2HYED

Crystal structure of the ddb1-cul4a-rbx1-sv5v complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords DNA damage-binding protein 1
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hyeD00
3N9MA 4A4BA 2E6SA 3RPGB 3ZVYA 4A49A 2L0BA 2CKLB 1E4UA 5DKAA 2QIZA 4B7YC 4A0CD 4AUQB 1Z6UA 5AITA 2KREA 1WFKA 2KU3A 3I2DA 4IC2A 4NN2A 2ECTA 3T7LA 5LKUA 2YREA 4FJCA 4I7CA 1HYIA 4R2YA 4S3OB 2JRJA 2H0DA 5TABA 4YBSA 2VJFA 2LQ6A 3M62A 2JMDA 3ASLA 2F6NA 2K16A 2CKLA 2K17A 1WILA 3LQHA 1F62A 2YQMA 4UP5A 4O64A 3PURA 2C2VS 4B86C 4GB0A 1CHCA 5LKZA 3SHBA 3M63A 3KQIA 4L7XA 4AP4A 2G43A 3RPGC 4ZUXU 2YURA 2VP7A 1HYJA 1WIMA 4I7BA 3KV5A 2VPBA 2MD7B 5AIUA 3ZTGA 1K2FA 4L58A 4GNFA 5H1VA 5LKXA 3ZPV1 4WZ3B 2LRIC 2LGKA 5J3XA 3U5OA 3MHSA 1WEPA 1LDKC 2XB1A 1WE9A 1X4UA 2YW8A 3O70A 3M99A 2H0DB 5G05B 4GNEA 2L75A 1XWHA 4V3LC 3NG2A 2KWKA 2Y1NA 3U5PA 2LXHC 1WENA 2F6JA 4LADB 2L5UA 5I3LA 3LQIA 1WGMA 2LGGA 3N9LA 5KH9A 4LK9A 3O35A 5LCWB 2ECIA 5D1KB 5EYAF 2CSZA 1WEWA 2ECVA 2MUMA 2BAYA 1WEUA 2Y43A 3KV6A 4I7DA 4IC3A 1VD4A 1FP0A 2D8SA 3SOUA 4FO9A 1WEMA 2RSDA 2YT5A 5B79A 2YU4A 2L80A 4WZ0A 1LDJB 5H9MA 4UI9B 2DX8A 3HCUA 5FB1A 1WEOA 2UZGA 2OXQC 3PHDA 3HCTA 3ZPVE 4YABA 4CA1A 3VK6A 5B78A 2Y1MA 1V87A 2M6MA 2KWOA 4W4UA 2EA6A 5B76A 1FBVA 2KFTA 3N9OA 3RTRB 2MA5A 5C13A 4PPEA 2ECWA 5D1MB 5B75A 4BBQA 1N87A 2I50A 3O33A 2PUYA 4YADA 2F42A 3LRQA 2CSYA 1RMDA 4P5OB 1ZBDB 2NAAA 1X4JA 3PUQA 2VPEA 3DQVR 1MM2A 3LQJA 5TBNA 2MNYA 4V3KC 2JMJA 3L1ZB 4XI1A 3GL6A 1WEQA 2ZETC 4LKAA 3L11A 4YBTA 4LJNA 2M1RA 1VYXA 3N9NA 5LKTA 3ZNIA 2VPGA 5FEYA 2VPDA 4F52B 3C6WA 3N9QA 5H1UA 4YBMA 4FK5A 2G45A 3EB5A 3T6RA 2HYED 5G0FA 2MT5A 2KE1A 4FIPA 2FUIA 1JOCA 5C11A 1T1HA 3DPLR 4QF2A 4AYCB 2YHNA 4PTBA 1X4IA 1BORA 4YATA 4A4CA 1U6GB 2KGGA 2KWNA 4X3GA 2VJEB 1DVPA 3O7AA 2E6RA 4WZ2A 2YSJA 1WEEA 2CT2A 4MSXA 5B77A 2ECGA 3U5MA 4ZQLA 2M85A 5KH3A 5D1LB 3GV4A 2YSMA 2LN0A 2MIQA 3IHPA 3O37A 3U5NA 2L43A 3HCSA 5TRBA 1VFYA 4GNGA 4YC9A 5TDRA 5TDWA 2MD8C 2LGLA 2FSAA 3C5KA 2KWJA 5FERA 4BHWA 2VJEA 1Z2QA 4AVXA 4QF3A 2VNFA 2KGIA 2K1JA 4N4FA 4YAXA 4AYCA 2YQLA 2PNXA 4Q6FA 4ZDTA 1WEVA 1JM7A 3ZYQA 5JG6A 4MVTA 4N3WA 4R8PK 2EGPA 2XEUA 3O34A 2MA6A 5KH7A 2C2LA 2LXPC 2FUUA 3ZVZB 4TKPB 2ECNA 3V43A 1MM3A 3KNVA 3SOXA 4WA6A 2YHOA 3EB6A 3SOWA 5H1TA 2JMIA 2KIZA 3L1XA 2EODA 4S3OC 3MHHA 3HTKC 4CCGX 2AN6A 1JM7B 1G25A 4UP0A 2YUCA 2LV9A 2G6QA 4LLBA 2YYRA 1Z60A 2KR4A 2LGVA 2M3HA 1IYMA 2RI7A 2IDAA 3N9PA 2QICA 2K4DA 4C9ZA 2VJFB 4R7EA 5B8DA 3O36A 2KYUA 1WESA 5FB0A 2QJ0A 5DINA 2HDPA 4GNDA 3FL2A 2MNZA 2ECJA 2LDRA 5G04B 3QZVA
