2HYED

Crystal structure of the ddb1-cul4a-rbx1-sv5v complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA damage-binding protein 1
publication title Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hyeD00
1WFKA 1V87A 3VK6A 1LDJB 1N87A 2IDAA 2KIZA 2VPGA 4A4BA 1G25A 2LXHC 5B8DA 2YUCA 5B77A 1Z2QA 2F6JA 1F62A 1VYXA 2VNFA 3MHSA 4N3WA 4I7BA 3N9QA 2VPEA 3SOWA 3V43A 3KQIA 4B86C 3O35A 4AP4A 2QIZA 5I3LA 3M62A 1WEUA 4A49A 3U5PA 4UP5A 1X4IA 5AIUA 2MA6A 4FO9A 4V3LC 1WE9A 5B75A 2MD7B 3ZVYA 2LGKA 2FUUA 2Y1MA 4LK9A 2XEUA 2EGPA 1HYIA 2OXQC 5LKUA 2CKLB 4R2YA 3ZNIA 3DQVR 2HYED 3MHHA 4FK5A 4GB0A 2ECJA 2CT2A 4IC2A 5D1KB 5DKAA 2KYUA 2EODA 2L75A 2K16A 1MM3A 2M3HA 5H9MA 1WENA 3I2DA 2MUMA 3O34A 4YADA 3SHBA 2KWKA 4XI1A 3HCUA 2L0BA 4YAXA 2D8SA 5TABA 2C2LA 2VJFB 2ECNA 5B76A 2KE1A 5TDRA 4O64A 2YHOA 2RI7A 3SOUA 4PPEA 4S3OB 3LQIA 3L1ZB 3C5KA 2K17A 4ZDTA 3RPGB 3RTRB 4UI9B 2LGLA 5KH3A 3M63A 5LKZA 5KH9A 4A4CA 4ZUXU 1X4UA 2G6QA 1ZBDB 2YW8A 1WEPA 3PHDA 2KR4A 2ECIA 2H0DA 1MM2A 4UP0A 5DINA 3N9PA 2YT5A 4Q6FA 3KV5A 5D1MB 4WZ0A 2LN0A 2L80A 3T6RA 3PUQA 5FERA 2UZGA 2VJEA 5G0FA 2E6SA 1XWHA 2Y43A 4B7YC 4N4FA 4R7EA 4F52B 1IYMA 4BHWA 3U5NA 2KFTA 2KWOA 2LRIC 3N9OA 1VD4A 1X4JA 4QF2A 4W4UA 2F6NA 4WZ2A 2YYRA 2PNXA 4YATA 1JM7A 4GNFA 2MIQA 2HDPA 4L58A 3SOXA 4YBMA 1E4UA 2YU4A 2YSJA 3FL2A 5LCWB 4C9ZA 5TRBA 2CSZA 3EB5A 2L5UA 4YC9A 5J3XA 4YABA 2LDRA 1WILA 2KREA 4NN2A 2MNZA 4ZQLA 5D1LB 1FBVA 3ASLA 5LKXA 2K4DA 4TKPB 3HTKC 3M99A 1K2FA 5C13A 4X3GA 2DX8A 5LKTA 4PTBA 3QZVA 3T7LA 4R8PK 2M6MA 4IC3A 4WA6A 4FIPA 2ECTA 4LJNA 5G04B 2F42A 5EYAF 3EB6A 1U6GB 2M1RA 1WESA 3KNVA 2YQLA 4P5OB 3GL6A 1Z60A 3N9LA 2MT5A 3O36A 2ECVA 2Y1NA 2H0DB 2PUYA 2VJFA 4MSXA 4AYCA 2L43A 5AITA 3N9MA 5JG6A 1WEVA 2CSYA 1WIMA 4QF3A 1RMDA 2MA5A 3U5OA 2I50A 4AVXA 2JMDA 2LV9A 4AUQB 5KH7A 1FP0A 3O70A 3C6WA 2KU3A 2G45A 4L7XA 2VJEB 3GV4A 5TDWA 3DPLR 2AN6A 5B78A 1T1HA 3PURA 1WEQA 5C11A 2MD8C 2RSDA 1CHCA 2QICA 4LLBA 2M85A 3KV6A 2EA6A 2ZETC 3IHPA 2FUIA 2JMIA 3ZPVE 3ZVZB 2MNYA 4S3OC 1WGMA 2K1JA 4CA1A 4V3KC 1JM7B 2YREA 5H1VA 1DVPA 3NG2A 2VP7A 3RPGC 2YHNA 5G05B 3HCTA 2FSAA 4I7CA 1JOCA 3L11A 4FJCA 3ZTGA 4GNDA 4YBTA 2E6RA 2YURA 4A0CD 1WEOA 2KGIA 2YQMA 5TBNA 4BBQA 2YSMA 3O7AA 2VPDA 2ECWA 4CCGX 5FB1A 2CKLA 1BORA 2BAYA 4GNGA 4MVTA 4WZ3B 3LQHA 2KWNA 3N9NA 4LKAA 4GNEA 1WEMA 4LADB 3L1XA 2JMJA 2LQ6A 4YBSA 3U5MA 2LGVA 5H1TA 5H1UA 2LGGA 2KGGA 3O37A 5FB0A 3ZPV1 2JRJA 3LQJA 5B79A 3HCSA 2G43A 1LDKC 1Z6UA 2VPBA 1WEEA 1HYJA 2KWJA 1WEWA 2C2VS 4I7DA 2XB1A 3LRQA 1VFYA 2QJ0A 4AYCB 2ECGA 5FEYA 2NAAA 3ZYQA 3O33A 2LXPC
