1FP0A

Solution structure of the phd domain from the kap-1 corepressor
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
88
structure length
88
Chain Sequence
MRGSHHHHHHGSDIIDEFGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDVDLQACKLN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PHD domain from the KAP-1 corepressor: structural determinants for PHD, RING and LIM zinc-binding domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords KAP-1 COREPRESSOR
structure length 88
sequence length 88
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1fp0A00
2MNZA 2G45A 2VPBA 3LQIA 4P5OB 2ECIA 2EA6A 3M99A 3ZVYA 4FJCA 4IC3A 5D1KB 2LGLA 5LKXA 2YW8A 3O7AA 5B76A 2MD7B 3RPGC 5H1TA 4BBQA 2KWOA 3GL6A 2L0BA 1X4UA 2ECTA 3DQVR 4YAXA 1VYXA 2I50A 3N9QA 2JMIA 5TDRA 1BORA 4B86C 1Z2QA 5DINA 4YBMA 1WEOA 3T6RA 3ZPV1 2LDRA 4IC2A 2H0DA 3LQJA 3ZTGA 4GNEA 1X4JA 2MUMA 1FBVA 4GB0A 2UZGA 4CA1A 2NAAA 2G6QA 4A4BA 2VJFA 2LQ6A 2XEUA 1WEUA 4LJNA 4FIPA 1WEMA 2FUIA 5KH9A 4WZ3B 2KFTA 2VJEA 4B7YC 5TRBA 2LGKA 2E6SA 4QF2A 4CCGX 2RI7A 4XI1A 3QZVA 5J3XA 4C9ZA 2MD8C 4YBSA 1JM7A 3LRQA 4LLBA 3SOXA 2ECGA 2EODA 3SOWA 5LKZA 2ZETC 4L58A 4GNDA 3HCTA 3RTRB 4LADB 2F6JA 4YABA 1MM2A 3NG2A 3PURA 2LGGA 4I7CA 1LDJB 2YQLA 5KH3A 2KREA 3DPLR 2HYED 2KIZA 2YURA 4FK5A 3MHSA 1ZBDB 1WFKA 4AYCA 1V87A 2M85A 4O64A 2YYRA 1E4UA 4S3OC 2AN6A 1MM3A 2JMDA 2QICA 2KWNA 1IYMA 2M3HA 4ZUXU 3EB6A 5KH7A 2CSZA 3ZPVE 2ECJA 2Y43A 3N9OA 4PPEA 1HYJA 2G43A 2KGIA 2CKLB 5B77A 5H1UA 3VK6A 3O36A 4WZ2A 4UI9B 2CSYA 4R8PK 3SHBA 3L1XA 3N9PA 3M62A 2FUUA 5I3LA 1WGMA 1WEEA 3T7LA 1WILA 2YU4A 3SOUA 2KGGA 3O34A 2C2VS 2E6RA 1JM7B 3FL2A 1XWHA 2KYUA 2K16A 4GNGA 5LKTA 2QJ0A 2KE1A 4NN2A 4V3KC 5TABA 2K1JA 4PTBA 2JMJA 2L5UA 4L7XA 1CHCA 2VNFA 3ZYQA 5LKUA 5G05B 3U5NA 4YATA 1WEVA 2L43A 5AITA 4LK9A 2KWJA 2LGVA 5D1MB 4N4FA 3GV4A 2BAYA 4ZDTA 5EYAF 3L1ZB 1WIMA 2OXQC 3C6WA 5TBNA 5D1LB 2VJFB 2KR4A 5H9MA 2L80A 3U5MA 5B78A 2KU3A 5G04B 3KV6A 3M63A 2MA6A 4WA6A 2VPDA 3IHPA 2L75A 5C13A 4QF3A 3PHDA 4UP5A 3RPGB 2F6NA 2LXHC 4A4CA 2EGPA 1N87A 1VFYA 1WE9A 1FP0A 4AP4A 1G25A 5C11A 3ZVZB 4LKAA 4W4UA 1WENA 2D8SA 2RSDA 2VPEA 3HCSA 2LXPC 4I7BA 4N3WA 4UP0A 2YHNA 2YUCA 5H1VA 4X3GA 2PNXA 5LCWB 5B8DA 4R2YA 1WEPA 2MA5A 4YC9A 3HTKC 3O33A 2ECNA 5FEYA 2M6MA 2M1RA 1Z60A 2VJEB 2F42A 2MT5A 2DX8A 3U5PA 1T1HA 4AUQB 2LRIC 2XB1A 2PUYA 2QIZA 4V3LC 2YREA 4ZQLA 2YSMA 4R7EA 1VD4A 2KWKA 5B75A 3KNVA 1K2FA 2LN0A 3C5KA 3EB5A 