chains in the Genus database with same CATH superfamily
3N9MA 4A4BA 2E6SA 3RPGB 3ZVYA 4A49A 2L0BA 2M13A 2CKLB 1E4UA 5DKAA 2QIZA 4B7YC 4A0CD 4AUQB 1Z6UA 5AITA 2KREA 1WFKA 2KU3A 3I2DA 4IC2A 1MBMA 4NN2A 2ECTA 3T7LA 5LKUA 2YREA 4FJCA 4I7CA 1HYIA 3FJUB 4R2YA 4S3OB 2JRJA 2H0DA 2CRWA 5TABA 3LJUX 4YBSA 2JUNA 2VJFA 2LQ6A 3M62A 2JMDA 2DJAA 3ASLA 2F6NA 2K16A 3MDBC 2CKLA 2K17A 4OGEA 1WILA 3LQHA 1F62A 2EGMA 2YQMA 4UP5A 4O64A 3PURA 2C2VS 2DSMA 4B86C 4GB0A 1CHCA 3E2DA 5LKZA 3SHBA 3M63A 3KQIA 4L7XA 4AP4A 2G43A 2B0OE 3RPGC 4ZUXU 2YURA 2VP7A 1HYJA 1WIMA 4I7BA 3T9KA 3KV5A 2VPBA 2MD7B 5AIUA 3ZTGA 1K2FA 4L58A 4GNFA 5H1VA 5LKXA 3ZPV1 4WZ3B 5SVIB 2LRIC 2LGKA 5J3XA 3U5OA 3MHSA 1WEPA 1LDKC 2XB1A 1WE9A 3SUBA 1X4UA 2YW8A 3O70A 3M99A 2H0DB 5G05B 4H9DA 4GNEA 2L75A 1XWHA 2FFWA 4V3LC 3NG2A 2KWKA 2Y1NA 3U5PA 2LXHC 1WENA 2F6JA 4LADB 2L5UA 5I3LA 3LQIA 1WGMA 2LGGA 3N9LA 2L7PA 5KH9A 4LK9A 2KKXA 3O35A 2EXUA 5LCWB 2ECIA 5D1KB 3O47A 5EYAF 2CSZA 1WEWA 2ECVA 2MUMA 2BAYA 1WEUA 2Y43A 3KV6A 4I7DA 4IC3A 3KDEC 1VD4A 1FP0A 2D8SA 3SOUA 4FO9A 1WEMA 2RSDA 2YT5A 5B79A 3JUEA 2YU4A 2L80A 4WZ0A 1LDJB 5H9MA 4UI9B 2DX8A 3HCUA 5FB1A 1WEOA 4O62A 2UZGA 4Z0OA 2OXQC 3PHDA 3HCTA 3ZPVE 4YABA 4CA1A 3VK6A 2D8UA 5B78A 2Y1MA 2P57A 1V87A 2M6MA 2KWOA 4W4UA 2EA6A 3LVQE 5B76A 1FBVA 2KFTA 3N9OA 3RTRB 2MA5A 5C13A 4PPEA 2ECWA 5D1MB 2E61A 5B75A 4BBQA 1N87A 2I50A 3O33A 2PUYA 4YADA 2XOZA 2F42A 3LRQA 2CSYA 1RMDA 4P5OB 1ZBDB 3FEHA 2NAAA 1X4JA 3PUQA 2VPEA 3DQVR 1MM2A 3LQJA 5TBNA 5SVIA 3PLWA 2MNYA 3DWDA 4V3KC 2JMJA 3L1ZB 4XI1A 3GL6A 1WEQA 2ZETC 4LKAA 3L11A 4YBTA 4LJNA 2M1RA 1VYXA 3N9NA 5LKTA 2CSVA 3ZNIA 2VPGA 5FEYA 2VPDA 4F52B 3C6WA 3N9QA 5H1UA 4YBMA 4FK5A 4Z0RA 2G45A 3EB5A 3T6RA 2HYED 5G0FA 2MT5A 2KE1A 4FIPA 2FUIA 1JOCA 5C11A 1T1HA 3DPLR 4QF2A 4AYCB 2YHNA 4PTBA 1X4IA 1BORA 4YATA 5SVXA 4A4CA 1U6GB 2KGGA 2KWNA 4X3GA 2VJEB 1DVPA 3O7AA 2YVRA 3DDTA 4QQ4A 2E6RA 4WZ2A 4F1PA 2YSJA 1WEEA 2CT2A 4MSXA 5B77A 2ECGA 3U5MA 4ZQLA 2M85A 3H7HA 5KH3A 2XOCA 5D1LB 3GV4A 2YSMA 2LN0A 2MIQA 3IHPA 3O37A 3U5NA 2L43A 2OWAA 3FANA 3HCSA 5TRBA 2CONA 1VFYA 4GNGA 4YC9A 3M7KA 5TDRA 5TDWA 2MD8C 2LGLA 2FSAA 3C5KA 2KWJA 5FERA 4BHWA 2VJEA 1Z2QA 4AVXA 4QF3A 2KKYA 2VNFA 2KGIA 2K1JA 4N4FA 4YAXA 4AYCA 2JM3A 