chains in the Genus database with same CATH superfamily
1WFKA 1V87A 3VK6A 1LDJB 1N87A 4F1PA 2IDAA 2KIZA 2VPGA 4A4BA 1G25A 2LXHC 5B8DA 2YUCA 5B77A 1Z2QA 2F6JA 1F62A 1VYXA 2VNFA 3MHSA 4N3WA 4I7BA 3N9QA 2VPEA 3SOWA 3V43A 3KQIA 4B86C 2RR4A 3O35A 4AP4A 2QIZA 3DDTA 5I3LA 3M62A 1WEUA 4A49A 3U5PA 4UP5A 1X4IA 5AIUA 2MA6A 4FO9A 4V3LC 1WE9A 5B75A 2MD7B 3SUBA 3ZVYA 2LGKA 2FUUA 2Y1MA 4LK9A 2XEUA 2EGPA 1HYIA 2LAUA 2OXQC 5LKUA 2CKLB 4R2YA 3ZNIA 3DQVR 2HYED 3MHHA 4FK5A 4GB0A 2ECJA 2CT2A 3M7KA 4IC2A 5D1KB 2KKYA 2EXUA 2XOYA 5DKAA 2KYUA 2EODA 2L75A 3DWDA 2K16A 1MM3A 2M3HA 5H9MA 3KDEC 1WENA 3I2DA 3FAOA 5SVXA 2MUMA 3O34A 4YADA 2D8UA 3SHBA 2KWKA 4XI1A 3HCUA 2L0BA 4YAXA 2D8SA 2DJAA 5TABA 2C2LA 3O47A 2VJFB 5SVIB 2ECNA 5B76A 2KE1A 5TDRA 4O64A 2YHOA 2RI7A 3SOUA 4PPEA 4S3OB 3LQIA 3L1ZB 3FANA 2KKXA 3C5KA 2K17A 5SVYA 4ZDTA 3RPGB 3RTRB 4UI9B 2LGLA 5KH3A 3M63A 5LKZA 5KH9A 4A4CA 4ZUXU 1X4UA 2G6QA 1ZBDB 2YW8A 3FM8C 1WEPA 3PHDA 2KR4A 2ECIA 1MM2A 2H0DA 4UP0A 5DINA 3N9PA 2YT5A 4Q6FA 2P57A 3KV5A 5D1MB 4WZ0A 2LN0A 2L80A 3T6RA 3PUQA 5FERA 2UZGA 2VJEA 2XOCA 5G0FA 2E6SA 1XWHA 2Y43A 4B7YC 4N4FA 4R7EA 3MDBC 4F52B 1IYMA 4BHWA 3U5NA 2KFTA 2KWOA 2LRIC 2IQJA 3N9OA 1VD4A 1X4JA 4QF2A 4W4UA 2F6NA 3LDYA 4WZ2A 2YYRA 2PNXA 3Q1DA 4YATA 1JM7A 4GNFA 2MIQA 2HDPA 4L58A 3SOXA 4YBMA 1E4UA 2JM3A 2YU4A 2YSJA 3FL2A 5LCWB 4C9ZA 5TRBA 2CSZA 3EB5A 2L5UA 4YC9A 5J3XA 4YABA 2LDRA 1WILA 2KREA 4NN2A 2MNZA 4ZQLA 5D1LB 3T9KA 1FBVA 3ASLA 5LKXA 2K4DA 4TKPB 3HTKC 3M99A 1MBMA 2CRWA 4OGCA 1K2FA 3LVQE 5C13A 4X3GA 2DX8A 5LKTA 4PTBA 3QZVA 4QQ4A 3T7LA 4R8PK 2M6MA 4IC3A 4WA6A 4FIPA 2ECTA 4LJNA 4O62A 4OGEA 5G04B 2F42A 5EYAF 3EB6A 1U6GB 2M1RA 1WESA 3H7HA 3KNVA 2YVRA 2YQLA 4P5OB 3GL6A 2M13A 2XP0A 1Z60A 3N9LA 3E2DA 2MT5A 3O36A 2ECVA 2Y1NA 2H0DB 2PUYA 2VJFA 4MSXA 4AYCA 2L43A 5AITA 3N9MA 5JG6A 1WEVA 2CSYA 1WIMA 4QF3A 1RMDA 2MA5A 3U5OA 2I50A 4AVXA 2DSMA 2JMDA 2LV9A 4AUQB 5KH7A 1FP0A 3O70A 3C6WA 3JUEA 2L7PA 2KU3A 2B0OE 2G45A 4L7XA 2VJEB 3GV4A 2JUNA 2XOZA 5TDWA 3DPLR 2AN6A 5B78A 2FFWA 4H9DA 1T1HA 3PURA 1WEQA 5C11A 2MD8C 2RSDA 1CHCA 2QICA 4LLBA 2M85A 3KV6A 2EA6A 2ZETC 3IHPA 2FUIA 2JMIA 3ZPVE 3ZVZB 3PLWA 2MNYA 4S3OC 3FJUB 1DCQA 1WGMA 2K1JA 4CA1A 4V3KC 1JM7B 2YREA 5H1VA 1DVPA 