUA 3JUEA 5SVIA 5I3LA 2NAAA 2FUUA 3SOUA 3V43A 5LKTA 5SVXA 1JM7B 4XI1A 5B76A 2UZGA 2L80A 4ZQLA 4A49A 1WEVA 3T7LA 2OXQC 2KU3A 2MIQA 5D1LB 3KDEC 2K17A 4YC9A 4UI9B 2XB1A 1MBMA 2FSAA 2P57A 2YHOA 2KWOA 5B78A 5JG6A 2MA5A 3LQJA 2YUCA 1F62A 1XWHA 2I50A 2YU4A 5KH3A 3O33A 4GNEA 2LGKA 2VPDA 3N9NA 1K2FA 3VK6A 2L7PA 4N3WA 4ZUXU 2F42A 2DX8A 3FL2A 2ZETC 4O64A 2XOZA 3SOXA 2YYRA
chains in the Genus database with same CATH topology
2LGVA 3ZNIA 2CSZA 2ECIA 3L11A 4C9ZA 2YW8A 5C13A 3QZVA 2VPEA 2H0DB 4YAXA 5B79A 3ASLA 2VPBA 3L1ZB 3HCTA 1IYMA 4AYCB 1WEEA 1WEUA 3KV5A 1VYXA 2KGIA 2L75A 1WIMA 2XEUA 3LQIA 2JRJA 2YHNA 5LCWB 2EGPA 4FK5A 4BHWA 2Y1MA 3PUQA 1X4JA 1X4UA 2BAYA 3O37A 4MSXA 3MHSA 3DPLR 2EODA 1FP0A 1MM2A 4S3OC 4UP0A 1BORA 2H0DA 3L1XA 3NG2A 1WENA 2M85A 2Y1NA 1WE9A 3ZPVE 4LJNA 4R7EA 2F6NA 4LADB 5FERA 2VPGA 5AIUA 4AYCA 2MT5A 3RPGB 5H1VA 5TDWA 4I7BA 3KQIA 4B86C 2MD8C 4B7YC 1MM3A 2ECTA 5G0FA 4WZ2A 4AVXA 2QIZA 3C5KA 4R2YA 1FBVA 4WA6A 4F52B 2G45A 2C2LA 2JMIA 2JMJA 4W4UA 1WEPA 2QJ0A 4UP5A 4FIPA 1N87A 2KFTA 2EA6A 3I2DA 2C2VS 2CKLB 4FJCA 2YREA 4P5OB 5FEYA 4WZ3B 1CHCA 4ZDTA 1WESA 4QF3A 3RPGC 3N9QA 2HDPA 1U6GB 4TKPB 3O70A 2YSJA 3IHPA 3O35A 2YSMA 4GNDA 5TABA 4A4CA 5B75A 3U5MA 1E4UA 3O34A 4I7CA 2AN6A 2KIZA 4I7DA 3HTKC 4NN2A 1LDJB 4S3OB 2KR4A 4A4BA 4WZ0A 3PURA 2ECJA 2YQMA 5FB1A 1ZBDB 5H1UA 2KWNA 4QF2A 4A0CD 2JMDA 3ZVYA 1WEWA 2CSYA 2CKLA 1V87A 1WILA 3HCUA 5DINA 5D1MB 1RMDA 3U5OA 4YBTA 2G6QA 3EB6A 3ZYQA 1WEOA 2VJFA 2LXHC 3KV6A 2LGGA 2KWKA 1G25A 2LGLA 2M6MA 3M99A 4GNGA 2QICA 4YBMA 2KGGA 4YABA 5D1KB 4LKAA 4IC3A 5TBNA 3PHDA 4R8PK 3N9LA 2E6RA 2ECNA 3SOWA 1LDKC 5G04B 3ZPV1 3GV4A 3N9PA 2FUIA 2HYED 2VNFA 2D8SA 3GL6A 3LRQA 4V3LC 4FO9A 4PTBA 4YADA 1HYJA 2Y43A 4IC2A 5AITA 2K4DA 2M3HA 5KH7A 3SHBA 4AP4A 1JOCA 3O36A 3U5PA 4L58A 1WEQA 1Z2QA 1VFYA 4MVTA 2RSDA 2YT5A 4LK9A 4V3KC 2RI7A 2VJFB 2LQ6A 2PNXA 3ZVZB 5TRBA 4L7XA 2VJEA 2ECVA 4GNFA 4X3GA 5J3XA 3ZTGA 4GB0A 4N4FA 4AUQB 3M62A 3T6RA 2LN0A 3M63A 1Z60A 2L0BA 5LKXA 1WGMA 5LKZA 5TDRA 2YURA 1VD4A 