3KV5A 3N9NA 2YQMA 2IDAA 4BHWA 2Y1MA 4YBTA 4A0CD 2LV9A 4AYCB 2H0DB 5AIUA 3V43A 2VPGA 4MSXA 1X4IA 3N9MA 5JG6A 3O35A 2CT2A 3HCUA 3ZNIA 5B79A 3L11A 5FB1A 3PUQA 2HDPA 3O37A 4WZ0A 2Y1NA 1LDKC 1U6GB 2JRJA 2MNYA 2ECWA 1WEQA 2YHOA 4YADA 1WESA 2YT5A 4S3OB 5DKAA 3KQIA 4GNFA 2YSJA 1JOCA 1DVPA 1Z6UA 2VP7A 4Q6FA 4FO9A 3U5OA 2K17A 4TKPB 3N9LA 3MHHA 2ECVA 4F52B 1HYIA 1F62A 2MIQA 5G0FA 1WEWA 3O70A 4MVTA 2FSAA 3I2DA 2K4DA 5FERA 2C2LA 3LQHA 4A49A 4AVXA 3ASLA 4I7DA 1RMDA 5FB0A 5TDWA 2CKLA
chains in the Genus database with same CATH superfamily
2MNZA 2G45A 2VPBA 3LQIA 4P5OB 2ECIA 2XOCA 2EA6A 3M99A 3ZVYA 4FJCA 4IC3A 5D1KB 2LGLA 5LKXA 2YW8A 3O7AA 5B76A 2MD7B 3RPGC 5H1TA 4BBQA 2KWOA 2M13A 3GL6A 2L0BA 1X4UA 2ECTA 3DQVR 4YAXA 1VYXA 2P57A 2I50A 3N9QA 2JMIA 5TDRA 1BORA 4B86C 1Z2QA 5DINA 4YBMA 1WEOA 3T6RA 3O47A 5SVXA 3ZPV1 2LDRA 4IC2A 3T9KA 2H0DA 3LQJA 3ZTGA 4GNEA 1X4JA 5SVIA 2MUMA 1FBVA 4GB0A 2UZGA 4CA1A 2CSVA 3FANA 2NAAA 2G6QA 4A4BA 2VJFA 2LQ6A 2XEUA 1WEUA 4LJNA 4FIPA 1WEMA 2FUIA 5KH9A 4WZ3B 2KFTA 2VJEA 5K3QA 3JUEA 4B7YC 5TRBA 2LGKA 2E6SA 4QF2A 1DCQA 4CCGX 2RI7A 4XI1A 4OGCA 3QZVA 5J3XA 4C9ZA 2MD8C 4YBSA 1JM7A 5SVYA 3LRQA 2XOYA 3H7HA 4LLBA 3SOXA 2XOZA 2ECGA 2EODA 3SOWA 5LKZA 2ZETC 4L58A 4GNDA 3LJUX 3HCTA 3RTRB 4LADB 2F6JA 4YABA 2KKYA 1MM2A 4F1PA 2KKXA 5SVIB 3NG2A 3PURA 2FFWA 2LGGA 4I7CA 1LDJB 2YQLA 3MDBC 5KH3A 2KREA 3DPLR 3PLWA 2HYED 2KIZA 2LAUA 2YURA 4FK5A 3MHSA 2MKEA 1ZBDB 1WFKA 4AYCA 1V87A 2M85A 4O64A 2YYRA 1E4UA 4Z0RA 4S3OC 2AN6A 1MM3A 2JMDA 2QICA 2KWNA 1IYMA 2M3HA 4ZUXU 3EB6A 5KH7A 2XP0A 2CSZA 3ZPVE 2ECJA 2Y43A 3N9OA 4PPEA 3Q1DA 3LVQE 3LVRE 1HYJA 2G43A 2KGIA 2CKLB 5B77A 5H1UA 3O36A 3VK6A 4WZ2A 4UI9B 2CSYA 4R8PK 3SHBA 3L1XA 3N9PA 3M62A 2FUUA 5I3LA 1WGMA 1WEEA 3T7LA 1WILA 2YU4A 3SOUA 2KGGA 3O34A 2C2VS 2E6RA 1JM7B 3FL2A 1XWHA 2IQJA 2KYUA 2K16A 4GNGA 5LKTA 2JM3A 2E61A 2QJ0A 2KE1A 2OWAA 4NN2A 4V3KC 5TABA 2K1JA 4PTBA 3M7KA 2JMJA 2L5UA 4L7XA 1CHCA 2CRWA 2VNFA 3ZYQA 5LKUA 5G05B 3U5NA 4YATA 1WEVA 2L43A 5AITA 4LK9A 4H9DA 2KWJA 2LGVA 5D1MB 3KDEC 4N4FA 3GV4A 2BAYA 4ZDTA 5EYAF 2EGMA 3L1ZB 1WIMA 2OXQC 3C6WA 5TBNA 2B0OE 5D1LB 2VJFB 2KR4A 5H9MA 2L80A 3U5MA 5B78A 2KU3A 5G04B 3KV6A 3M63A 2MA6A 4WA6A 2VPDA 3FJUB 3IHPA 2L75A 5C13A 4QF3A 3PHDA 4UP5A 3RPGB 2F6NA 2LXHC 4A4CA 2EGPA 1N87A 1VFYA 1WE9A 1FP0A 4AP4A 1G25A 4QQ4A 2CONA 3E2DA 5C11A 3ZVZB 4LKAA 4W4UA 1WENA 2D8SA 2RSDA 3HCSA 2VPEA 2LXPC 4I7BA 4N3WA 4UP0A 4OGEA 2YHNA 2YUCA 