5SVYA 2YQLA 2PNXA 3Q1DA 4Q6FA 4ZDTA 1WEVA 5K3QA 1JM7A 3ZYQA 5JG6A 4MVTA 4N3WA 4R8PK 2EGPA 2XEUA 3O34A 2MA6A 5KH7A 2CRRA 2C2LA 2LXPC 2FUUA 3ZVZB 4TKPB 2LAUA 2ECNA 2RR4A 3V43A 1MM3A 3LVRE 3KNVA 3SOXA 2IQJA 4WA6A 4OGCA 2YHOA 3EB6A 3SOWA 1DCQA 5H1TA 2JMIA 2KIZA 3L1XA 2EODA 4S3OC 3MHHA 3HTKC 4CCGX 2AN6A 1JM7B 1G25A 4UP0A 2YUCA 2LV9A 2G6QA 4LLBA 2YYRA 1Z60A 3FAOA 2XOYA 2KR4A 2LGVA 2M3HA 1IYMA 2RI7A 2IDAA 3N9PA 3LDYA 2QICA 2FD4A 2K4DA 4C9ZA 2VJFB 4R7EA 5B8DA 3O36A 3FM8C 2KYUA 1WESA 5FB0A 2QJ0A 2XP0A 5DINA 2HDPA 2MKEA 4GNDA 3FL2A 2MNZA 2ECJA 2LDRA 5G04B 3QZVA
chains in the Genus database with same CATH topology
3N9MA 4A4BA 2E6SA 3RPGB 3ZVYA 4A49A 2L0BA 2CKLB 1E4UA 5DKAA 2QIZA 4B7YC 4A0CD 4AUQB 1Z6UA 5AITA 2KREA 1WFKA 2KU3A 3I2DA 4IC2A 4NN2A 2ECTA 3T7LA 5LKUA 2YREA 4FJCA 4I7CA 1HYIA 4R2YA 4S3OB 2JRJA 2H0DA 5TABA 4YBSA 2VJFA 2LQ6A 3M62A 2JMDA 3ASLA 2F6NA 2K16A 2CKLA 2K17A 1WILA 3LQHA 1F62A 2YQMA 4UP5A 4O64A 3PURA 2C2VS 4B86C 4GB0A 1CHCA 5LKZA 3SHBA 3M63A 3KQIA 4L7XA 4AP4A 2G43A 3RPGC 4ZUXU 2YURA 2VP7A 1HYJA 1WIMA 4I7BA 3KV5A 2VPBA 2MD7B 5AIUA 3ZTGA 1K2FA 4L58A 4GNFA 5H1VA 5LKXA 3ZPV1 4WZ3B 2LRIC 2LGKA 5J3XA 3U5OA 3MHSA 1WEPA 1LDKC 2XB1A 1WE9A 1X4UA 2YW8A 3O70A 3M99A 2H0DB 5G05B 4GNEA 2L75A 1XWHA 4V3LC 3NG2A 2KWKA 2Y1NA 3U5PA 2LXHC 1WENA 2F6JA 4LADB 2L5UA 5I3LA 3LQIA 1WGMA 2LGGA 3N9LA 5KH9A 4LK9A 3O35A 5LCWB 2ECIA 5D1KB 5EYAF 2CSZA 1WEWA 2ECVA 2MUMA 2BAYA 1WEUA 2Y43A 3KV6A 4I7DA 4IC3A 1VD4A 1FP0A 2D8SA 3SOUA 4FO9A 1WEMA 2RSDA 2YT5A 5B79A 2YU4A 2L80A 4WZ0A 1LDJB 5H9MA 4UI9B 2DX8A 3HCUA 5FB1A 1WEOA 2UZGA 2OXQC 3PHDA 3HCTA 3ZPVE 4YABA 4CA1A 3VK6A 5B78A 2Y1MA 1V87A 2M6MA 2KWOA 4W4UA 2EA6A 5B76A 1FBVA 2KFTA 3N9OA 3RTRB 2MA5A 5C13A 4PPEA 2ECWA 5D1MB 5B75A 4BBQA 1N87A 2I50A 3O33A 2PUYA 4YADA 2F42A 3LRQA 2CSYA 1RMDA 4P5OB 1ZBDB 2NAAA 1X4JA 3PUQA 2VPEA 3DQVR 1MM2A 3LQJA 5TBNA 2MNYA 4V3KC 2JMJA 3L1ZB 4XI1A 3GL6A 1WEQA 2ZETC 4LKAA 3L11A 4YBTA 4LJNA 2M1RA 1VYXA 3N9NA 5LKTA 3ZNIA 2VPGA 5FEYA 2VPDA 4F52B 3C6WA 3N9QA 5H1UA 4YBMA 4FK5A 2G45A 3EB5A 3T6RA 2HYED 5G0FA 2MT5A 2KE1A 4FIPA 2FUIA 1JOCA 5C11A 1T1HA 3DPLR 4QF2A 4AYCB 2YHNA 4PTBA 1X4IA 1BORA 4YATA 4A4CA 1U6GB 2KGGA 2KWNA 4X3GA 2VJEB 1DVPA 3O7AA 2E6RA 4WZ2A 2YSJA 1WEEA 2CT2A 4MSXA 5B77A 2ECGA 3U5MA 4ZQLA 2M85A 5KH3A 5D1LB 3GV4A 2YSMA 2LN0A 2MIQA 3IHPA 3O37A 3U5NA 2L43A 3HCSA 5TRBA 1VFYA 4GNGA 4YC9A 5TDRA 5TDWA 