2MKEA 2VP7A 3NG2A 3RPGC 2E61A 2YHNA 5G05B 3HCTA 4Z0OA 2FSAA 4I7CA 3FEHA 1JOCA 3L11A 2OWAA 4FJCA 3ZTGA 4GNDA 4YBTA 2E6RA 2YURA 4A0CD 2EGMA 3LJUX 1WEOA 2KGIA 2YQMA 5TBNA 2FD4A 4BBQA 2YSMA 3O7AA 2CSVA 2VPDA 2ECWA 4CCGX 2CONA 4Z0RA 5FB1A 2CKLA 1BORA 2BAYA 4GNGA 4MVTA 4WZ3B 3LQHA 2KWNA 3N9NA 4LKAA 4GNEA 1WEMA 4LADB 3L1XA 2JMJA 2LQ6A 4YBSA 3U5MA 2LGVA 5H1TA 5H1UA 2LGGA 2KGGA 3O37A 5K3QA 5FB0A 3ZPV1 2JRJA 3LQJA 5B79A 3HCSA 2G43A 1LDKC 1Z6UA 2VPBA 1WEEA 1HYJA 2KWJA 1WEWA 2C2VS 4I7DA 2XB1A 3LRQA 1VFYA 2QJ0A 3LVRE 4AYCB 2ECGA 2CRRA 5FEYA 2NAAA 3ZYQA 3O33A 5SVIA 2LXPC
chains in the Genus database with same CATH topology
1WFKA 1V87A 3VK6A 1LDJB 1N87A 2IDAA 2KIZA 2VPGA 4A4BA 1G25A 2LXHC 5B8DA 2YUCA 5B77A 1Z2QA 2F6JA 1F62A 1VYXA 2VNFA 3MHSA 4N3WA 4I7BA 3N9QA 2VPEA 3SOWA 3V43A 3KQIA 4B86C 3O35A 4AP4A 2QIZA 5I3LA 3M62A 1WEUA 4A49A 3U5PA 4UP5A 1X4IA 5AIUA 2MA6A 4FO9A 4V3LC 1WE9A 5B75A 2MD7B 3ZVYA 2LGKA 2FUUA 2Y1MA 4LK9A 2XEUA 2EGPA 1HYIA 2OXQC 5LKUA 2CKLB 4R2YA 3ZNIA 3DQVR 2HYED 3MHHA 4FK5A 4GB0A 2ECJA 2CT2A 4IC2A 5D1KB 5DKAA 2KYUA 2EODA 2L75A 2K16A 1MM3A 2M3HA 5H9MA 1WENA 3I2DA 2MUMA 3O34A 4YADA 3SHBA 2KWKA 4XI1A 3HCUA 2L0BA 4YAXA 2D8SA 5TABA 2C2LA 2VJFB 2ECNA 5B76A 2KE1A 5TDRA 4O64A 2YHOA 2RI7A 3SOUA 4PPEA 4S3OB 3LQIA 3L1ZB 3C5KA 2K17A 4ZDTA 3RPGB 3RTRB 4UI9B 2LGLA 5KH3A 3M63A 5LKZA 5KH9A 4A4CA 4ZUXU 1X4UA 2G6QA 1ZBDB 2YW8A 1WEPA 3PHDA 2KR4A 2ECIA 2H0DA 1MM2A 4UP0A 5DINA 3N9PA 2YT5A 4Q6FA 3KV5A 5D1MB 4WZ0A 2LN0A 2L80A 3T6RA 3PUQA 5FERA 2UZGA 2VJEA 5G0FA 2E6SA 1XWHA 2Y43A 4B7YC 4N4FA 4R7EA 4F52B 1IYMA 4BHWA 3U5NA 2KFTA 2KWOA 2LRIC 3N9OA 1VD4A 1X4JA 4QF2A 4W4UA 2F6NA 4WZ2A 2YYRA 2PNXA 4YATA 1JM7A 4GNFA 2MIQA 2HDPA 4L58A 3SOXA 4YBMA 1E4UA 2YU4A 2YSJA 3FL2A 5LCWB 4C9ZA 5TRBA 2CSZA 3EB5A 2L5UA 4YC9A 5J3XA 4YABA 2LDRA 1WILA 2KREA 4NN2A 2MNZA 4ZQLA 5D1LB 1FBVA 3ASLA 5LKXA 2K4DA 4TKPB 3HTKC 3M99A 1K2FA 5C13A 4X3GA 2DX8A 5LKTA 4PTBA 3QZVA 3T7LA 4R8PK 2M6MA 4IC3A 4WA6A 4FIPA 2ECTA 4LJNA 5G04B 2F42A 5EYAF 3EB6A 1U6GB 2M1RA 1WESA 3KNVA 2YQLA 4P5OB 3GL6A 1Z60A 3N9LA 2MT5A 3O36A 2ECVA 2Y1NA 2H0DB 2PUYA 2VJFA 4MSXA 4AYCA 2L43A 5AITA 3N9MA 5JG6A 1WEVA 2CSYA 1WIMA 4QF3A 1RMDA 2MA5A 3U5OA 2I50A 4AVXA 2JMDA 2LV9A 4AUQB 5KH7A 1FP0A 3O70A 3C6WA 2KU3A 2G45A 4L7XA 2VJEB 3GV4A 5TDWA 3DPLR 2AN6A 5B78A 1T1HA 3PURA 1WEQA 5C11A 2MD8C 2RSDA 1CHCA 2QICA 4LLBA 2M85A 3KV6A 2EA6A 2ZETC 