5H1VA 4X3GA 3FAOA 2EXUA 2PNXA 5LCWB 5B8DA 2RR4A 4R2YA 1WEPA 2MA5A 4YC9A 2DSMA 3HTKC 3O33A 2ECNA 5FEYA 2M6MA 2M1RA 1Z60A 2VJEB 2F42A 2MT5A 2YVRA 2L7PA 2DX8A 3U5PA 1T1HA 4AUQB 4Z0OA 2LRIC 2XB1A 2DJAA 2PUYA 2QIZA 4V3LC 2YREA 4ZQLA 2YSMA 4R7EA 1VD4A 2KWKA 3FEHA 5B75A 3KNVA 1K2FA 2LN0A 3C5KA 3EB5A 3KV5A 3N9NA 2YQMA 2IDAA 4BHWA 2Y1MA 4YBTA 2CRRA 4A0CD 2LV9A 4O62A 2H0DB 4AYCB 5AIUA 2D8UA 3V43A 2VPGA 4MSXA 1X4IA 3N9MA 5JG6A 3O35A 2CT2A 3DWDA 3HCUA 3ZNIA 5B79A 3L11A 5FB1A 3PUQA 2HDPA 3O37A 4WZ0A 2Y1NA 1LDKC 1U6GB 2YHOA 2JRJA 2ECWA 1WEQA 2MNYA 4YADA 1WESA 2YT5A 4S3OB 5DKAA 3KQIA 4GNFA 2YSJA 1JOCA 1DVPA 3DDTA 3FM8C 1Z6UA 2VP7A 4Q6FA 4FO9A 3U5OA 2K17A 1MBMA 4TKPB 3LDYA 3N9LA 3MHHA 2ECVA 2JUNA 4F52B 1HYIA 1F62A 2MIQA 5G0FA 1WEWA 3O70A 4MVTA 2FSAA 3I2DA 2K4DA 3SUBA 5FERA 2C2LA 3LQHA 4A49A 4AVXA 3ASLA 4I7DA 1RMDA 5FB0A 2FD4A 5TDWA 2CKLA
chains in the Genus database with same CATH topology
2MNZA 2G45A 2VPBA 3LQIA 4P5OB 2ECIA 2EA6A 3M99A 3ZVYA 4FJCA 4IC3A 5D1KB 2LGLA 5LKXA 2YW8A 3O7AA 5B76A 2MD7B 3RPGC 5H1TA 4BBQA 2KWOA 3GL6A 2L0BA 1X4UA 2ECTA 3DQVR 4YAXA 1VYXA 2I50A 3N9QA 2JMIA 5TDRA 1BORA 4B86C 1Z2QA 5DINA 4YBMA 1WEOA 3T6RA 3ZPV1 2LDRA 4IC2A 2H0DA 3LQJA 3ZTGA 4GNEA 1X4JA 2MUMA 1FBVA 4GB0A 2UZGA 4CA1A 2NAAA 2G6QA 4A4BA 2VJFA 2LQ6A 2XEUA 1WEUA 4LJNA 4FIPA 1WEMA 2FUIA 5KH9A 4WZ3B 2KFTA 2VJEA 4B7YC 5TRBA 2LGKA 2E6SA 4QF2A 4CCGX 2RI7A 4XI1A 3QZVA 5J3XA 4C9ZA 2MD8C 4YBSA 1JM7A 3LRQA 4LLBA 3SOXA 2ECGA 2EODA 3SOWA 5LKZA 2ZETC 4L58A 4GNDA 3HCTA 3RTRB 4LADB 2F6JA 4YABA 1MM2A 3NG2A 3PURA 2LGGA 4I7CA 1LDJB 2YQLA 5KH3A 2KREA 3DPLR 2HYED 2KIZA 2YURA 4FK5A 3MHSA 1ZBDB 1WFKA 4AYCA 1V87A 2M85A 4O64A 2YYRA 1E4UA 4S3OC 2AN6A 1MM3A 2JMDA 2QICA 2KWNA 1IYMA 2M3HA 4ZUXU 3EB6A 5KH7A 2CSZA 3ZPVE 2ECJA 2Y43A 3N9OA 4PPEA 1HYJA 2G43A 2KGIA 2CKLB 5B77A 5H1UA 3VK6A 3O36A 4WZ2A 4UI9B 2CSYA 4R8PK 3SHBA 3L1XA 3N9PA 3M62A 2FUUA 5I3LA 1WGMA 1WEEA 3T7LA 1WILA 2YU4A 3SOUA 2KGGA 3O34A 2C2VS 2E6RA 1JM7B 3FL2A 1XWHA 2KYUA 2K16A 4GNGA 5LKTA 2QJ0A 2KE1A 4NN2A 4V3KC 5TABA 2K1JA 4PTBA 2JMJA 2L5UA 4L7XA 1CHCA 2VNFA 3ZYQA 5LKUA 5G05B 3U5NA 4YATA 1WEVA 2L43A 5AITA 4LK9A 2KWJA 2LGVA 5D1MB 4N4FA 3GV4A 2BAYA 4ZDTA 5EYAF 3L1ZB 1WIMA 2OXQC 3C6WA 5TBNA 5D1LB 2VJFB 2KR4A 5H9MA 2L80A 3U5MA 5B78A 2KU3A 5G04B 3KV6A 3M63A 2MA6A 4WA6A 2VPDA 3IHPA 2L75A 5C13A 4QF3A 3PHDA 4UP5A 3RPGB 2F6NA 2LXHC 4A4CA 2EGPA 1N87A 1VFYA 1WE9A 1FP0A 4AP4A 1G25A 5C11A 3ZVZB 