2MD8C 2LGLA 2FSAA 3C5KA 2KWJA 5FERA 4BHWA 2VJEA 1Z2QA 4AVXA 4QF3A 2VNFA 2KGIA 2K1JA 4N4FA 4YAXA 4AYCA 2YQLA 2PNXA 4Q6FA 4ZDTA 1WEVA 1JM7A 3ZYQA 5JG6A 4MVTA 4N3WA 4R8PK 2EGPA 2XEUA 3O34A 2MA6A 5KH7A 2C2LA 2LXPC 2FUUA 3ZVZB 4TKPB 2ECNA 3V43A 1MM3A 3KNVA 3SOXA 4WA6A 2YHOA 3EB6A 3SOWA 5H1TA 2JMIA 2KIZA 3L1XA 2EODA 4S3OC 3MHHA 3HTKC 4CCGX 2AN6A 1JM7B 1G25A 4UP0A 2YUCA 2LV9A 2G6QA 4LLBA 2YYRA 1Z60A 2KR4A 2LGVA 2M3HA 1IYMA 2RI7A 2IDAA 3N9PA 2QICA 2K4DA 4C9ZA 2VJFB 4R7EA 5B8DA 3O36A 2KYUA 1WESA 5FB0A 2QJ0A 5DINA 2HDPA 4GNDA 3FL2A 2MNZA 2ECJA 2LDRA 5G04B 3QZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9M A;  4A4B A;  2E6S A;  3RPG B;  3ZVY A;  4A49 A;  2L0B A;  2CKL B;  1E4U A;  5DKA A;  2QIZ A;  4B7Y C;  4A0C D;  4AUQ B;  1Z6U A;  5AIT A;  2KRE A;  1WFK A;  2KU3 A;  3I2D A;  4IC2 A;  4NN2 A;  2ECT A;  3T7L A;  5LKU A;  2YRE A;  4FJC A;  4I7C A;  1HYI A;  4R2Y A;  4S3O B;  2JRJ A;  2H0D A;  5TAB A;  4YBS A;  2VJF A;  2LQ6 A;  3M62 A;  2JMD A;  3ASL A;  2F6N A;  2K16 A;  2CKL A;  2K17 A;  1WIL A;  3LQH A;  1F62 A;  2YQM A;  4UP5 A;  4O64 A;  3PUR A;  2C2V S;  4B86 C;  4GB0 A;  1CHC A;  5LKZ A;  3SHB A;  3M63 A;  3KQI A;  4L7X A;  4AP4 A;  2G43 A;  3RPG C;  4ZUX U;  2YUR A;  2VP7 A;  1HYJ A;  1WIM A;  4I7B A;  3KV5 A;  2VPB A;  2MD7 B;  5AIU A;  3ZTG A;  1K2F A;  4L58 A;  4GNF A;  5H1V A;  5LKX A;  3ZPV 1;  4WZ3 B;  2LRI C;  2LGK A;  5J3X A;  3U5O A;  3MHS A;  1WEP A;  1LDK C;  2XB1 A;  1WE9 A;  1X4U A;  2YW8 A;  3O70 A;  3M99 A;  2H0D B;  5G05 B;  4GNE A;  2L75 A;  1XWH A;  4V3L C;  3NG2 A;  2KWK A;  2Y1N A;  3U5P A;  2LXH C;  1WEN A;  2F6J A;  4LAD B;  2L5U A;  5I3L A;  3LQI A;  1WGM A;  2LGG A;  3N9L A;  5KH9 A;  4LK9 A;  3O35 A;  5LCW B;  2ECI A;  5D1K B;  5EYA F;  2CSZ A;  1WEW A;  2ECV A;  2MUM A;  2BAY A;  1WEU A;  2Y43 A;  3KV6 A;  4I7D A;  4IC3 A;  1VD4 A;  1FP0 A;  2D8S A;  3SOU A;  4FO9 A;  1WEM A;  2RSD A;  2YT5 A;  5B79 A;  2YU4 A;  2L80 A;  4WZ0 A;  1LDJ B;  5H9M A;  4UI9 B;  2DX8 A;  3HCU A;  5FB1 A;  1WEO A;  2UZG A;  2OXQ C;  3PHD A;  3HCT A;  3ZPV E;  4YAB A;  4CA1 A;  3VK6 A;  5B78 A;  2Y1M A;  1V87 A;  2M6M A;  2KWO A;  4W4U A;  2EA6 A;  5B76 A;  1FBV A;  2KFT A;  3N9O A;  3RTR B;  2MA5 A;  5C13 A;  4PPE A;  2ECW A;  5D1M B;  5B75 A;  4BBQ A;  1N87 A;  2I50 A;  3O33 A;  2PUY A;  4YAD A;  2F42 A;  3LRQ A;  2CSY A;  1RMD