2HYED

Crystal structure of the ddb1-cul4a-rbx1-sv5v complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
b'KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA damage-binding protein 1
publication title Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hyeD00
3M63A 5FB0A 2K4DA 2YT5A 2LXHC 3LQJA 1WESA 1WEMA 3RPGC 2G45A 2ECTA 2VPGA 4Q6FA 2VNFA 2HYED 5D1KB 5LKXA 2VJEA 2KWOA 4YAXA 2LGGA 5H1VA 1WILA 2FUIA 2UZGA 5I3LA 5KH9A 2YQMA 2H0DB 2IDAA 4FK5A 3T6RA 3ZYQA 5DKAA 2L43A 2MNZA 4PPEA 2F42A 1JM7A 1FBVA 3ZPV1 2C2LA 1LDKC 2VPBA 2VPEA 3GV4A 2XB1A 4FJCA 4A4CA 3HTKC 3MHHA 5D1LB 2KIZA 4BBQA 3KQIA 4CA1A 4YBSA 1BORA 5TRBA 2Y1MA 4YC9A 5H1UA 2ECWA 5B79A 4AVXA 5D1MB 4MSXA 4V3LC 2ECIA 2LDRA 1U6GB 2YUCA 2KREA 1WEPA 2C2VS 2CKLA 1WEQA 2M3HA 4L7XA 4FO9A 3SOXA 4UI9B 4QF3A 2YHOA 1MM3A 2KGIA 2LGKA 2YHNA 1WEUA 3NG2A 3N9MA 2MIQA 2ZETC 4GNGA 1E4UA 2LQ6A 2FSAA 2MNYA 4I7CA 4A0CD 5B75A 4I7DA 2YYRA 2MT5A 5TDWA 1WGMA 3O34A 2JMDA 1WFKA 2M6MA 3I2DA 4LJNA 2DX8A 3L1ZB 2K1JA 2LRIC 4F52B 5FB1A 5KH3A 2VJFB 2PNXA 3EB6A 1DVPA 3PURA 1HYJA 5B8DA 4AYCA 1N87A 4YABA 2CSYA 5G05B 4PTBA 4IC3A 3FL2A 4UP0A 2L80A 2CT2A 4A49A 3RPGB 5LKUA 3ZTGA 5G04B 2KFTA 3HCTA 2JRJA 1CHCA 4TKPB 3ASLA 3KNVA 4UP5A 2QICA 5TBNA 2LV9A 2ECGA 2D8SA 2M85A 4B86C 5J3XA 2E6RA 3O36A 3QZVA 4S3OB 1MM2A 3O37A 4WZ0A 1VYXA 2KWKA 4B7YC 5LCWB 3GL6A 3O7AA 4WZ3B 5C11A 3RTRB 2HDPA 4LKAA 4YBTA 1X4IA 3ZVZB 2MD7B 3IHPA 2Y1NA 2QIZA 4NN2A 4GNFA 3L11A 3HCUA 1VFYA 3N9PA 3PHDA 4YATA 2EA6A 2LGLA 2YU4A 3O33A 5JG6A 3T7LA 2G6QA 1X4UA 2YW8A 5FEYA 1LDJB 2YQLA 2ECJA 1WEEA 1WIMA 1F62A 2VP7A 4N4FA 1WEVA 4C9ZA 1IYMA 1X4JA 3N9LA 5TDRA 3ZVYA 4YBMA 3SHBA 3ZPVE 4LK9A 5C13A 3U5NA 4V3KC 4I7BA 5H1TA 3DQVR 3U5OA 1V87A 4A4BA 2MA6A 5LKZA 2MUMA 2NAAA 4L58A 5EYAF 4WA6A 5AITA 4IC2A 2JMJA 2VPDA 1WEOA 1WE9A 2KE1A 4ZUXU 3C6WA 2KYUA 2K16A 2VJEB 3U5PA 4LADB 3LQIA 2YREA 2ECNA 4CCGX 1WEWA 1FP0A 1XWHA 4GNDA 3N9NA 2EGPA 2KGGA 3O70A 4N3WA 2RSDA 1VD4A 2VJFA 2F6NA 2YSMA 3SOWA 3PUQA 2AN6A 1JM7B 4AP4A 2ECVA 3C5KA 2FUUA 2XEUA 3KV6A 4LLBA 4R2YA 2YURA 3HCSA 2H0DA 1G25A 2L75A 4S3OC 5H9MA 2YSJA 4MVTA 5TABA 4AUQB 2LN0A 4P5OB 2MA5A 5DINA 3N9QA 2KU3A 