4LKAA 4W4UA 1WENA 2D8SA 2RSDA 2VPEA 3HCSA 2LXPC 4I7BA 4N3WA 4UP0A 2YHNA 2YUCA 5H1VA 4X3GA 2PNXA 5LCWB 5B8DA 4R2YA 1WEPA 2MA5A 4YC9A 3HTKC 3O33A 2ECNA 5FEYA 2M6MA 2M1RA 1Z60A 2VJEB 2F42A 2MT5A 2DX8A 3U5PA 1T1HA 4AUQB 2LRIC 2XB1A 2PUYA 2QIZA 4V3LC 2YREA 4ZQLA 2YSMA 4R7EA 1VD4A 2KWKA 5B75A 3KNVA 1K2FA 2LN0A 3C5KA 3EB5A 3KV5A 3N9NA 2YQMA 2IDAA 4BHWA 2Y1MA 4YBTA 4A0CD 2LV9A 4AYCB 2H0DB 5AIUA 3V43A 2VPGA 4MSXA 1X4IA 3N9MA 5JG6A 3O35A 2CT2A 3HCUA 3ZNIA 5B79A 3L11A 5FB1A 3PUQA 2HDPA 3O37A 4WZ0A 2Y1NA 1LDKC 1U6GB 2JRJA 2MNYA 2ECWA 1WEQA 2YHOA 4YADA 1WESA 2YT5A 4S3OB 5DKAA 3KQIA 4GNFA 2YSJA 1JOCA 1DVPA 1Z6UA 2VP7A 4Q6FA 4FO9A 3U5OA 2K17A 4TKPB 3N9LA 3MHHA 2ECVA 4F52B 1HYIA 1F62A 2MIQA 5G0FA 1WEWA 3O70A 4MVTA 2FSAA 3I2DA 2K4DA 5FERA 2C2LA 3LQHA 4A49A 4AVXA 3ASLA 4I7DA 1RMDA 5FB0A 5TDWA 2CKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MNZ A;  2G45 A;  2VPB A;  3LQI A;  4P5O B;  2ECI A;  2EA6 A;  3M99 A;  3ZVY A;  4FJC A;  4IC3 A;  5D1K B;  2LGL A;  5LKX A;  2YW8 A;  3O7A A;  5B76 A;  2MD7 B;  3RPG C;  5H1T A;  4BBQ A;  2KWO A;  3GL6 A;  2L0B A;  1X4U A;  2ECT A;  3DQV R;  4YAX A;  1VYX A;  2I50 A;  3N9Q A;  2JMI A;  5TDR A;  1BOR A;  4B86 C;  1Z2Q A;  5DIN A;  4YBM A;  1WEO A;  3T6R A;  3ZPV 1;  2LDR A;  4IC2 A;  2H0D A;  3LQJ A;  3ZTG A;  4GNE A;  1X4J A;  2MUM A;  1FBV A;  4GB0 A;  2UZG A;  4CA1 A;  2NAA A;  2G6Q A;  4A4B A;  2VJF A;  2LQ6 A;  2XEU A;  1WEU A;  4LJN A;  4FIP A;  1WEM A;  2FUI A;  5KH9 A;  4WZ3 B;  2KFT A;  2VJE A;  4B7Y C;  5TRB A;  2LGK A;  2E6S A;  4QF2 A;  4CCG X;  2RI7 A;  4XI1 A;  3QZV A;  5J3X A;  4C9Z A;  2MD8 C;  4YBS A;  1JM7 A;  3LRQ A;  4LLB A;  3SOX A;  2ECG A;  2EOD A;  3SOW A;  5LKZ A;  2ZET C;  4L58 A;  4GND A;  3HCT A;  3RTR B;  4LAD B;  2F6J A;  4YAB A;  1MM2 A;  3NG2 A;  3PUR A;  2LGG A;  4I7C A;  1LDJ B;  2YQL A;  5KH3 A;  2KRE A;  3DPL R;  2HYE D;  2KIZ A;  2YUR A;  4FK5 A;  3MHS A;  1ZBD B;  1WFK A;  4AYC A;  1V87 A;  2M85 A;  4O64 A;  2YYR A;  1E4U A;  4S3O C;  2AN6 A;  1MM3 A;  2JMD A;  2QIC A;  2KWN A;  1IYM A;  2M3H A;  4ZUX U;  3EB6 A;  5KH7 A;  2CSZ A;  3ZPV E;  2ECJ A;  2Y43 A;  3N9O A;  4PPE A;  1HYJ A;  2G43 A;  2KGI A;  2CKL B;  5B77 A;  5H1U A;  3VK6 A;  3O36 A;  4WZ2 A;  4UI9 B;  2CSY A;  4R8P K;  3SHB A;  3L1X A;  3N9P A;  3M62 A;  2FUU A;  5I3L A;  1WGM A;  1WEE A;  3T7L A;  1WIL A;  2YU4 A;  3SOU A;  2KGG A;  3O34 A;  2C2V S;  2E6R A;  1JM7 B;  3FL2 A;  1XWH A;  2KYU A;  2K16 A;  4GNG A;  5LKT A;  2QJ0 A;  2KE1 A;  4NN2 A;  4V3K C;  5TAB A;  2K1J A;  4PTB A;  2JMJ A;  2L5U A;  4L7X A;  1CHC A;  2VNF A;  3ZYQ A;  5LKU A;  5G05 B;  3U5N A;  4YAT A;  1WEV A;  2L43 A;  5AIT A;  4LK9 A;  2KWJ A;  2LGV A;  5D1M B;  4N4F A;  3GV4 A;  2BAY A;  4ZDT A;  5EYA F;  3L1Z B;  1WIM A;  2OXQ C;  3C6W A;  5TBN A;  5D1L B;  2VJF B;  2KR4 A;  5H9M A;  2L80 A;  3U5M A;  5B78 A;  2KU3 A;  5G04 B;  3KV6 A;  3M63 A;  2MA6 A;  4WA6 A;  2VPD A;  3IHP A;  2L75 A;  5C13 A;  4QF3 A;  3PHD A;  4UP5 A;  3RPG B;  2F6N A;  2LXH C;  4A4C A;  2EGP A;  1N87 A;  1VFY A;  1WE9 A;  1FP0 A;  4AP4 A;  1G25 A;  5C11 A;  3ZVZ B;  4LKA A;  4W4U A;  1WEN A;  2D8S A;  2RSD A;  2VPE A;  3HCS A;  2LXP C;  4I7B A;  4N3W A;  4UP0 A;  2YHN A;  2YUC A;  5H1V A;  4X3G A;  2PNX A;  5LCW B;  5B8D A;  4R2Y A;  1WEP A;  2MA5 A;  4YC9 A;  3HTK C;  3O33 A;  2ECN A;  5FEY A;  2M6M A;  2M1R A;  1Z60 A;  2VJE B;  2F42 A;  2MT5 A;  2DX8 A;  3U5P A;  1T1H A;  4AUQ B;  2LRI C;  2XB1 A;  2PUY A;  2QIZ A;  4V3L C;  2YRE A;  4ZQL A;  2YSM A;  4R7E A;  1VD4 A;  2KWK A;  5B75 A;  3KNV A;  1K2F A;  2LN0 A;  3C5K A;  3EB5 A;  3KV5 A;  3N9N A;  2YQM A;  2IDA A;  4BHW A;  2Y1M A;  4YBT A;  4A0C D;  2LV9 A;  4AYC B;  2H0D B;  5AIU A;  3V43 A;  2VPG A;  4MSX A;  1X4I A;  3N9M A;  5JG6 A;  3O35 A;  2CT2 A;  3HCU A;  3ZNI A;  5B79 A;  3L11 A;  5FB1 A;  3PUQ A;  2HDP A;  3O37 A;  4WZ0 A;  2Y1N A;  1LDK C;  1U6G B;  2JRJ A;  2MNY A;  2ECW A;  1WEQ A;  2YHO A;  4YAD A;  1WES A;  2YT5 A;  4S3O B;  5DKA A;  3KQI A;  4GNF A;  2YSJ A;  1JOC A;  1DVP A;  1Z6U A;  2VP7 A;  4Q6F A;  4FO9 A;  3U5O A;  2K17 A;  4TKP B;  3N9L A;  3MHH A;  2ECV A;  4F52 B;  1HYI A;  1F62 A;  2MIQ A;  5G0F A;  1WEW A;  3O70 A;  4MVT A;  2FSA A;  3I2D A;  2K4D A;  5FER A;  2C2L A;  3LQH A;  4A49 A;  4AVX A;  3ASL A;  4I7D A;  1RMD A;  5FB0 A;  5TDW A;  2CKL A; 
#chains in the Genus database with same CATH topology
 2MNZ A;  2G45 A;  2VPB A;  3LQI A;  4P5O B;  2ECI A;  2XOC A;  2EA6 A;  3M99 A;  3ZVY A;  4FJC A;  4IC3 A;  5D1K B;  2LGL A;  5LKX A;  2YW8 A;  3O7A A;  5B76 A;  2MD7 B;  3RPG C;  5H1T A;  4BBQ A;  2KWO A;  2M13 A;  3GL6 A;  2L0B A;  1X4U A;  2ECT A;  3DQV R;  4YAX A;  1VYX A;  2P57 A;  2I50 A;  3N9Q A;  2JMI A;  5TDR A;  1BOR A;  4B86 C;  1Z2Q A;  5DIN A;  4YBM A;  1WEO A;  3T6R A;  3O47 A;  5SVX A;  3ZPV 1;  