A;  4P5O B;  1ZBD B;  2NAA A;  1X4J A;  3PUQ A;  2VPE A;  3DQV R;  1MM2 A;  3LQJ A;  5TBN A;  2MNY A;  4V3K C;  2JMJ A;  3L1Z B;  4XI1 A;  3GL6 A;  1WEQ A;  2ZET C;  4LKA A;  3L11 A;  4YBT A;  4LJN A;  2M1R A;  1VYX A;  3N9N A;  5LKT A;  3ZNI A;  2VPG A;  5FEY A;  2VPD A;  4F52 B;  3C6W A;  3N9Q A;  5H1U A;  4YBM A;  4FK5 A;  2G45 A;  3EB5 A;  3T6R A;  2HYE D;  5G0F A;  2MT5 A;  2KE1 A;  4FIP A;  2FUI A;  1JOC A;  5C11 A;  1T1H A;  3DPL R;  4QF2 A;  4AYC B;  2YHN A;  4PTB A;  1X4I A;  1BOR A;  4YAT A;  4A4C A;  1U6G B;  2KGG A;  2KWN A;  4X3G A;  2VJE B;  1DVP A;  3O7A A;  2E6R A;  4WZ2 A;  2YSJ A;  1WEE A;  2CT2 A;  4MSX A;  5B77 A;  2ECG A;  3U5M A;  4ZQL A;  2M85 A;  5KH3 A;  5D1L B;  3GV4 A;  2YSM A;  2LN0 A;  2MIQ A;  3IHP A;  3O37 A;  3U5N A;  2L43 A;  3HCS A;  5TRB A;  1VFY A;  4GNG A;  4YC9 A;  5TDR A;  5TDW A;  2MD8 C;  2LGL A;  2FSA A;  3C5K A;  2KWJ A;  5FER A;  4BHW A;  2VJE A;  1Z2Q A;  4AVX A;  4QF3 A;  2VNF A;  2KGI A;  2K1J A;  4N4F A;  4YAX A;  4AYC A;  2YQL A;  2PNX A;  4Q6F A;  4ZDT A;  1WEV A;  1JM7 A;  3ZYQ A;  5JG6 A;  4MVT A;  4N3W A;  4R8P K;  2EGP A;  2XEU A;  3O34 A;  2MA6 A;  5KH7 A;  2C2L A;  2LXP C;  2FUU A;  3ZVZ B;  4TKP B;  2ECN A;  3V43 A;  1MM3 A;  3KNV A;  3SOX A;  4WA6 A;  2YHO A;  3EB6 A;  3SOW A;  5H1T A;  2JMI A;  2KIZ A;  3L1X A;  2EOD A;  4S3O C;  3MHH A;  3HTK C;  4CCG X;  2AN6 A;  1JM7 B;  1G25 A;  4UP0 A;  2YUC A;  2LV9 A;  2G6Q A;  4LLB A;  2YYR A;  1Z60 A;  2KR4 A;  2LGV A;  2M3H A;  1IYM A;  2RI7 A;  2IDA A;  3N9P A;  2QIC A;  2K4D A;  4C9Z A;  2VJF B;  4R7E A;  5B8D A;  3O36 A;  2KYU A;  1WES A;  5FB0 A;  2QJ0 A;  5DIN A;  2HDP A;  4GND A;  3FL2 A;  2MNZ A;  2ECJ A;  2LDR A;  5G04 B;  3QZV A; 
#chains in the Genus database with same CATH topology
 3N9M A;  4A4B A;  2E6S A;  3RPG B;  3ZVY A;  4A49 A;  2L0B A;  2M13 A;  2CKL B;  1E4U A;  5DKA A;  2QIZ A;  4B7Y C;  4A0C D;  4AUQ B;  1Z6U A;  5AIT A;  2KRE A;  1WFK A;  2KU3 A;  3I2D A;  4IC2 A;  1MBM A;  4NN2 A;  2ECT A;  3T7L A;  5LKU A;  2YRE A;  4FJC A;  4I7C A;  1HYI A;  3FJU B;  4R2Y A;  4S3O B;  2JRJ A;  2H0D A;  2CRW A;  5TAB A;  3LJU X;  4YBS A;  2JUN A;  2VJF A;  2LQ6 A;  3M62 A;  2JMD A;  2DJA A;  3ASL A;  2F6N A;  2K16 A;  3MDB C;  2CKL A;  2K17 A;  4OGE A;  1WIL A;  3LQH A;  1F62 A;  2EGM A;  2YQM A;  4UP5 A;  4O64 A;  3PUR A;  2C2V