3IHPA 2FUIA 2JMIA 3ZPVE 3ZVZB 2MNYA 4S3OC 1WGMA 2K1JA 4CA1A 4V3KC 1JM7B 2YREA 5H1VA 1DVPA 3NG2A 2VP7A 3RPGC 2YHNA 5G05B 3HCTA 2FSAA 4I7CA 1JOCA 3L11A 4FJCA 3ZTGA 4GNDA 4YBTA 2E6RA 2YURA 4A0CD 1WEOA 2KGIA 2YQMA 5TBNA 4BBQA 2YSMA 3O7AA 2VPDA 2ECWA 4CCGX 5FB1A 2CKLA 1BORA 2BAYA 4GNGA 4MVTA 4WZ3B 3LQHA 2KWNA 3N9NA 4LKAA 4GNEA 1WEMA 4LADB 3L1XA 2JMJA 2LQ6A 4YBSA 3U5MA 2LGVA 5H1TA 5H1UA 2LGGA 2KGGA 3O37A 5FB0A 3ZPV1 2JRJA 3LQJA 5B79A 3HCSA 2G43A 1LDKC 1Z6UA 2VPBA 1WEEA 1HYJA 2KWJA 1WEWA 2C2VS 4I7DA 2XB1A 3LRQA 1VFYA 2QJ0A 4AYCB 2ECGA 5FEYA 2NAAA 3ZYQA 3O33A 2LXPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFK A;  1V87 A;  3VK6 A;  1LDJ B;  1N87 A;  2IDA A;  2KIZ A;  2VPG A;  4A4B A;  1G25 A;  2LXH C;  5B8D A;  2YUC A;  5B77 A;  1Z2Q A;  2F6J A;  1F62 A;  1VYX A;  2VNF A;  3MHS A;  4N3W A;  4I7B A;  3N9Q A;  2VPE A;  3SOW A;  3V43 A;  3KQI A;  4B86 C;  3O35 A;  4AP4 A;  2QIZ A;  5I3L A;  3M62 A;  1WEU A;  4A49 A;  3U5P A;  4UP5 A;  1X4I A;  5AIU A;  2MA6 A;  4FO9 A;  4V3L C;  1WE9 A;  5B75 A;  2MD7 B;  3ZVY A;  2LGK A;  2FUU A;  2Y1M A;  4LK9 A;  2XEU A;  2EGP A;  1HYI A;  2OXQ C;  5LKU A;  2CKL B;  4R2Y A;  3ZNI A;  3DQV R;  2HYE D;  3MHH A;  4FK5 A;  4GB0 A;  2ECJ A;  2CT2 A;  4IC2 A;  5D1K B;  5DKA A;  2KYU A;  2EOD A;  2L75 A;  2K16 A;  1MM3 A;  2M3H A;  5H9M A;  1WEN A;  3I2D A;  2MUM A;  3O34 A;  4YAD A;  3SHB A;  2KWK A;  4XI1 A;  3HCU A;  2L0B A;  4YAX A;  2D8S A;  5TAB A;  2C2L A;  2VJF B;  2ECN A;  5B76 A;  2KE1 A;  5TDR A;  4O64 A;  2YHO A;  2RI7 A;  3SOU A;  4PPE A;  4S3O B;  3LQI A;  3L1Z B;  3C5K A;  2K17 A;  4ZDT A;  3RPG B;  3RTR B;  4UI9 B;  2LGL A;  5KH3 A;  3M63 A;  5LKZ A;  5KH9 A;  4A4C A;  4ZUX U;  1X4U A;  2G6Q A;  1ZBD B;  2YW8 A;  1WEP A;  3PHD A;  2KR4 A;  2ECI A;  2H0D A;  1MM2 A;  4UP0 A;  5DIN A;  3N9P A;  2YT5 A;  4Q6F A;  3KV5 A;  5D1M B;  4WZ0 A;  2LN0 A;  2L80 A;  3T6R A;  3PUQ A;  5FER A;  2UZG A;  2VJE A;  5G0F A;  2E6S A;  1XWH A;  2Y43 A;  4B7Y C;  4N4F A;  4R7E A;  4F52 B;  1IYM A;  4BHW A;  3U5N A;  2KFT A;  2KWO A;  2LRI C;  3N9O A;  1VD4 A;  1X4J A;  4QF2 A;  4W4U A;  2F6N A;  4WZ2 A;  2YYR A;  2PNX A;  4YAT A;  1JM7 A;  4GNF A;  2MIQ A;  2HDP A;  4L58 A;  3SOX A;  4YBM A;  1E4U A;  2YU4 A;  2YSJ A;  3FL2 A;  5LCW B;  4C9Z A;  5TRB A;  2CSZ A;  3EB5 A;  2L5U A;  4YC9 A;  5J3X A;  4YAB A;  2LDR A;  