2E6SA 2MNZA 5G05B 4YBSA 5LKUA 3O7AA 2YQLA 3N9OA 2K1JA 3LQHA 2MUMA 2L43A 2KWJA 5EYAF 5FB0A 2IDAA 1JM7A 5H1TA 2LV9A 2F6JA 2KE1A 4PPEA 5H9MA 5B8DA 5C11A 2MA6A 3DQVR 3C6WA 2ECGA 2MD7B 2M1RA 3MHHA 5DKAA 2VP7A 4Q6FA 2ECWA 2LDRA 2LRIC 1T1HA 3EB5A 2K16A 3U5NA 2G43A 4CA1A 2KYUA 2LXPC 4YATA 2VJEB 3N9MA 4LLBA 1WFKA 1WEMA 1HYIA 5B77A 1Z6UA 5KH9A 4BBQA 1DVPA 4CCGX 2CT2A 3HCSA 2PUYA 2KREA 3RTRB 2MNYA 3KNVA 2L5UA 1X4IA 5I3LA 2NAAA 2FUUA 3SOUA 3V43A 5LKTA 1JM7B 4XI1A 5B76A 2UZGA 2L80A 4ZQLA 4A49A 1WEVA 3T7LA 2OXQC 2KU3A 2MIQA 5D1LB 2K17A 4YC9A 4UI9B 2XB1A 2FSAA 2YHOA 2KWOA 5B78A 5JG6A 2MA5A 3LQJA 2YUCA 1F62A 1XWHA 2I50A 2YU4A 5KH3A 3O33A 4GNEA 2LGKA 2VPDA 3N9NA 1K2FA 3VK6A 4N3WA 4ZUXU 2F42A 2DX8A 3FL2A 2ZETC 4O64A 3SOXA 2YYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGV A;  3ZNI A;  2CSZ A;  2ECI A;  3L11 A;  4C9Z A;  2YW8 A;  5C13 A;  3QZV A;  2VPE A;  2H0D B;  4YAX A;  5B79 A;  3ASL A;  2VPB A;  3L1Z B;  3HCT A;  1IYM A;  4AYC B;  1WEE A;  1WEU A;  3KV5 A;  1VYX A;  2KGI A;  2L75 A;  1WIM A;  2XEU A;  3LQI A;  2JRJ A;  2YHN A;  5LCW B;  2EGP A;  4FK5 A;  4BHW A;  2Y1M A;  3PUQ A;  1X4J A;  1X4U A;  2BAY A;  3O37 A;  4MSX A;  3MHS A;  3DPL R;  2EOD A;  1FP0 A;  1MM2 A;  4S3O C;  4UP0 A;  1BOR A;  2H0D A;  3L1X A;  3NG2 A;  1WEN A;  2M85 A;  2Y1N A;  1WE9 A;  3ZPV E;  4LJN A;  4R7E A;  2F6N A;  4LAD B;  5FER A;  2VPG A;  5AIU A;  4AYC A;  2MT5 A;  3RPG B;  5H1V A;  5TDW A;  4I7B A;  3KQI A;  4B86 C;  2MD8 C;  4B7Y C;  1MM3 A;  2ECT A;  5G0F A;  4WZ2 A;  4AVX A;  2QIZ A;  3C5K A;  4R2Y A;  1FBV A;  4WA6 A;  4F52 B;  2G45 A;  2C2L A;  2JMI A;  2JMJ A;  4W4U A;  1WEP A;  2QJ0 A;  4UP5 A;  4FIP A;  1N87 A;  2KFT A;  2EA6 A;  3I2D A;  2C2V S;  2CKL B;  4FJC A;  2YRE A;  4P5O B;  5FEY A;  4WZ3 B;  1CHC A;  4ZDT A;  1WES A;  4QF3 A;  3RPG C;  3N9Q A;  2HDP A;  1U6G B;  4TKP B;  3O70 A;  2YSJ A;  3IHP A;  3O35 A;  2YSM A;  4GND A;  5TAB A;  4A4C A;  5B75 A;  3U5M A;  1E4U A;  3O34 A;  4I7C A;  2AN6 A;  2KIZ A;  4I7D A;  3HTK C;  4NN2 A;  1LDJ B;  4S3O B;  2KR4 A;  4A4B A;  4WZ0 A;  3PUR A;  2ECJ A;  2YQM A;  5FB1 A;  1ZBD B;  5H1U A;  2KWN A;  4QF2 A;  4A0C D;  2JMD A;  3ZVY A;  1WEW A;  2CSY A;  2CKL A;  1V87 A;  1WIL A;  3HCU A;  5DIN A;  5D1M B;  1RMD A;  3U5O A;  4YBT A;  2G6Q A;  3EB6 A;  3ZYQ A;  1WEO A;  2VJF A;  2LXH C;  3KV6 A;  2LGG A;  2KWK A;  1G25 A;  2LGL A;  2M6M A;  3M99 A;  4GNG A;  2QIC A;  4YBM A;  2KGG A;  4YAB A;  5D1K B;  4LKA A;  4IC3 A;  5TBN A;  3PHD A;  4R8P K;  3N9L A;  2E6R A;  2ECN A;  3SOW A;  1LDK C;  5G04 B;  3ZPV 1;  3GV4 A;  3N9P A;  2FUI A;  2HYE D;  2VNF A;  2D8S A;  3GL6 A;  3LRQ A;  4V3L C;  4FO9 A;  4PTB A;  4YAD A;  1HYJ A;  2Y43 A;  4IC2 A;  5AIT A;  2K4D A;  2M3H A;  5KH7 A;  3SHB A;  4AP4 A;  1JOC A;  3O36 A;  3U5P A;  4L58 A;  1WEQ A;  1Z2Q A;  1VFY A;  4MVT A;  2RSD A;  2YT5 A;  4LK9 A;  4V3K C;  2RI7 A;  2VJF B;  2LQ6 A;  2PNX A;  3ZVZ B;  5TRB A;  4L7X A;  2VJE A;  2ECV A;  4GNF A;  4X3G A;  5J3X A;  3ZTG A;  4GB0 A;  4N4F A;  4AUQ B;  3M62 A;  3T6R A;  2LN0 A;  3M63 A;  1Z60 A;  2L0B A;  5LKX A;  1WGM A;  5LKZ A;  5TDR A;  2YUR A;  1VD4 A;  2E6S A;  2MNZ A;  5G05 B;  4YBS A;  5LKU A;  3O7A A;  2YQL A;  3N9O A;  2K1J A;  3LQH A;  2MUM A;  2L43 A;  2KWJ A;  5EYA F;  5FB0 A;  2IDA A;  1JM7 A;  5H1T A;  2LV9 A;  2F6J A;  2KE1 A;  4PPE A;  5H9M A;  5B8D A;  5C11 A;  2MA6 A;  3DQV R;  3C6W A;  2ECG A;  2MD7 B;  2M1R A;  3MHH A;  5DKA A;  2VP7 A;  4Q6F A;  2ECW A;  2LDR A;  2LRI C;  1T1H A;  3EB5 A;  2K16 A;  3U5N A;  2G43 A;  4CA1 A;  2KYU A;  2LXP C;  4YAT A;  2VJE B;  3N9M A;  4LLB A;  1WFK A;  1WEM A;  1HYI A;  5B77 A;  1Z6U A;  5KH9 A;  4BBQ A;  1DVP A;  4CCG X;  2CT2 A;  3HCS A;  2PUY A;  2KRE A;  3RTR B;  2MNY A;  3KNV A;  2L5U A;  1X4I A;  5I3L A;  2NAA A;  2FUU A;  3SOU A;  3V43 A;  5LKT A;  1JM7 B;  4XI1 A;  5B76 A;  2UZG A;  2L80 A;  4ZQL A;  4A49 A;  1WEV A;  3T7L A;  2OXQ C;  2KU3 A;  2MIQ A;  5D1L B;  2K17 A;  4YC9 A;  4UI9 B;  2XB1 A;  2FSA A;  2YHO A;  2KWO A;  5B78 A;  5JG6 A;  2MA5 A;  3LQJ A;  2YUC A;  1F62 A;  1XWH A;  2I50 A;  2YU4 A;  5KH3 A;  3O33 A;  4GNE A;  2LGK A;  2VPD A;  3N9N A;  1K2F A;  3VK6 A;  4N3W A;  4ZUX U;  2F42 A;  2DX8 A;  3FL2 A;  2ZET C;  4O64 A;  3SOX A;  2YYR A; 