2LDR A;  4IC2 A;  3T9K A;  2H0D A;  3LQJ A;  3ZTG A;  4GNE A;  1X4J A;  5SVI A;  2MUM A;  1FBV A;  4GB0 A;  2UZG A;  4CA1 A;  2CSV A;  3FAN A;  2NAA A;  2G6Q A;  4A4B A;  2VJF A;  2LQ6 A;  2XEU A;  1WEU A;  4LJN A;  4FIP A;  1WEM A;  2FUI A;  5KH9 A;  4WZ3 B;  2KFT A;  2VJE A;  5K3Q A;  3JUE A;  4B7Y C;  5TRB A;  2LGK A;  2E6S A;  4QF2 A;  1DCQ A;  4CCG X;  2RI7 A;  4XI1 A;  4OGC A;  3QZV A;  5J3X A;  4C9Z A;  2MD8 C;  4YBS A;  1JM7 A;  5SVY A;  3LRQ A;  2XOY A;  3H7H A;  4LLB A;  3SOX A;  2XOZ A;  2ECG A;  2EOD A;  3SOW A;  5LKZ A;  2ZET C;  4L58 A;  4GND A;  3LJU X;  3HCT A;  3RTR B;  4LAD B;  2F6J A;  4YAB A;  2KKY A;  1MM2 A;  4F1P A;  2KKX A;  5SVI B;  3NG2 A;  3PUR A;  2FFW A;  2LGG A;  4I7C A;  1LDJ B;  2YQL A;  3MDB C;  5KH3 A;  2KRE A;  3DPL R;  3PLW A;  2HYE D;  2KIZ A;  2LAU A;  2YUR A;  4FK5 A;  3MHS A;  2MKE A;  1ZBD B;  1WFK A;  4AYC A;  1V87 A;  2M85 A;  4O64 A;  2YYR A;  1E4U A;  4Z0R A;  4S3O C;  2AN6 A;  1MM3 A;  2JMD A;  2QIC A;  2KWN A;  1IYM A;  2M3H A;  4ZUX U;  3EB6 A;  5KH7 A;  2XP0 A;  2CSZ A;  3ZPV E;  2ECJ A;  2Y43 A;  3N9O A;  4PPE A;  3Q1D A;  3LVQ E;  3LVR E;  1HYJ A;  2G43 A;  2KGI A;  2CKL B;  5B77 A;  5H1U A;  3O36 A;  3VK6 A;  4WZ2 A;  4UI9 B;  2CSY A;  4R8P K;  3SHB A;  3L1X A;  3N9P A;  3M62 A;  2FUU A;  5I3L A;  1WGM A;  1WEE A;  3T7L A;  1WIL A;  2YU4 A;  3SOU A;  2KGG A;  3O34 A;  2C2V S;  2E6R A;  1JM7 B;  3FL2 A;  1XWH A;  2IQJ A;  2KYU A;  2K16 A;  4GNG A;  5LKT A;  2JM3 A;  2E61 A;  2QJ0 A;  2KE1 A;  2OWA A;  4NN2 A;  4V3K C;  5TAB A;  2K1J A;  4PTB A;  3M7K A;  2JMJ A;  2L5U A;  4L7X A;  1CHC A;  2CRW A;  2VNF A;  3ZYQ A;  5LKU A;  5G05 B;  3U5N A;  4YAT A;  1WEV A;  2L43 A;  5AIT A;  4LK9 A;  4H9D A;  2KWJ A;  2LGV A;  5D1M B;  3KDE C;  4N4F A;  3GV4 A;  2BAY A;  4ZDT A;  5EYA F;  2EGM A;  3L1Z B;  1WIM A;  2OXQ C;  3C6W A;  5TBN A;  2B0O E;  5D1L B;  2VJF B;  2KR4 A;  5H9M A;  2L80 A;  3U5M A;  5B78 A;  2KU3 A;  5G04 B;  3KV6 A;  3M63 A;  2MA6 A;  4WA6 A;  2VPD A;  3FJU B;  3IHP A;  2L75 A;  5C13 A;  4QF3 A;  3PHD A;  4UP5 A;  3RPG B;  2F6N A;  2LXH C;  4A4C A;  2EGP A;  1N87 A;  1VFY A;  1WE9 A;  1FP0 A;  4AP4 A;  1G25 A;  4QQ4 A;  2CON A;  3E2D A;  5C11 A;  3ZVZ B;  4LKA A;  4W4U A;  1WEN A;  2D8S A;  2RSD A;  3HCS A;  2VPE A;  2LXP C;  4I7B A;  4N3W A;  4UP0 A;  4OGE A;  2YHN A;  2YUC A;  5H1V A;  4X3G A;  3FAO A;  2EXU A;  2PNX A;  