4ZQLA 4R8PK 2CKLB 3LQHA 1RMDA 3MHSA 3U5MA 2Y43A 3N9OA 4FIPA 2LGVA 4YADA 3V43A 4XI1A 2EODA 1Z6UA 5AIUA 2BAYA 1Z60A 2LXPC 2OXQC 3ZNIA 3VK6A 1Z2QA 4ZDTA 5B77A 2F6JA 1JOCA 3O35A 1HYIA 2RI7A 2KR4A 2JMIA 4GB0A 2KWJA 4BHWA 1K2FA 2L0BA 2E6SA 3KV5A 4WZ2A 2M1RA 2CSZA 3M62A 1T1HA 4R7EA 4X3GA 2L5UA 2K17A 3DPLR 3M99A 2PUYA 2G43A 4O64A 4AYCB 5B78A 4GNEA 2MD8C 1WENA 3SOUA 1ZBDB 3L1XA 2I50A 4W4UA 2QJ0A 5G0FA 5KH7A 3EB5A 2KWNA 5B76A 5FERA 3LRQA 5LKTA 4QF2A
chains in the Genus database with same CATH superfamily
3M63A 5FB0A 2K4DA 2YT5A 2LXHC 3LQJA 1WESA 1WEMA 3RPGC 2G45A 2ECTA 2VPGA 4Q6FA 2VNFA 2HYED 5D1KB 5LKXA 2VJEA 2KWOA 4YAXA 2E61A 2LGGA 5SVXA 4Z0RA 5H1VA 2EXUA 1WILA 4O62A 2FUIA 2UZGA 5I3LA 5KH9A 2YQMA 2H0DB 4OGCA 2IDAA 4FK5A 3T6RA 3FJUB 3ZYQA 5DKAA 2L43A 2MNZA 4PPEA 2F42A 1JM7A 1FBVA 3ZPV1 2C2LA 1LDKC 2VPBA 2VPEA 3GV4A 2CRWA 2XB1A 4FJCA 4A4CA 3HTKC 3MHHA 5D1LB 3O47A 3PLWA 2KIZA 4BBQA 2CONA 3KQIA 4CA1A 4YBSA 1BORA 3FM8C 5TRBA 2Y1MA 4YC9A 5SVIB 5H1UA 2ECWA 5B79A 2JM3A 4AVXA 5D1MB 3FANA 2DJAA 4MSXA 4V3LC 2ECIA 3Q1DA 2LDRA 1U6GB 2YUCA 2KREA 1WEPA 2IQJA 2C2VS 2CKLA 1WEQA 2M3HA 4L7XA 4FO9A 3SOXA 2L7PA 4UI9B 4QF3A 2YHOA 1MM3A 5SVYA 2KGIA 2LGKA 2YHNA 1WEUA 3NG2A 3N9MA 3JUEA 2D8UA 2MIQA 2ZETC 3DWDA 4GNGA 3T9KA 1E4UA 2LQ6A 2FSAA 2MNYA 4I7CA 4A0CD 5B75A 4I7DA 2YYRA 2MT5A 5TDWA 1WGMA 2DSMA 3O34A 2JMDA 1WFKA 2M6MA 3I2DA 2OWAA 4LJNA 2DX8A 3L1ZB 2K1JA 2LRIC 4F52B 5FB1A 5KH3A 2VJFB 2PNXA 3EB6A 1DVPA 3PURA 3H7HA 1HYJA 5B8DA 4AYCA 1N87A 4YABA 3LDYA 2CSYA 5G05B 4PTBA 4IC3A 3FL2A 4QQ4A 4UP0A 2KKYA 2L80A 2YVRA 2CT2A 4A49A 3RPGB 5LKUA 2EGMA 3ZTGA 5G04B 2KFTA 3HCTA 2JRJA 1CHCA 2FFWA 4TKPB 2B0OE 3ASLA 3KNVA 4UP5A 2QICA 2LAUA 5TBNA 2LV9A 2ECGA 2D8SA 2M85A 4B86C 5J3XA 2E6RA 3O36A 3QZVA 4S3OB 1MM2A 3O37A 4WZ0A 1VYXA 2KWKA 4B7YC 5LCWB 3GL6A 3O7AA 4WZ3B 5C11A 3RTRB 2HDPA 4LKAA 4YBTA 1X4IA 3ZVZB 2MD7B 3IHPA 2Y1NA 2QIZA 3FAOA 4NN2A 4F1PA 4GNFA 3L11A 3LVRE 3HCUA 1VFYA 3N9PA 3PHDA 4YATA 2EA6A 2LGLA 2YU4A 3O33A 5JG6A 3T7LA 2G6QA 1X4UA 2YW8A 5FEYA 1LDJB 2YQLA 2M13A 1MBMA 2ECJA 3KDEC 1WEEA 1WIMA 1F62A 2VP7A 4N4FA 1WEVA 3LVQE 4C9ZA 1IYMA 1X4JA 3SUBA 3N9LA 5TDRA 