S;  2DSM A;  4B86 C;  4GB0 A;  1CHC A;  3E2D A;  5LKZ A;  3SHB A;  3M63 A;  3KQI A;  4L7X A;  4AP4 A;  2G43 A;  2B0O E;  3RPG C;  4ZUX U;  2YUR A;  2VP7 A;  1HYJ A;  1WIM A;  4I7B A;  3T9K A;  3KV5 A;  2VPB A;  2MD7 B;  5AIU A;  3ZTG A;  1K2F A;  4L58 A;  4GNF A;  5H1V A;  5LKX A;  3ZPV 1;  4WZ3 B;  5SVI B;  2LRI C;  2LGK A;  5J3X A;  3U5O A;  3MHS A;  1WEP A;  1LDK C;  2XB1 A;  1WE9 A;  3SUB A;  1X4U A;  2YW8 A;  3O70 A;  3M99 A;  2H0D B;  5G05 B;  4H9D A;  4GNE A;  2L75 A;  1XWH A;  2FFW A;  4V3L C;  3NG2 A;  2KWK A;  2Y1N A;  3U5P A;  2LXH C;  1WEN A;  2F6J A;  4LAD B;  2L5U A;  5I3L A;  3LQI A;  1WGM A;  2LGG A;  3N9L A;  2L7P A;  5KH9 A;  4LK9 A;  2KKX A;  3O35 A;  2EXU A;  5LCW B;  2ECI A;  5D1K B;  3O47 A;  5EYA F;  2CSZ A;  1WEW A;  2ECV A;  2MUM A;  2BAY A;  1WEU A;  2Y43 A;  3KV6 A;  4I7D A;  4IC3 A;  3KDE C;  1VD4 A;  1FP0 A;  2D8S A;  3SOU A;  4FO9 A;  1WEM A;  2RSD A;  2YT5 A;  5B79 A;  3JUE A;  2YU4 A;  2L80 A;  4WZ0 A;  1LDJ B;  5H9M A;  4UI9 B;  2DX8 A;  3HCU A;  5FB1 A;  1WEO A;  4O62 A;  2UZG A;  4Z0O A;  2OXQ C;  3PHD A;  3HCT A;  3ZPV E;  4YAB A;  4CA1 A;  3VK6 A;  2D8U A;  5B78 A;  2Y1M A;  2P57 A;  1V87 A;  2M6M A;  2KWO A;  4W4U A;  2EA6 A;  3LVQ E;  5B76 A;  1FBV A;  2KFT A;  3N9O A;  3RTR B;  2MA5 A;  5C13 A;  4PPE A;  2ECW A;  5D1M B;  2E61 A;  5B75 A;  4BBQ A;  1N87 A;  2I50 A;  3O33 A;  2PUY A;  4YAD A;  2XOZ A;  2F42 A;  3LRQ A;  2CSY A;  1RMD A;  4P5O B;  1ZBD B;  3FEH A;  2NAA A;  1X4J A;  3PUQ A;  2VPE A;  3DQV R;  1MM2 A;  3LQJ A;  5TBN A;  5SVI A;  3PLW A;  2MNY A;  3DWD A;  4V3K C;  2JMJ A;  3L1Z B;  4XI1 A;  3GL6 A;  1WEQ A;  2ZET C;  4LKA A;  3L11 A;  4YBT A;  4LJN A;  2M1R A;  1VYX A;  3N9N A;  5LKT A;  2CSV A;  3ZNI A;  2VPG A;  5FEY A;  2VPD A;  4F52 B;  3C6W A;  3N9Q A;  5H1U A;  4YBM A;  4FK5 A;  4Z0R A;  2G45 A;  3EB5 A;  3T6R A;  2HYE D;  5G0F A;  2MT5 A;  2KE1 A;  4FIP A;  2FUI A;  1JOC A;  5C11 A;  1T1H A;  3DPL R;  4QF2 A;  4AYC B;  2YHN A;  4PTB A;  1X4I A;  1BOR A;  4YAT A;  5SVX A;  4A4C A;  1U6G B;  2KGG A;  2KWN A;  4X3G A;  2VJE B;  1DVP A;  3O7A A;  2YVR A;  3DDT A;  4QQ4 A;  2E6R A;  4WZ2 A;  4F1P A;  2YSJ A;  1WEE A;  2CT2 A;  4MSX A;  5B77 A;  2ECG A;  3U5M A;  4ZQL A;  2M85 A;  3H7H A;  5KH3 A;  2XOC A;  5D1L B;  3GV4 A;  2YSM A;  2LN0 A;  2MIQ A;  3IHP A;  3O37 A;  3U5N A;  2L43 