1WIL A;  2KRE A;  4NN2 A;  2MNZ A;  4ZQL A;  5D1L B;  1FBV A;  3ASL A;  5LKX A;  2K4D A;  4TKP B;  3HTK C;  3M99 A;  1K2F A;  5C13 A;  4X3G A;  2DX8 A;  5LKT A;  4PTB A;  3QZV A;  3T7L A;  4R8P K;  2M6M A;  4IC3 A;  4WA6 A;  4FIP A;  2ECT A;  4LJN A;  5G04 B;  2F42 A;  5EYA F;  3EB6 A;  1U6G B;  2M1R A;  1WES A;  3KNV A;  2YQL A;  4P5O B;  3GL6 A;  1Z60 A;  3N9L A;  2MT5 A;  3O36 A;  2ECV A;  2Y1N A;  2H0D B;  2PUY A;  2VJF A;  4MSX A;  4AYC A;  2L43 A;  5AIT A;  3N9M A;  5JG6 A;  1WEV A;  2CSY A;  1WIM A;  4QF3 A;  1RMD A;  2MA5 A;  3U5O A;  2I50 A;  4AVX A;  2JMD A;  2LV9 A;  4AUQ B;  5KH7 A;  1FP0 A;  3O70 A;  3C6W A;  2KU3 A;  2G45 A;  4L7X A;  2VJE B;  3GV4 A;  5TDW A;  3DPL R;  2AN6 A;  5B78 A;  1T1H A;  3PUR A;  1WEQ A;  5C11 A;  2MD8 C;  2RSD A;  1CHC A;  2QIC A;  4LLB A;  2M85 A;  3KV6 A;  2EA6 A;  2ZET C;  3IHP A;  2FUI A;  2JMI A;  3ZPV E;  3ZVZ B;  2MNY A;  4S3O C;  1WGM A;  2K1J A;  4CA1 A;  4V3K C;  1JM7 B;  2YRE A;  5H1V A;  1DVP A;  3NG2 A;  2VP7 A;  3RPG C;  2YHN A;  5G05 B;  3HCT A;  2FSA A;  4I7C A;  1JOC A;  3L11 A;  4FJC A;  3ZTG A;  4GND A;  4YBT A;  2E6R A;  2YUR A;  4A0C D;  1WEO A;  2KGI A;  2YQM A;  5TBN A;  4BBQ A;  2YSM A;  3O7A A;  2VPD A;  2ECW A;  4CCG X;  5FB1 A;  2CKL A;  1BOR A;  2BAY A;  4GNG A;  4MVT A;  4WZ3 B;  3LQH A;  2KWN A;  3N9N A;  4LKA A;  4GNE A;  1WEM A;  4LAD B;  3L1X A;  2JMJ A;  2LQ6 A;  4YBS A;  3U5M A;  2LGV A;  5H1T A;  5H1U A;  2LGG A;  2KGG A;  3O37 A;  5FB0 A;  3ZPV 1;  2JRJ A;  3LQJ A;  5B79 A;  3HCS A;  2G43 A;  1LDK C;  1Z6U A;  2VPB A;  1WEE A;  1HYJ A;  2KWJ A;  1WEW A;  2C2V S;  4I7D A;  2XB1 A;  3LRQ A;  1VFY A;  2QJ0 A;  4AYC B;  2ECG A;  5FEY A;  2NAA A;  3ZYQ A;  3O33 A;  2LXP C; 
#chains in the Genus database with same CATH topology
 1WFK A;  1V87 A;  3VK6 A;  1LDJ B;  1N87 A;  4F1P A;  2IDA A;  2KIZ A;  2VPG A;  4A4B A;  1G25 A;  2LXH C;  5B8D A;  2YUC A;  5B77 A;  1Z2Q A;  2F6J A;  1F62 A;  1VYX A;  2VNF A;  3MHS A;  4N3W A;  4I7B A;  3N9Q A;  2VPE A;  3SOW A;  3V43 A;  3KQI A;  4B86 C;  2RR4 A;  3O35 A;  4AP4 A;  2QIZ A;  3DDT A;  5I3L A;  3M62 A;  1WEU A;  4A49 A;  3U5P A;  4UP5 A;  1X4I A;  5AIU A;  2MA6 A;  4FO9 A;  4V3L C;  1WE9 A;  5B75 A;  2MD7 B;  3SUB A;  3ZVY A;  2LGK A;  2FUU A;  2Y1M A;  4LK9 A;  2XEU A;  2EGP A;  1HYI A;  2LAU A;  2OXQ C;  5LKU A;  2CKL B;  