3ZVYA 4YBMA 3SHBA 3ZPVE 3MDBC 4LK9A 2FD4A 5SVIA 5C13A 3U5NA 4V3KC 4I7BA 5H1TA 3DQVR 3U5OA 1V87A 4A4BA 2MA6A 5LKZA 4OGEA 2MUMA 2NAAA 2XP0A 4L58A 5EYAF 4WA6A 5AITA 2XOZA 4IC2A 3FEHA 2JMJA 2VPDA 1WEOA 1WE9A 2KE1A 4ZUXU 3C6WA 2KYUA 2K16A 3LJUX 2VJEB 3U5PA 4LADB 3LQIA 2YREA 2ECNA 4CCGX 1WEWA 1FP0A 1XWHA 4GNDA 3N9NA 2EGPA 2KGGA 3O70A 2JUNA 3E2DA 4N3WA 2RSDA 1VD4A 2VJFA 2F6NA 2YSMA 3SOWA 3PUQA 3DDTA 2AN6A 1JM7B 4AP4A 2ECVA 3C5KA 1DCQA 2FUUA 2XOYA 2XEUA 3KV6A 4LLBA 4R2YA 2YURA 3HCSA 2CSVA 2RR4A 2H0DA 1G25A 2L75A 4S3OC 5H9MA 2YSJA 4MVTA 5TABA 4AUQB 2LN0A 4P5OB 2MA5A 5DINA 3N9QA 2KU3A 4ZQLA 4R8PK 2CKLB 3LQHA 1RMDA 3MHSA 3U5MA 2Y43A 3N9OA 4FIPA 2LGVA 4YADA 3V43A 4XI1A 2EODA 1Z6UA 5AIUA 2BAYA 1Z60A 2LXPC 2OXQC 2P57A 3ZNIA 2MKEA 3VK6A 3M7KA 1Z2QA 4ZDTA 5B77A 2F6JA 1JOCA 3O35A 1HYIA 2RI7A 2KR4A 2JMIA 4GB0A 2KWJA 4BHWA 1K2FA 2L0BA 2E6SA 3KV5A 4WZ2A 2M1RA 2CSZA 3M62A 1T1HA 4R7EA 2CRRA 4X3GA 2L5UA 2KKXA 2K17A 3DPLR 4Z0OA 3M99A 2PUYA 2XOCA 2G43A 4O64A 4AYCB 5B78A 4GNEA 2MD8C 1WENA 3SOUA 4H9DA 1ZBDB 3L1XA 2I50A 4W4UA 2QJ0A 5G0FA 5K3QA 5KH7A 3EB5A 2KWNA 5B76A 5FERA 3LRQA 5LKTA 4QF2A
chains in the Genus database with same CATH topology
3M63A 5FB0A 2K4DA 2YT5A 2LXHC 3LQJA 1WESA 1WEMA 3RPGC 2G45A 2ECTA 2VPGA 4Q6FA 2VNFA 2HYED 5D1KB 5LKXA 2VJEA 2KWOA 4YAXA 2LGGA 5H1VA 1WILA 2FUIA 2UZGA 5I3LA 5KH9A 2YQMA 2H0DB 2IDAA 4FK5A 3T6RA 3ZYQA 5DKAA 2L43A 2MNZA 4PPEA 2F42A 1JM7A 1FBVA 3ZPV1 2C2LA 1LDKC 2VPBA 2VPEA 3GV4A 2XB1A 4FJCA 4A4CA 3HTKC 3MHHA 5D1LB 2KIZA 4BBQA 3KQIA 4CA1A 4YBSA 1BORA 5TRBA 2Y1MA 4YC9A 5H1UA 2ECWA 5B79A 4AVXA 5D1MB 4MSXA 4V3LC 2ECIA 2LDRA 1U6GB 2YUCA 2KREA 1WEPA 2C2VS 2CKLA 1WEQA 2M3HA 4L7XA 4FO9A 3SOXA 4UI9B 4QF3A 2YHOA 1MM3A 2KGIA 2LGKA 2YHNA 1WEUA 3NG2A 3N9MA 2MIQA 2ZETC 4GNGA 1E4UA 2LQ6A 2FSAA 2MNYA 4I7CA 4A0CD 5B75A 4I7DA 2YYRA 2MT5A 5TDWA 1WGMA 3O34A 2JMDA 1WFKA 2M6MA 3I2DA 4LJNA 2DX8A 3L1ZB 2K1JA 2LRIC 4F52B 5FB1A 5KH3A 2VJFB 2PNXA 3EB6A 1DVPA 3PURA 1HYJA 5B8DA 4AYCA 1N87A 4YABA 2CSYA 5G05B 4PTBA 4IC3A 3FL2A 4UP0A 2L80A 2CT2A 4A49A 3RPGB 5LKUA 3ZTGA 5G04B 2KFTA 3HCTA 2JRJA 1CHCA 4TKPB 3ASLA 3KNVA 4UP5A 2QICA 5TBNA 2LV9A 2ECGA 