5LCW B;  5B8D A;  2RR4 A;  4R2Y A;  1WEP A;  2MA5 A;  4YC9 A;  2DSM A;  3HTK C;  3O33 A;  2ECN A;  5FEY A;  2M6M A;  2M1R A;  1Z60 A;  2VJE B;  2F42 A;  2MT5 A;  2YVR A;  2L7P A;  2DX8 A;  3U5P A;  1T1H A;  4AUQ B;  4Z0O A;  2LRI C;  2XB1 A;  2DJA A;  2PUY A;  2QIZ A;  4V3L C;  2YRE A;  4ZQL A;  2YSM A;  4R7E A;  1VD4 A;  2KWK A;  3FEH A;  5B75 A;  3KNV A;  1K2F A;  2LN0 A;  3C5K A;  3EB5 A;  3KV5 A;  3N9N A;  2YQM A;  2IDA A;  4BHW A;  2Y1M A;  4YBT A;  2CRR A;  4A0C D;  2LV9 A;  4O62 A;  2H0D B;  4AYC B;  5AIU A;  2D8U A;  3V43 A;  2VPG A;  4MSX A;  1X4I A;  3N9M A;  5JG6 A;  3O35 A;  2CT2 A;  3DWD A;  3HCU A;  3ZNI A;  5B79 A;  3L11 A;  5FB1 A;  3PUQ A;  2HDP A;  3O37 A;  4WZ0 A;  2Y1N A;  1LDK C;  1U6G B;  2YHO A;  2JRJ A;  2ECW A;  1WEQ A;  2MNY A;  4YAD A;  1WES A;  2YT5 A;  4S3O B;  5DKA A;  3KQI A;  4GNF A;  2YSJ A;  1JOC A;  1DVP A;  3DDT A;  3FM8 C;  1Z6U A;  2VP7 A;  4Q6F A;  4FO9 A;  3U5O A;  2K17 A;  1MBM A;  4TKP B;  3LDY A;  3N9L A;  3MHH A;  2ECV A;  2JUN A;  4F52 B;  1HYI A;  1F62 A;  2MIQ A;  5G0F A;  1WEW A;  3O70 A;  4MVT A;  2FSA A;  3I2D A;  2K4D A;  3SUB A;  5FER A;  2C2L A;  3LQH A;  4A49 A;  4AVX A;  3ASL A;  4I7D A;  1RMD A;  5FB0 A;  2FD4 A;  5TDW A;  2CKL A; 
#chains in the Genus database with same CATH homology
 2MNZ A;  2G45 A;  2VPB A;  3LQI A;  4P5O B;  2ECI A;  2EA6 A;  3M99 A;  3ZVY A;  4FJC A;  4IC3 A;  5D1K B;  2LGL A;  5LKX A;  2YW8 A;  3O7A A;  5B76 A;  2MD7 B;  3RPG C;  5H1T A;  4BBQ A;  2KWO A;  3GL6 A;  2L0B A;  1X4U A;  2ECT A;  3DQV R;  4YAX A;  1VYX A;  2I50 A;  3N9Q A;  2JMI A;  5TDR A;  1BOR A;  4B86 C;  1Z2Q A;  5DIN A;  4YBM A;  1WEO A;  3T6R A;  3ZPV 1;  2LDR A;  4IC2 A;  2H0D A;  3LQJ A;  3ZTG A;  4GNE A;  1X4J A;  2MUM A;  1FBV A;  4GB0 A;  2UZG A;  4CA1 A;  2NAA A;  2G6Q A;  4A4B A;  2VJF A;  2LQ6 A;  2XEU A;  1WEU A;  4LJN A;  4FIP A;  1WEM A;  2FUI A;  5KH9 A;  4WZ3 B;  2KFT A;  2VJE A;  4B7Y C;  5TRB A;  2LGK A;  2E6S A;  4QF2 A;  4CCG X;  2RI7 A;  4XI1 A;  3QZV A;  5J3X A;  4C9Z A;  2MD8 C;  4YBS A;  1JM7 A;  3LRQ A;  4LLB A;  3SOX A;  2ECG A;  2EOD A;  3SOW A;  5LKZ A;  2ZET C;  4L58 A;  4GND A;  3HCT A;  3RTR B;  4LAD B;  2F6J A;  4YAB A;  1MM2 A;  3NG2 A;  3PUR A;  2LGG A;  4I7C A;  1LDJ B;  2YQL A;  5KH3 A;  2KRE A;  3DPL R;  2HYE D;  2KIZ A;  2YUR A;  4FK5 A;  3MHS A;  1ZBD B;  1WFK A;  4AYC A;  1V87 A;  2M85 A;  4O64 A;  2YYR