#chains in the Genus database with same CATH topology
 2LGV A;  3ZNI A;  2CSZ A;  2ECI A;  3L11 A;  4C9Z A;  2YW8 A;  5C13 A;  3QZV A;  2VPE A;  2CSV A;  2JUN A;  2H0D B;  4YAX A;  5B79 A;  3ASL A;  2VPB A;  2KKX A;  3L1Z B;  3HCT A;  1IYM A;  3FM8 C;  4AYC B;  1WEE A;  1WEU A;  3KV5 A;  1VYX A;  2KGI A;  5SVY A;  2FFW A;  2L75 A;  1WIM A;  2M13 A;  2XEU A;  3LQI A;  2JRJ A;  2YHN A;  5LCW B;  2EGP A;  4FK5 A;  4BHW A;  2Y1M A;  2LAU A;  3PUQ A;  4Z0O A;  1X4J A;  1X4U A;  2BAY A;  3LJU X;  3O37 A;  4MSX A;  3M7K A;  3MHS A;  3DPL R;  2EOD A;  3PLW A;  1FP0 A;  1MM2 A;  4S3O C;  4UP0 A;  1BOR A;  2H0D A;  3L1X A;  3NG2 A;  1WEN A;  2M85 A;  2Y1N A;  1WE9 A;  3ZPV E;  4LJN A;  4R7E A;  2F6N A;  4LAD B;  5FER A;  2VPG A;  5AIU A;  4AYC A;  2MT5 A;  3RPG B;  5H1V A;  5TDW A;  4F1P A;  4I7B A;  3KQI A;  4B86 C;  2MD8 C;  4OGE A;  4B7Y C;  1MM3 A;  2ECT A;  5G0F A;  2YVR A;  4WZ2 A;  4AVX A;  2QIZ A;  2RR4 A;  3C5K A;  4R2Y A;  3E2D A;  1FBV A;  4WA6 A;  4F52 B;  3FAN A;  2DJA A;  2G45 A;  2C2L A;  2JMI A;  2JMJ A;  4OGC A;  1WEP A;  2OWA A;  2QJ0 A;  4W4U A;  3T9K A;  4FIP A;  4UP5 A;  1N87 A;  2KFT A;  2EA6 A;  3I2D A;  2C2V S;  2CKL B;  4FJC A;  2YRE A;  4P5O B;  5FEY A;  4WZ3 B;  1CHC A;  4ZDT A;  1WES A;  4QF3 A;  3RPG C;  3N9Q A;  2HDP A;  1U6G B;  4TKP B;  3O70 A;  2YSJ A;  3IHP A;  3O35 A;  2YSM A;  4GND A;  3LVR E;  5TAB A;  4A4C A;  5B75 A;  2XOC A;  3U5M A;  1E4U A;  3O34 A;  4I7C A;  2AN6 A;  2KIZ A;  4I7D A;  3HTK C;  4NN2 A;  1LDJ B;  2KKY A;  4S3O B;  2KR4 A;  4A4B A;  4WZ0 A;  3PUR A;  2ECJ A;  4Z0R A;  3FAO A;  2YQM A;  5FB1 A;  1ZBD B;  5H1U A;  2KWN A;  4QF2 A;  4A0C D;  2JMD A;  3ZVY A;  1WEW A;  2CSY A;  2CKL A;  1V87 A;  