2D8SA 2M85A 4B86C 5J3XA 2E6RA 3O36A 3QZVA 4S3OB 1MM2A 3O37A 4WZ0A 1VYXA 2KWKA 4B7YC 5LCWB 3GL6A 3O7AA 4WZ3B 5C11A 3RTRB 2HDPA 4LKAA 4YBTA 1X4IA 3ZVZB 2MD7B 3IHPA 2Y1NA 2QIZA 4NN2A 4GNFA 3L11A 3HCUA 1VFYA 3N9PA 3PHDA 4YATA 2EA6A 2LGLA 2YU4A 3O33A 5JG6A 3T7LA 2G6QA 1X4UA 2YW8A 5FEYA 1LDJB 2YQLA 2ECJA 1WEEA 1WIMA 1F62A 2VP7A 4N4FA 1WEVA 4C9ZA 1IYMA 1X4JA 3N9LA 5TDRA 3ZVYA 4YBMA 3SHBA 3ZPVE 4LK9A 5C13A 3U5NA 4V3KC 4I7BA 5H1TA 3DQVR 3U5OA 1V87A 4A4BA 2MA6A 5LKZA 2MUMA 2NAAA 4L58A 5EYAF 4WA6A 5AITA 4IC2A 2JMJA 2VPDA 1WEOA 1WE9A 2KE1A 4ZUXU 3C6WA 2KYUA 2K16A 2VJEB 3U5PA 4LADB 3LQIA 2YREA 2ECNA 4CCGX 1WEWA 1FP0A 1XWHA 4GNDA 3N9NA 2EGPA 2KGGA 3O70A 4N3WA 2RSDA 1VD4A 2VJFA 2F6NA 2YSMA 3SOWA 3PUQA 2AN6A 1JM7B 4AP4A 2ECVA 3C5KA 2FUUA 2XEUA 3KV6A 4LLBA 4R2YA 2YURA 3HCSA 2H0DA 1G25A 2L75A 4S3OC 5H9MA 2YSJA 4MVTA 5TABA 4AUQB 2LN0A 4P5OB 2MA5A 5DINA 3N9QA 2KU3A 4ZQLA 4R8PK 2CKLB 3LQHA 1RMDA 3MHSA 3U5MA 2Y43A 3N9OA 4FIPA 2LGVA 4YADA 3V43A 4XI1A 2EODA 1Z6UA 5AIUA 2BAYA 1Z60A 2LXPC 2OXQC 3ZNIA 3VK6A 1Z2QA 4ZDTA 5B77A 2F6JA 1JOCA 3O35A 1HYIA 2RI7A 2KR4A 2JMIA 4GB0A 2KWJA 4BHWA 1K2FA 2L0BA 2E6SA 3KV5A 4WZ2A 2M1RA 2CSZA 3M62A 1T1HA 4R7EA 4X3GA 2L5UA 2K17A 3DPLR 3M99A 2PUYA 2G43A 4O64A 4AYCB 5B78A 4GNEA 2MD8C 1WENA 3SOUA 1ZBDB 3L1XA 2I50A 4W4UA 2QJ0A 5G0FA 5KH7A 3EB5A 2KWNA 5B76A 5FERA 3LRQA 5LKTA 4QF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 A;  5FB0 A;  2K4D A;  2YT5 A;  2LXH C;  3LQJ A;  1WES A;  1WEM A;  3RPG C;  2G45 A;  2ECT A;  2VPG A;  4Q6F A;  2VNF A;  2HYE D;  5D1K B;  5LKX A;  2VJE A;  2KWO A;  4YAX A;  2LGG A;  5H1V A;  1WIL A;  2FUI A;  2UZG A;  5I3L A;  5KH9 A;  2YQM A;  2H0D B;  2IDA A;  4FK5 A;  3T6R A;  3ZYQ A;  5DKA A;  2L43 A;  2MNZ A;  4PPE A;  2F42 A;  1JM7 A;  1FBV A;  3ZPV 1;  2C2L A;  1LDK C;  2VPB A;  2VPE A;  3GV4 A;  2XB1 A;  4FJC A;  4A4C A;  3HTK C;  3MHH A;  5D1L B;  2KIZ A;  4BBQ A;  3KQI A;  4CA1 A;  4YBS A;  1BOR A;  5TRB A;  2Y1M A;  4YC9 A;  5H1U A;  2ECW A;  5B79 A;  4AVX A;  5D1M B;  4MSX A;  4V3L C;  2ECI A;  2LDR A;  1U6G B;  2YUC A;  2KRE A;  1WEP A;  2C2V S;  2CKL A;  1WEQ A;  2M3H A;  