4R2Y A;  3ZNI A;  3DQV R;  2HYE D;  3MHH A;  4FK5 A;  4GB0 A;  2ECJ A;  2CT2 A;  3M7K A;  4IC2 A;  5D1K B;  2KKY A;  2EXU A;  2XOY A;  5DKA A;  2KYU A;  2EOD A;  2L75 A;  3DWD A;  2K16 A;  1MM3 A;  2M3H A;  5H9M A;  3KDE C;  1WEN A;  3I2D A;  3FAO A;  5SVX A;  2MUM A;  3O34 A;  4YAD A;  2D8U A;  3SHB A;  2KWK A;  4XI1 A;  3HCU A;  2L0B A;  4YAX A;  2D8S A;  2DJA A;  5TAB A;  2C2L A;  3O47 A;  2VJF B;  5SVI B;  2ECN A;  5B76 A;  2KE1 A;  5TDR A;  4O64 A;  2YHO A;  2RI7 A;  3SOU A;  4PPE A;  4S3O B;  3LQI A;  3L1Z B;  3FAN A;  2KKX A;  3C5K A;  2K17 A;  5SVY A;  4ZDT A;  3RPG B;  3RTR B;  4UI9 B;  2LGL A;  5KH3 A;  3M63 A;  5LKZ A;  5KH9 A;  4A4C A;  4ZUX U;  1X4U A;  2G6Q A;  1ZBD B;  2YW8 A;  3FM8 C;  1WEP A;  3PHD A;  2KR4 A;  2ECI A;  1MM2 A;  2H0D A;  4UP0 A;  5DIN A;  3N9P A;  2YT5 A;  4Q6F A;  2P57 A;  3KV5 A;  5D1M B;  4WZ0 A;  2LN0 A;  2L80 A;  3T6R A;  3PUQ A;  5FER A;  2UZG A;  2VJE A;  2XOC A;  5G0F A;  2E6S A;  1XWH A;  2Y43 A;  4B7Y C;  4N4F A;  4R7E A;  3MDB C;  4F52 B;  1IYM A;  4BHW A;  3U5N A;  2KFT A;  2KWO A;  2LRI C;  2IQJ A;  3N9O A;  1VD4 A;  1X4J A;  4QF2 A;  4W4U A;  2F6N A;  3LDY A;  4WZ2 A;  2YYR A;  2PNX A;  3Q1D A;  4YAT A;  1JM7 A;  4GNF A;  2MIQ A;  2HDP A;  4L58 A;  3SOX A;  4YBM A;  1E4U A;  2JM3 A;  2YU4 A;  2YSJ A;  3FL2 A;  5LCW B;  4C9Z A;  5TRB A;  2CSZ A;  3EB5 A;  2L5U A;  4YC9 A;  5J3X A;  4YAB A;  2LDR A;  1WIL A;  2KRE A;  4NN2 A;  2MNZ A;  4ZQL A;  5D1L B;  3T9K A;  1FBV A;  3ASL A;  5LKX A;  2K4D A;  4TKP B;  3HTK C;  3M99 A;  1MBM A;  2CRW A;  4OGC A;  1K2F A;  3LVQ E;  5C13 A;  4X3G A;  2DX8 A;  5LKT A;  4PTB A;  3QZV A;  4QQ4 A;  3T7L A;  4R8P K;  2M6M A;  4IC3 A;  4WA6 A;  4FIP A;  2ECT A;  4LJN A;  4O62 A;  4OGE A;  5G04 B;  2F42 A;  5EYA F;  3EB6 A;  1U6G B;  2M1R A;  1WES A;  3H7H A;  3KNV A;  2YVR A;  2YQL A;  4P5O B;  3GL6 A;  2M13 A;  2XP0 A;  1Z60 A;  3N9L A;  3E2D A;  2MT5 A;  3O36 A;  2ECV A;  2Y1N A;  2H0D B;  2PUY A;  2VJF A;  4MSX A;  4AYC A;  2L43 A;  5AIT A;  3N9M A;  5JG6 A;  1WEV A;  2CSY A;  1WIM A;  4QF3 A;  1RMD A;  2MA5 A;  3U5O A;  2I50 A;  4AVX A;  2DSM A;  2JMD A;  2LV9 A;  4AUQ B;  5KH7 A;  1FP0 A;  3O70 A;  3C6W A;  3JUE A;  2L7P A;  2KU3 A;  2B0O E;  2G45 A;  4L7X A;  2VJE B;  3GV4 A;  2JUN A;  2XOZ A;  5TDW A;  3DPL R;  2AN6 A;  5B78 A;  2FFW A;  4H9D A;  1T1H A;  