1WIL A;  3HCU A;  5DIN A;  2XOY A;  5D1M B;  1RMD A;  3U5O A;  4YBT A;  2G6Q A;  3EB6 A;  3ZYQ A;  1WEO A;  2VJF A;  2LXH C;  3KV6 A;  2CON A;  2LGG A;  2KWK A;  1G25 A;  2LGL A;  2M6M A;  1DCQ A;  3M99 A;  3DWD A;  4GNG A;  2QIC A;  4YBM A;  2KGG A;  4YAB A;  5D1K B;  4LKA A;  4IC3 A;  5TBN A;  3FEH A;  3PHD A;  4R8P K;  4O62 A;  3N9L A;  2E6R A;  2ECN A;  3SOW A;  1LDK C;  5G04 B;  3ZPV 1;  4QQ4 A;  2E61 A;  3GV4 A;  3N9P A;  2FUI A;  2HYE D;  2VNF A;  2D8S A;  3GL6 A;  3LRQ A;  4V3L C;  4FO9 A;  4PTB A;  4YAD A;  3SUB A;  1HYJ A;  2Y43 A;  4IC2 A;  5AIT A;  2K4D A;  2M3H A;  5KH7 A;  3O47 A;  3SHB A;  4AP4 A;  1JOC A;  3O36 A;  3U5P A;  2EGM A;  4L58 A;  1WEQ A;  1Z2Q A;  1VFY A;  2IQJ A;  3LDY A;  5K3Q A;  4MVT A;  2RSD A;  3FJU B;  2YT5 A;  3Q1D A;  4LK9 A;  4V3K C;  2RI7 A;  2VJF B;  2CRW A;  2LQ6 A;  2PNX A;  3ZVZ B;  5TRB A;  4L7X A;  2D8U A;  2VJE A;  2ECV A;  4GNF A;  4X3G A;  5J3X A;  3ZTG A;  4GB0 A;  4N4F A;  4AUQ B;  3M62 A;  3T6R A;  2LN0 A;  2XP0 A;  2MKE A;  3M63 A;  1Z60 A;  2L0B A;  5LKX A;  1WGM A;  5LKZ A;  5TDR A;  2YUR A;  1VD4 A;  2E6S A;  2MNZ A;  5G05 B;  4YBS A;  5LKU A;  3O7A A;  2YQL A;  3N9O A;  2K1J A;  3LQH A;  2MUM A;  2L43 A;  2KWJ A;  2CRR A;  5EYA F;  5FB0 A;  2IDA A;  1JM7 A;  5H1T A;  2LV9 A;  2F6J A;  2KE1 A;  4PPE A;  5H9M A;  3H7H A;  5B8D A;  5C11 A;  2MA6 A;  2JM3 A;  3DQV R;  3C6W A;  2ECG A;  5SVI B;  3LVQ E;  2MD7 B;  2M1R A;  3MHH A;  4H9D A;  5DKA A;  3DDT A;  2VP7 A;  4Q6F A;  3MDB C;  2ECW A;  2LDR A;  2LRI C;  2DSM A;  1T1H A;  3EB5 A;  2K16 A;  2FD4 A;  3U5N A;  2G43 A;  4CA1 A;  2KYU A;  2LXP C;  4YAT A;  2VJE B;  3N9M A;  4LLB A;  1WFK A;  1WEM A;  1HYI A;  2B0O E;  5B77 A;  1Z6U A;  5KH9 A;  4BBQ A;  1DVP A;  4CCG X;  2CT2 A;  3HCS A;  2PUY A;  2KRE A;  3RTR B;  2MNY A;  3KNV A;  2L5U A;  1X4I A;  2EXU A;  3JUE A;  5SVI A;  5I3L A;  2NAA A;  2FUU A;  3SOU A;  3V43 A;  5LKT A;  5SVX A;  1JM7 B;  4XI1 A;  5B76 A;  2UZG A;  2L80 A;  4ZQL A;  