4L7X A;  4FO9 A;  3SOX A;  4UI9 B;  4QF3 A;  2YHO A;  1MM3 A;  2KGI A;  2LGK A;  2YHN A;  1WEU A;  3NG2 A;  3N9M A;  2MIQ A;  2ZET C;  4GNG A;  1E4U A;  2LQ6 A;  2FSA A;  2MNY A;  4I7C A;  4A0C D;  5B75 A;  4I7D A;  2YYR A;  2MT5 A;  5TDW A;  1WGM A;  3O34 A;  2JMD A;  1WFK A;  2M6M A;  3I2D A;  4LJN A;  2DX8 A;  3L1Z B;  2K1J A;  2LRI C;  4F52 B;  5FB1 A;  5KH3 A;  2VJF B;  2PNX A;  3EB6 A;  1DVP A;  3PUR A;  1HYJ A;  5B8D A;  4AYC A;  1N87 A;  4YAB A;  2CSY A;  5G05 B;  4PTB A;  4IC3 A;  3FL2 A;  4UP0 A;  2L80 A;  2CT2 A;  4A49 A;  3RPG B;  5LKU A;  3ZTG A;  5G04 B;  2KFT A;  3HCT A;  2JRJ A;  1CHC A;  4TKP B;  3ASL A;  3KNV A;  4UP5 A;  2QIC A;  5TBN A;  2LV9 A;  2ECG A;  2D8S A;  2M85 A;  4B86 C;  5J3X A;  2E6R A;  3O36 A;  3QZV A;  4S3O B;  1MM2 A;  3O37 A;  4WZ0 A;  1VYX A;  2KWK A;  4B7Y C;  5LCW B;  3GL6 A;  3O7A A;  4WZ3 B;  5C11 A;  3RTR B;  2HDP A;  4LKA A;  4YBT A;  1X4I A;  3ZVZ B;  2MD7 B;  3IHP A;  2Y1N A;  2QIZ A;  4NN2 A;  4GNF A;  3L11 A;  3HCU A;  1VFY A;  3N9P A;  3PHD A;  4YAT A;  2EA6 A;  2LGL A;  2YU4 A;  3O33 A;  5JG6 A;  3T7L A;  2G6Q A;  1X4U A;  2YW8 A;  5FEY A;  1LDJ B;  2YQL A;  2ECJ A;  1WEE A;  1WIM A;  1F62 A;  2VP7 A;  4N4F A;  1WEV A;  4C9Z A;  1IYM A;  1X4J A;  3N9L A;  5TDR A;  3ZVY A;  4YBM A;  3SHB A;  3ZPV E;  4LK9 A;  5C13 A;  3U5N A;  4V3K C;  4I7B A;  5H1T A;  3DQV R;  3U5O A;  1V87 A;  4A4B A;  2MA6 A;  5LKZ A;  2MUM A;  2NAA A;  4L58 A;  5EYA F;  4WA6 A;  5AIT A;  4IC2 A;  2JMJ A;  2VPD A;  1WEO A;  1WE9 A;  2KE1 A;  4ZUX U;  3C6W A;  2KYU A;  2K16 A;  2VJE B;  3U5P A;  4LAD B;  3LQI A;  2YRE A;  2ECN A;  4CCG X;  1WEW A;  1FP0 A;  1XWH A;  4GND A;  3N9N A;  2EGP A;  2KGG A;  3O70 A;  4N3W A;  2RSD A;  1VD4 A;  2VJF A;  2F6N A;  2YSM A;  3SOW A;  3PUQ A;  2AN6 A;  1JM7 B;  4AP4 A;  2ECV A;  3C5K A;  2FUU A;  2XEU A;  3KV6 A;  4LLB A;  4R2Y A;  2YUR A;  3HCS A;  2H0D A;  1G25 A;  2L75 A;  4S3O C;  5H9M A;  2YSJ A;  4MVT A;  5TAB A;  4AUQ B;  2LN0 A;  4P5O B;  2MA5 A;  5DIN A;  3N9Q A;  2KU3 A;  4ZQL A;  4R8P K;  2CKL B;  3LQH A;  1RMD A;  3MHS A;  3U5M A;  2Y43 A;  3N9O A;  