A;  1E4U A;  4S3O C;  2AN6 A;  1MM3 A;  2JMD A;  2QIC A;  2KWN A;  1IYM A;  2M3H A;  4ZUX U;  3EB6 A;  5KH7 A;  2CSZ A;  3ZPV E;  2ECJ A;  2Y43 A;  3N9O A;  4PPE A;  1HYJ A;  2G43 A;  2KGI A;  2CKL B;  5B77 A;  5H1U A;  3VK6 A;  3O36 A;  4WZ2 A;  4UI9 B;  2CSY A;  4R8P K;  3SHB A;  3L1X A;  3N9P A;  3M62 A;  2FUU A;  5I3L A;  1WGM A;  1WEE A;  3T7L A;  1WIL A;  2YU4 A;  3SOU A;  2KGG A;  3O34 A;  2C2V S;  2E6R A;  1JM7 B;  3FL2 A;  1XWH A;  2KYU A;  2K16 A;  4GNG A;  5LKT A;  2QJ0 A;  2KE1 A;  4NN2 A;  4V3K C;  5TAB A;  2K1J A;  4PTB A;  2JMJ A;  2L5U A;  4L7X A;  1CHC A;  2VNF A;  3ZYQ A;  5LKU A;  5G05 B;  3U5N A;  4YAT A;  1WEV A;  2L43 A;  5AIT A;  4LK9 A;  2KWJ A;  2LGV A;  5D1M B;  4N4F A;  3GV4 A;  2BAY A;  4ZDT A;  5EYA F;  3L1Z B;  1WIM A;  2OXQ C;  3C6W A;  5TBN A;  5D1L B;  2VJF B;  2KR4 A;  5H9M A;  2L80 A;  3U5M A;  5B78 A;  2KU3 A;  5G04 B;  3KV6 A;  3M63 A;  2MA6 A;  4WA6 A;  2VPD A;  3IHP A;  2L75 A;  5C13 A;  4QF3 A;  3PHD A;  4UP5 A;  3RPG B;  2F6N A;  2LXH C;  4A4C A;  2EGP A;  1N87 A;  1VFY A;  1WE9 A;  1FP0 A;  4AP4 A;  1G25 A;  5C11 A;  3ZVZ B;  4LKA A;  4W4U A;  1WEN A;  2D8S A;  2RSD A;  2VPE A;  3HCS A;  2LXP C;  4I7B A;  4N3W A;  4UP0 A;  2YHN A;  2YUC A;  5H1V A;  4X3G A;  2PNX A;  5LCW B;  5B8D A;  4R2Y A;  1WEP A;  2MA5 A;  4YC9 A;  3HTK C;  3O33 A;  2ECN A;  5FEY A;  2M6M A;  2M1R A;  1Z60 A;  2VJE B;  2F42 A;  2MT5 A;  2DX8 A;  3U5P A;  1T1H A;  4AUQ B;  2LRI C;  2XB1 A;  2PUY A;  2QIZ A;  4V3L C;  2YRE A;  4ZQL A;  2YSM A;  4R7E A;  1VD4 A;  2KWK A;  5B75 A;  3KNV A;  1K2F A;  2LN0 A;  3C5K A;  3EB5 A;  3KV5 A;  3N9N A;  2YQM A;  2IDA A;  4BHW A;  2Y1M A;  4YBT A;  4A0C D;  2LV9 A;  4AYC B;  2H0D B;  5AIU A;  3V43 A;  2VPG A;  4MSX A;  1X4I A;  3N9M A;  5JG6 A;  3O35 A;  2CT2 A;  3HCU A;  3ZNI A;  5B79 A;  3L11 A;  5FB1 A;  3PUQ A;  2HDP A;  3O37 A;  4WZ0 A;  2Y1N A;  1LDK C;  1U6G B;  2JRJ A;  2MNY A;  2ECW A;  1WEQ A;  2YHO A;  4YAD A;  1WES A;  2YT5 A;  4S3O B;  5DKA A;  3KQI A;  4GNF A;  2YSJ A;  1JOC A;  1DVP A;  1Z6U A;  2VP7 A;  4Q6F A;  4FO9 A;  3U5O A;  2K17 A;  4TKP B;  3N9L A;  3MHH A;  2ECV A;  4F52 B;  1HYI A;  1F62 A;  2MIQ A;  5G0F A;  1WEW A;  3O70 A;  4MVT A;  2FSA A;  3I2D A;  2K4D A;  5FER A;  2C2L A;  3LQH A;  4A49 A;  4AVX A;  3ASL A;  4I7D A;  1RMD A;  5FB0 A;  5TDW A;  2CKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...