3PUR A;  1WEQ A;  5C11 A;  2MD8 C;  2RSD A;  1CHC A;  2QIC A;  4LLB A;  2M85 A;  3KV6 A;  2EA6 A;  2ZET C;  3IHP A;  2FUI A;  2JMI A;  3ZPV E;  3ZVZ B;  3PLW A;  2MNY A;  4S3O C;  3FJU B;  1DCQ A;  1WGM A;  2K1J A;  4CA1 A;  4V3K C;  1JM7 B;  2YRE A;  5H1V A;  1DVP A;  2MKE A;  2VP7 A;  3NG2 A;  3RPG C;  2E61 A;  2YHN A;  5G05 B;  3HCT A;  4Z0O A;  2FSA A;  4I7C A;  3FEH A;  1JOC A;  3L11 A;  2OWA A;  4FJC A;  3ZTG A;  4GND A;  4YBT A;  2E6R A;  2YUR A;  4A0C D;  2EGM A;  3LJU X;  1WEO A;  2KGI A;  2YQM A;  5TBN A;  2FD4 A;  4BBQ A;  2YSM A;  3O7A A;  2CSV A;  2VPD A;  2ECW A;  4CCG X;  2CON A;  4Z0R A;  5FB1 A;  2CKL A;  1BOR A;  2BAY A;  4GNG A;  4MVT A;  4WZ3 B;  3LQH A;  2KWN A;  3N9N A;  4LKA A;  4GNE A;  1WEM A;  4LAD B;  3L1X A;  2JMJ A;  2LQ6 A;  4YBS A;  3U5M A;  2LGV A;  5H1T A;  5H1U A;  2LGG A;  2KGG A;  3O37 A;  5K3Q A;  5FB0 A;  3ZPV 1;  2JRJ A;  3LQJ A;  5B79 A;  3HCS A;  2G43 A;  1LDK C;  1Z6U A;  2VPB A;  1WEE A;  1HYJ A;  2KWJ A;  1WEW A;  2C2V S;  4I7D A;  2XB1 A;  3LRQ A;  1VFY A;  2QJ0 A;  3LVR E;  4AYC B;  2ECG A;  2CRR A;  5FEY A;  2NAA A;  3ZYQ A;  3O33 A;  5SVI A;  2LXP C; 
#chains in the Genus database with same CATH homology
 1WFK A;  1V87 A;  3VK6 A;  1LDJ B;  1N87 A;  2IDA A;  2KIZ A;  2VPG A;  4A4B A;  1G25 A;  2LXH C;  5B8D A;  2YUC A;  5B77 A;  1Z2Q A;  2F6J A;  1F62 A;  1VYX A;  2VNF A;  3MHS A;  4N3W A;  4I7B A;  3N9Q A;  2VPE A;  3SOW A;  3V43 A;  3KQI A;  4B86 C;  3O35 A;  4AP4 A;  2QIZ A;  5I3L A;  3M62 A;  1WEU A;  4A49 A;  3U5P A;  4UP5 A;  1X4I A;  5AIU A;  2MA6 A;  4FO9 A;  4V3L C;  1WE9 A;  5B75 A;  2MD7 B;  3ZVY A;  2LGK A;  2FUU A;  2Y1M A;  4LK9 A;  2XEU A;  2EGP A;  1HYI A;  2OXQ C;  5LKU A;  2CKL B;  4R2Y A;  3ZNI A;  3DQV R;  2HYE D;  3MHH A;  4FK5 A;  4GB0 A;  2ECJ A;  2CT2 A;  4IC2 A;  5D1K B;  5DKA A;  2KYU A;  2EOD A;  2L75 A;  2K16 A;  1MM3 A;  2M3H A;  5H9M A;  1WEN A;  3I2D A;  2MUM A;  3O34 A;  4YAD A;  3SHB A;  2KWK A;  4XI1 A;  3HCU A;  2L0B A;  4YAX A;  2D8S A;  5TAB A;  2C2L A;  2VJF B;  2ECN A;  5B76 A;  2KE1 A;  5TDR A;  4O64 A;  2YHO A;  2RI7 A;  3SOU A;  4PPE A;  4S3O B;  3LQI A;  3L1Z B;  3C5K A;  2K17 A;  4ZDT A;  3RPG B;  3RTR B;  4UI9 B;  2LGL A;  5KH3 A;  3M63 A;  5LKZ A;  5KH9 A;  4A4C A;  4ZUX U;  1X4U A;  2G6Q A;  1ZBD B;  2YW8 A;  1WEP A;  3PHD A;  2KR4 A;  2ECI A;  2H0D