4FIP A;  2LGV A;  4YAD A;  3V43 A;  4XI1 A;  2EOD A;  1Z6U A;  5AIU A;  2BAY A;  1Z60 A;  2LXP C;  2OXQ C;  3ZNI A;  3VK6 A;  1Z2Q A;  4ZDT A;  5B77 A;  2F6J A;  1JOC A;  3O35 A;  1HYI A;  2RI7 A;  2KR4 A;  2JMI A;  4GB0 A;  2KWJ A;  4BHW A;  1K2F A;  2L0B A;  2E6S A;  3KV5 A;  4WZ2 A;  2M1R A;  2CSZ A;  3M62 A;  1T1H A;  4R7E A;  4X3G A;  2L5U A;  2K17 A;  3DPL R;  3M99 A;  2PUY A;  2G43 A;  4O64 A;  4AYC B;  5B78 A;  4GNE A;  2MD8 C;  1WEN A;  3SOU A;  1ZBD B;  3L1X A;  2I50 A;  4W4U A;  2QJ0 A;  5G0F A;  5KH7 A;  3EB5 A;  2KWN A;  5B76 A;  5FER A;  3LRQ A;  5LKT A;  4QF2 A; 
#chains in the Genus database with same CATH topology
 3M63 A;  5FB0 A;  2K4D A;  2YT5 A;  2LXH C;  3LQJ A;  1WES A;  1WEM A;  3RPG C;  2G45 A;  2ECT A;  2VPG A;  4Q6F A;  2VNF A;  2HYE D;  5D1K B;  5LKX A;  2VJE A;  2KWO A;  4YAX A;  2E61 A;  2LGG A;  5SVX A;  4Z0R A;  5H1V A;  2EXU A;  1WIL A;  4O62 A;  2FUI A;  2UZG A;  5I3L A;  5KH9 A;  2YQM A;  2H0D B;  4OGC A;  2IDA A;  4FK5 A;  3T6R A;  3FJU B;  3ZYQ A;  5DKA A;  2L43 A;  2MNZ A;  4PPE A;  2F42 A;  1JM7 A;  1FBV A;  3ZPV 1;  2C2L A;  1LDK C;  2VPB A;  2VPE A;  3GV4 A;  2CRW A;  2XB1 A;  4FJC A;  4A4C A;  3HTK C;  3MHH A;  5D1L B;  3O47 A;  3PLW A;  2KIZ A;  4BBQ A;  2CON A;  3KQI A;  4CA1 A;  4YBS A;  1BOR A;  3FM8 C;  5TRB A;  2Y1M A;  4YC9 A;  5SVI B;  5H1U A;  2ECW A;  5B79 A;  2JM3 A;  4AVX A;  5D1M B;  3FAN A;  2DJA A;  4MSX A;  4V3L C;  2ECI A;  3Q1D A;  2LDR A;  1U6G B;  2YUC A;  2KRE A;  1WEP A;  2IQJ A;  2C2V S;  2CKL A;  1WEQ A;  2M3H A;  4L7X A;  4FO9 A;  3SOX A;  2L7P A;  4UI9 B;  4QF3 A;  2YHO A;  1MM3 A;  5SVY A;  2KGI A;  2LGK A;  2YHN A;  1WEU A;  3NG2 A;  3N9M A;  3JUE A;  2D8U A;  2MIQ A;  2ZET C;  3DWD A;  4GNG A;  3T9K A;  1E4U A;  2LQ6 A;  2FSA A;  2MNY A;  4I7C A;  4A0C D;  5B75 A;  4I7D A;  2YYR A;  2MT5 A;  5TDW A;  1WGM A;  2DSM A;  3O34 A;  2JMD A;  1WFK A;  2M6M A;  3I2D A;  2OWA A;  4LJN A;  2DX8 A;  3L1Z B;  2K1J A;  2LRI C;  4F52 B;  5FB1 A;  5KH3 A;  2VJF B;  2PNX A;  3EB6 A;  1DVP A;  3PUR A;  3H7H A;  1HYJ A;  5B8D A;  4AYC A;  1N87 A;  4YAB A;  3LDY A;  