A;  2OWA A;  3FAN A;  3HCS A;  5TRB A;  2CON A;  1VFY A;  4GNG A;  4YC9 A;  3M7K A;  5TDR A;  5TDW A;  2MD8 C;  2LGL A;  2FSA A;  3C5K A;  2KWJ A;  5FER A;  4BHW A;  2VJE A;  1Z2Q A;  4AVX A;  4QF3 A;  2KKY A;  2VNF A;  2KGI A;  2K1J A;  4N4F A;  4YAX A;  4AYC A;  2JM3 A;  5SVY A;  2YQL A;  2PNX A;  3Q1D A;  4Q6F A;  4ZDT A;  1WEV A;  5K3Q A;  1JM7 A;  3ZYQ A;  5JG6 A;  4MVT A;  4N3W A;  4R8P K;  2EGP A;  2XEU A;  3O34 A;  2MA6 A;  5KH7 A;  2CRR A;  2C2L A;  2LXP C;  2FUU A;  3ZVZ B;  4TKP B;  2LAU A;  2ECN A;  2RR4 A;  3V43 A;  1MM3 A;  3LVR E;  3KNV A;  3SOX A;  2IQJ A;  4WA6 A;  4OGC A;  2YHO A;  3EB6 A;  3SOW A;  1DCQ A;  5H1T A;  2JMI A;  2KIZ A;  3L1X A;  2EOD A;  4S3O C;  3MHH A;  3HTK C;  4CCG X;  2AN6 A;  1JM7 B;  1G25 A;  4UP0 A;  2YUC A;  2LV9 A;  2G6Q A;  4LLB A;  2YYR A;  1Z60 A;  3FAO A;  2XOY A;  2KR4 A;  2LGV A;  2M3H A;  1IYM A;  2RI7 A;  2IDA A;  3N9P A;  3LDY A;  2QIC A;  2FD4 A;  2K4D A;  4C9Z A;  2VJF B;  4R7E A;  5B8D A;  3O36 A;  3FM8 C;  2KYU A;  1WES A;  5FB0 A;  2QJ0 A;  2XP0 A;  5DIN A;  2HDP A;  2MKE A;  4GND A;  3FL2 A;  2MNZ A;  2ECJ A;  2LDR A;  5G04 B;  3QZV A; 
#chains in the Genus database with same CATH homology
 3N9M A;  4A4B A;  2E6S A;  3RPG B;  3ZVY A;  4A49 A;  2L0B A;  2CKL B;  1E4U A;  5DKA A;  2QIZ A;  4B7Y C;  4A0C D;  4AUQ B;  1Z6U A;  5AIT A;  2KRE A;  1WFK A;  2KU3 A;  3I2D A;  4IC2 A;  4NN2 A;  2ECT A;  3T7L A;  5LKU A;  2YRE A;  4FJC A;  4I7C A;  1HYI A;  4R2Y A;  4S3O B;  2JRJ A;  2H0D A;  5TAB A;  4YBS A;  2VJF A;  2LQ6 A;  3M62 A;  2JMD A;  3ASL A;  2F6N A;  2K16 A;  2CKL A;  2K17 A;  1WIL A;  3LQH A;  1F62 A;  2YQM A;  4UP5 A;  4O64 A;  3PUR A;  2C2V S;  4B86 C;  4GB0 A;  1CHC A;  5LKZ A;  3SHB A;  3M63 A;  3KQI A;  4L7X A;  4AP4 A;  2G43 A;  3RPG C;  4ZUX U;  2YUR A;  2VP7 A;  1HYJ A;  1WIM A;  4I7B A;  3KV5 A;  2VPB A;  2MD7 B;  5AIU A;  3ZTG A;  1K2F A;  4L58 A;  4GNF A;  5H1V A;  5LKX A;  3ZPV 1;  4WZ3 B;  2LRI C;  2LGK A;  5J3X A;  3U5O A;  3MHS A;  1WEP A;  1LDK C;  2XB1 A;  1WE9 A;  1X4U A;  2YW8 A;  3O70 A;  3M99 A;  2H0D B;  5G05 B;  4GNE A;  2L75 A;  1XWH A;  4V3L C;  3NG2 A;  2KWK A;  2Y1N A;  3U5P A;  2LXH C;  1WEN A;  2F6J A;  4LAD B;  2L5U A;  5I3L A;  3LQI A;  1WGM A;  2LGG A;  3N9L A;  5KH9 A;  4LK9 A;  3O35 A;  5LCW B;  2ECI A;  5D1K B;  5EYA F;  2CSZ A;  1WEW A;  2ECV