4A49 A;  1WEV A;  3T7L A;  2OXQ C;  2KU3 A;  2MIQ A;  5D1L B;  3KDE C;  2K17 A;  4YC9 A;  4UI9 B;  2XB1 A;  1MBM A;  2FSA A;  2P57 A;  2YHO A;  2KWO A;  5B78 A;  5JG6 A;  2MA5 A;  3LQJ A;  2YUC A;  1F62 A;  1XWH A;  2I50 A;  2YU4 A;  5KH3 A;  3O33 A;  4GNE A;  2LGK A;  2VPD A;  3N9N A;  1K2F A;  3VK6 A;  2L7P A;  4N3W A;  4ZUX U;  2F42 A;  2DX8 A;  3FL2 A;  2ZET C;  4O64 A;  2XOZ A;  3SOX A;  2YYR A; 
#chains in the Genus database with same CATH homology
 2LGV A;  3ZNI A;  2CSZ A;  2ECI A;  3L11 A;  4C9Z A;  2YW8 A;  5C13 A;  3QZV A;  2VPE A;  2H0D B;  4YAX A;  5B79 A;  3ASL A;  2VPB A;  3L1Z B;  3HCT A;  1IYM A;  4AYC B;  1WEE A;  1WEU A;  3KV5 A;  1VYX A;  2KGI A;  2L75 A;  1WIM A;  2XEU A;  3LQI A;  2JRJ A;  2YHN A;  5LCW B;  2EGP A;  4FK5 A;  4BHW A;  2Y1M A;  3PUQ A;  1X4J A;  1X4U A;  2BAY A;  3O37 A;  4MSX A;  3MHS A;  3DPL R;  2EOD A;  1FP0 A;  1MM2 A;  4S3O C;  4UP0 A;  1BOR A;  2H0D A;  3L1X A;  3NG2 A;  1WEN A;  2M85 A;  2Y1N A;  1WE9 A;  3ZPV E;  4LJN A;  4R7E A;  2F6N A;  4LAD B;  5FER A;  2VPG A;  5AIU A;  4AYC A;  2MT5 A;  3RPG B;  5H1V A;  5TDW A;  4I7B A;  3KQI A;  4B86 C;  2MD8 C;  4B7Y C;  1MM3 A;  2ECT A;  5G0F A;  4WZ2 A;  4AVX A;  2QIZ A;  3C5K A;  4R2Y A;  1FBV A;  4WA6 A;  4F52 B;  2G45 A;  2C2L A;  2JMI A;  2JMJ A;  4W4U A;  1WEP A;  2QJ0 A;  4UP5 A;  4FIP A;  1N87 A;  2KFT A;  2EA6 A;  3I2D A;  2C2V S;  2CKL B;  4FJC A;  2YRE A;  4P5O B;  5FEY A;  4WZ3 B;  1CHC A;  4ZDT A;  1WES A;  4QF3 A;  3RPG C;  3N9Q A;  2HDP A;  1U6G B;  4TKP B;  3O70 A;  2YSJ A;  3IHP A;  3O35 A;  2YSM A;  4GND A;  5TAB A;  4A4C A;  5B75 A;  3U5M A;  1E4U A;  3O34 A;  4I7C A;  2AN6 A;  2KIZ A;  4I7D A;  3HTK C;  4NN2 A;  1LDJ B;  4S3O B;  2KR4 A;  4A4B A;  4WZ0 A;  3PUR A;  2ECJ A;  2YQM A;  5FB1 A;  1ZBD B;  5H1U A;  2KWN A;  4QF2 A;  4A0C D;  2JMD A;  3ZVY A;  1WEW A;  2CSY A;  2CKL A;  1V87 A;  1WIL A;  3HCU A;  5DIN A;  5D1M B;  1RMD A;  3U5O A;  4YBT A;  2G6Q A;  3EB6 A;  3ZYQ A;  1WEO