2CSY A;  5G05 B;  4PTB A;  4IC3 A;  3FL2 A;  4QQ4 A;  4UP0 A;  2KKY A;  2L80 A;  2YVR A;  2CT2 A;  4A49 A;  3RPG B;  5LKU A;  2EGM A;  3ZTG A;  5G04 B;  2KFT A;  3HCT A;  2JRJ A;  1CHC A;  2FFW A;  4TKP B;  2B0O E;  3ASL A;  3KNV A;  4UP5 A;  2QIC A;  2LAU A;  5TBN A;  2LV9 A;  2ECG A;  2D8S A;  2M85 A;  4B86 C;  5J3X A;  2E6R A;  3O36 A;  3QZV A;  4S3O B;  1MM2 A;  3O37 A;  4WZ0 A;  1VYX A;  2KWK A;  4B7Y C;  5LCW B;  3GL6 A;  3O7A A;  4WZ3 B;  5C11 A;  3RTR B;  2HDP A;  4LKA A;  4YBT A;  1X4I A;  3ZVZ B;  2MD7 B;  3IHP A;  2Y1N A;  2QIZ A;  3FAO A;  4NN2 A;  4F1P A;  4GNF A;  3L11 A;  3LVR E;  3HCU A;  1VFY A;  3N9P A;  3PHD A;  4YAT A;  2EA6 A;  2LGL A;  2YU4 A;  3O33 A;  5JG6 A;  3T7L A;  2G6Q A;  1X4U A;  2YW8 A;  5FEY A;  1LDJ B;  2YQL A;  2M13 A;  1MBM A;  2ECJ A;  3KDE C;  1WEE A;  1WIM A;  1F62 A;  2VP7 A;  4N4F A;  1WEV A;  3LVQ E;  4C9Z A;  1IYM A;  1X4J A;  3SUB A;  3N9L A;  5TDR A;  3ZVY A;  4YBM A;  3SHB A;  3ZPV E;  3MDB C;  4LK9 A;  2FD4 A;  5SVI A;  5C13 A;  3U5N A;  4V3K C;  4I7B A;  5H1T A;  3DQV R;  3U5O A;  1V87 A;  4A4B A;  2MA6 A;  5LKZ A;  4OGE A;  2MUM A;  2NAA A;  2XP0 A;  4L58 A;  5EYA F;  4WA6 A;  5AIT A;  2XOZ A;  4IC2 A;  3FEH A;  2JMJ A;  2VPD A;  1WEO A;  1WE9 A;  2KE1 A;  4ZUX U;  3C6W A;  2KYU A;  2K16 A;  3LJU X;  2VJE B;  3U5P A;  4LAD B;  3LQI A;  2YRE A;  2ECN A;  4CCG X;  1WEW A;  1FP0 A;  1XWH A;  4GND A;  3N9N A;  2EGP A;  2KGG A;  3O70 A;  2JUN A;  3E2D A;  4N3W A;  2RSD A;  1VD4 A;  2VJF A;  2F6N A;  2YSM A;  3SOW A;  3PUQ A;  3DDT A;  2AN6 A;  1JM7 B;  4AP4 A;  2ECV A;  3C5K A;  1DCQ A;  2FUU A;  2XOY A;  2XEU A;  3KV6 A;  4LLB A;  4R2Y A;  2YUR A;  3HCS A;  2CSV A;  2RR4 A;  2H0D A;  1G25 A;  2L75 A;  4S3O C;  5H9M A;  2YSJ A;  4MVT A;  5TAB A;  4AUQ B;  2LN0 A;  4P5O B;  2MA5 A;  5DIN A;  3N9Q A;  2KU3 A;  4ZQL A;  4R8P K;  2CKL B;  3LQH A;  1RMD A;  3MHS A;  3U5M A;  2Y43 A;  3N9O A;  4FIP A;  2LGV A;  4YAD A;  3V43 A;  4XI1 A;  2EOD A;  1Z6U A;  5AIU A;  2BAY A;  1Z60 A;  2LXP C;  2OXQ C;  2P57 A;  3ZNI A;  2MKE A;  3VK6 A;  3M7K A;  1Z2Q A;  4ZDT A;  5B77 A;  2F6J A;  