A;  1MM2 A;  4UP0 A;  5DIN A;  3N9P A;  2YT5 A;  4Q6F A;  3KV5 A;  5D1M B;  4WZ0 A;  2LN0 A;  2L80 A;  3T6R A;  3PUQ A;  5FER A;  2UZG A;  2VJE A;  5G0F A;  2E6S A;  1XWH A;  2Y43 A;  4B7Y C;  4N4F A;  4R7E A;  4F52 B;  1IYM A;  4BHW A;  3U5N A;  2KFT A;  2KWO A;  2LRI C;  3N9O A;  1VD4 A;  1X4J A;  4QF2 A;  4W4U A;  2F6N A;  4WZ2 A;  2YYR A;  2PNX A;  4YAT A;  1JM7 A;  4GNF A;  2MIQ A;  2HDP A;  4L58 A;  3SOX A;  4YBM A;  1E4U A;  2YU4 A;  2YSJ A;  3FL2 A;  5LCW B;  4C9Z A;  5TRB A;  2CSZ A;  3EB5 A;  2L5U A;  4YC9 A;  5J3X A;  4YAB A;  2LDR A;  1WIL A;  2KRE A;  4NN2 A;  2MNZ A;  4ZQL A;  5D1L B;  1FBV A;  3ASL A;  5LKX A;  2K4D A;  4TKP B;  3HTK C;  3M99 A;  1K2F A;  5C13 A;  4X3G A;  2DX8 A;  5LKT A;  4PTB A;  3QZV A;  3T7L A;  4R8P K;  2M6M A;  4IC3 A;  4WA6 A;  4FIP A;  2ECT A;  4LJN A;  5G04 B;  2F42 A;  5EYA F;  3EB6 A;  1U6G B;  2M1R A;  1WES A;  3KNV A;  2YQL A;  4P5O B;  3GL6 A;  1Z60 A;  3N9L A;  2MT5 A;  3O36 A;  2ECV A;  2Y1N A;  2H0D B;  2PUY A;  2VJF A;  4MSX A;  4AYC A;  2L43 A;  5AIT A;  3N9M A;  5JG6 A;  1WEV A;  2CSY A;  1WIM A;  4QF3 A;  1RMD A;  2MA5 A;  3U5O A;  2I50 A;  4AVX A;  2JMD A;  2LV9 A;  4AUQ B;  5KH7 A;  1FP0 A;  3O70 A;  3C6W A;  2KU3 A;  2G45 A;  4L7X A;  2VJE B;  3GV4 A;  5TDW A;  3DPL R;  2AN6 A;  5B78 A;  1T1H A;  3PUR A;  1WEQ A;  5C11 A;  2MD8 C;  2RSD A;  1CHC A;  2QIC A;  4LLB A;  2M85 A;  3KV6 A;  2EA6 A;  2ZET C;  3IHP A;  2FUI A;  2JMI A;  3ZPV E;  3ZVZ B;  2MNY A;  4S3O C;  1WGM A;  2K1J A;  4CA1 A;  4V3K C;  1JM7 B;  2YRE A;  5H1V A;  1DVP A;  3NG2 A;  2VP7 A;  3RPG C;  2YHN A;  5G05 B;  3HCT A;  2FSA A;  4I7C A;  1JOC A;  3L11 A;  4FJC A;  3ZTG A;  4GND A;  4YBT A;  2E6R A;  2YUR A;  4A0C D;  1WEO A;  2KGI A;  2YQM A;  5TBN A;  4BBQ A;  2YSM A;  3O7A A;  2VPD A;  2ECW A;  4CCG X;  5FB1 A;  2CKL A;  1BOR A;  2BAY A;  4GNG A;  4MVT A;  4WZ3 B;  3LQH A;  2KWN A;  3N9N A;  4LKA A;  4GNE A;  1WEM A;  4LAD B;  3L1X A;  2JMJ A;  2LQ6 A;  4YBS A;  3U5M A;  2LGV A;  5H1T A;  5H1U A;  2LGG A;  2KGG A;  3O37 A;  5FB0 A;  3ZPV 1;  2JRJ A;  3LQJ A;  5B79 A;  3HCS A;  2G43 A;  1LDK C;  1Z6U A;  2VPB A;  1WEE A;  1HYJ A;  2KWJ A;  1WEW A;  2C2V S;  4I7D A;  2XB1 A;  3LRQ A;  1VFY A;  2QJ0 A;  4AYC B;  2ECG A;  5FEY A;  2NAA A;  3ZYQ A;  3O33 A;  2LXP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...