A;  2VJF A;  2LXH C;  3KV6 A;  2LGG A;  2KWK A;  1G25 A;  2LGL A;  2M6M A;  3M99 A;  4GNG A;  2QIC A;  4YBM A;  2KGG A;  4YAB A;  5D1K B;  4LKA A;  4IC3 A;  5TBN A;  3PHD A;  4R8P K;  3N9L A;  2E6R A;  2ECN A;  3SOW A;  1LDK C;  5G04 B;  3ZPV 1;  3GV4 A;  3N9P A;  2FUI A;  2HYE D;  2VNF A;  2D8S A;  3GL6 A;  3LRQ A;  4V3L C;  4FO9 A;  4PTB A;  4YAD A;  1HYJ A;  2Y43 A;  4IC2 A;  5AIT A;  2K4D A;  2M3H A;  5KH7 A;  3SHB A;  4AP4 A;  1JOC A;  3O36 A;  3U5P A;  4L58 A;  1WEQ A;  1Z2Q A;  1VFY A;  4MVT A;  2RSD A;  2YT5 A;  4LK9 A;  4V3K C;  2RI7 A;  2VJF B;  2LQ6 A;  2PNX A;  3ZVZ B;  5TRB A;  4L7X A;  2VJE A;  2ECV A;  4GNF A;  4X3G A;  5J3X A;  3ZTG A;  4GB0 A;  4N4F A;  4AUQ B;  3M62 A;  3T6R A;  2LN0 A;  3M63 A;  1Z60 A;  2L0B A;  5LKX A;  1WGM A;  5LKZ A;  5TDR A;  2YUR A;  1VD4 A;  2E6S A;  2MNZ A;  5G05 B;  4YBS A;  5LKU A;  3O7A A;  2YQL A;  3N9O A;  2K1J A;  3LQH A;  2MUM A;  2L43 A;  2KWJ A;  5EYA F;  5FB0 A;  2IDA A;  1JM7 A;  5H1T A;  2LV9 A;  2F6J A;  2KE1 A;  4PPE A;  5H9M A;  5B8D A;  5C11 A;  2MA6 A;  3DQV R;  3C6W A;  2ECG A;  2MD7 B;  2M1R A;  3MHH A;  5DKA A;  2VP7 A;  4Q6F A;  2ECW A;  2LDR A;  2LRI C;  1T1H A;  3EB5 A;  2K16 A;  3U5N A;  2G43 A;  4CA1 A;  2KYU A;  2LXP C;  4YAT A;  2VJE B;  3N9M A;  4LLB A;  1WFK A;  1WEM A;  1HYI A;  5B77 A;  1Z6U A;  5KH9 A;  4BBQ A;  1DVP A;  4CCG X;  2CT2 A;  3HCS A;  2PUY A;  2KRE A;  3RTR B;  2MNY A;  3KNV A;  2L5U A;  1X4I A;  5I3L A;  2NAA A;  2FUU A;  3SOU A;  3V43 A;  5LKT A;  1JM7 B;  4XI1 A;  5B76 A;  2UZG A;  2L80 A;  4ZQL A;  4A49 A;  1WEV A;  3T7L A;  2OXQ C;  2KU3 A;  2MIQ A;  5D1L B;  2K17 A;  4YC9 A;  4UI9 B;  2XB1 A;  2FSA A;  2YHO A;  2KWO A;  5B78 A;  5JG6 A;  2MA5 A;  3LQJ A;  2YUC A;  1F62 A;  1XWH A;  2I50 A;  2YU4 A;  5KH3 A;  3O33 A;  4GNE A;  2LGK A;  2VPD A;  3N9N A;  1K2F A;  3VK6 A;  4N3W A;  4ZUX U;  2F42 A;  2DX8 A;  3FL2 A;  2ZET C;  4O64 A;  3SOX A;  2YYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...