A;  2MUM A;  2BAY A;  1WEU A;  2Y43 A;  3KV6 A;  4I7D A;  4IC3 A;  1VD4 A;  1FP0 A;  2D8S A;  3SOU A;  4FO9 A;  1WEM A;  2RSD A;  2YT5 A;  5B79 A;  2YU4 A;  2L80 A;  4WZ0 A;  1LDJ B;  5H9M A;  4UI9 B;  2DX8 A;  3HCU A;  5FB1 A;  1WEO A;  2UZG A;  2OXQ C;  3PHD A;  3HCT A;  3ZPV E;  4YAB A;  4CA1 A;  3VK6 A;  5B78 A;  2Y1M A;  1V87 A;  2M6M A;  2KWO A;  4W4U A;  2EA6 A;  5B76 A;  1FBV A;  2KFT A;  3N9O A;  3RTR B;  2MA5 A;  5C13 A;  4PPE A;  2ECW A;  5D1M B;  5B75 A;  4BBQ A;  1N87 A;  2I50 A;  3O33 A;  2PUY A;  4YAD A;  2F42 A;  3LRQ A;  2CSY A;  1RMD A;  4P5O B;  1ZBD B;  2NAA A;  1X4J A;  3PUQ A;  2VPE A;  3DQV R;  1MM2 A;  3LQJ A;  5TBN A;  2MNY A;  4V3K C;  2JMJ A;  3L1Z B;  4XI1 A;  3GL6 A;  1WEQ A;  2ZET C;  4LKA A;  3L11 A;  4YBT A;  4LJN A;  2M1R A;  1VYX A;  3N9N A;  5LKT A;  3ZNI A;  2VPG A;  5FEY A;  2VPD A;  4F52 B;  3C6W A;  3N9Q A;  5H1U A;  4YBM A;  4FK5 A;  2G45 A;  3EB5 A;  3T6R A;  2HYE D;  5G0F A;  2MT5 A;  2KE1 A;  4FIP A;  2FUI A;  1JOC A;  5C11 A;  1T1H A;  3DPL R;  4QF2 A;  4AYC B;  2YHN A;  4PTB A;  1X4I A;  1BOR A;  4YAT A;  4A4C A;  1U6G B;  2KGG A;  2KWN A;  4X3G A;  2VJE B;  1DVP A;  3O7A A;  2E6R A;  4WZ2 A;  2YSJ A;  1WEE A;  2CT2 A;  4MSX A;  5B77 A;  2ECG A;  3U5M A;  4ZQL A;  2M85 A;  5KH3 A;  5D1L B;  3GV4 A;  2YSM A;  2LN0 A;  2MIQ A;  3IHP A;  3O37 A;  3U5N A;  2L43 A;  3HCS A;  5TRB A;  1VFY A;  4GNG A;  4YC9 A;  5TDR A;  5TDW A;  2MD8 C;  2LGL A;  2FSA A;  3C5K A;  2KWJ A;  5FER A;  4BHW A;  2VJE A;  1Z2Q A;  4AVX A;  4QF3 A;  2VNF A;  2KGI A;  2K1J A;  4N4F A;  4YAX A;  4AYC A;  2YQL A;  2PNX A;  4Q6F A;  4ZDT A;  1WEV A;  1JM7 A;  3ZYQ A;  5JG6 A;  4MVT A;  4N3W A;  4R8P K;  2EGP A;  2XEU A;  3O34 A;  2MA6 A;  5KH7 A;  2C2L A;  2LXP C;  2FUU A;  3ZVZ B;  4TKP B;  2ECN A;  3V43 A;  1MM3 A;  3KNV A;  3SOX A;  4WA6 A;  2YHO A;  3EB6 A;  3SOW A;  5H1T A;  2JMI A;  2KIZ A;  3L1X A;  2EOD A;  4S3O C;  3MHH A;  3HTK C;  4CCG X;  2AN6 A;  1JM7 B;  1G25 A;  4UP0 A;  2YUC A;  2LV9 A;  2G6Q A;  4LLB A;  2YYR A;  1Z60 A;  2KR4 A;  2LGV A;  2M3H A;  1IYM A;  2RI7 A;  2IDA A;  3N9P A;  2QIC A;  2K4D A;  4C9Z A;  2VJF B;  4R7E A;  5B8D A;  3O36 A;  2KYU A;  1WES A;  5FB0 A;  2QJ0 A;  5DIN A;  2HDP A;  4GND A;  3FL2 A;  2MNZ A;  2ECJ A;  2LDR A;  5G04 B;  3QZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...