1JOC A;  3O35 A;  1HYI A;  2RI7 A;  2KR4 A;  2JMI A;  4GB0 A;  2KWJ A;  4BHW A;  1K2F A;  2L0B A;  2E6S A;  3KV5 A;  4WZ2 A;  2M1R A;  2CSZ A;  3M62 A;  1T1H A;  4R7E A;  2CRR A;  4X3G A;  2L5U A;  2KKX A;  2K17 A;  3DPL R;  4Z0O A;  3M99 A;  2PUY A;  2XOC A;  2G43 A;  4O64 A;  4AYC B;  5B78 A;  4GNE A;  2MD8 C;  1WEN A;  3SOU A;  4H9D A;  1ZBD B;  3L1X A;  2I50 A;  4W4U A;  2QJ0 A;  5G0F A;  5K3Q A;  5KH7 A;  3EB5 A;  2KWN A;  5B76 A;  5FER A;  3LRQ A;  5LKT A;  4QF2 A; 
#chains in the Genus database with same CATH homology
 3M63 A;  5FB0 A;  2K4D A;  2YT5 A;  2LXH C;  3LQJ A;  1WES A;  1WEM A;  3RPG C;  2G45 A;  2ECT A;  2VPG A;  4Q6F A;  2VNF A;  2HYE D;  5D1K B;  5LKX A;  2VJE A;  2KWO A;  4YAX A;  2LGG A;  5H1V A;  1WIL A;  2FUI A;  2UZG A;  5I3L A;  5KH9 A;  2YQM A;  2H0D B;  2IDA A;  4FK5 A;  3T6R A;  3ZYQ A;  5DKA A;  2L43 A;  2MNZ A;  4PPE A;  2F42 A;  1JM7 A;  1FBV A;  3ZPV 1;  2C2L A;  1LDK C;  2VPB A;  2VPE A;  3GV4 A;  2XB1 A;  4FJC A;  4A4C A;  3HTK C;  3MHH A;  5D1L B;  2KIZ A;  4BBQ A;  3KQI A;  4CA1 A;  4YBS A;  1BOR A;  5TRB A;  2Y1M A;  4YC9 A;  5H1U A;  2ECW A;  5B79 A;  4AVX A;  5D1M B;  4MSX A;  4V3L C;  2ECI A;  2LDR A;  1U6G B;  2YUC A;  2KRE A;  1WEP A;  2C2V S;  2CKL A;  1WEQ A;  2M3H A;  4L7X A;  4FO9 A;  3SOX A;  4UI9 B;  4QF3 A;  2YHO A;  1MM3 A;  2KGI A;  2LGK A;  2YHN A;  1WEU A;  3NG2 A;  3N9M A;  2MIQ A;  2ZET C;  4GNG A;  1E4U A;  2LQ6 A;  2FSA A;  2MNY A;  4I7C A;  4A0C D;  5B75 A;  4I7D A;  2YYR A;  2MT5 A;  5TDW A;  1WGM A;  3O34 A;  2JMD A;  1WFK A;  2M6M A;  3I2D A;  4LJN A;  2DX8 A;  3L1Z B;  2K1J A;  2LRI C;  4F52 B;  5FB1 A;  5KH3 A;  2VJF B;  2PNX A;  3EB6 A;  1DVP A;  3PUR A;  1HYJ A;  5B8D A;  4AYC A;  1N87 A;  4YAB A;  2CSY A;  5G05 B;  4PTB A;  4IC3 A;  3FL2 A;  4UP0 A;  2L80 A;  2CT2 A;  4A49 A;  3RPG B;  5LKU A;  3ZTG A;  5G04 B;  2KFT A;  3HCT A;  2JRJ A;  1CHC A;  4TKP B;  3ASL A;  3KNV A;  4UP5 A;  2QIC A;  5TBN A;  2LV9 A;  2ECG A;  2D8S A;  2M85 A;  4B86 C;  5J3X A;  2E6R A;  3O36 A;  3QZV A;  4S3O B;  1MM2 A;  3O37 A;  4WZ0 A;  1VYX A;  2KWK A;  4B7Y C;  5LCW B;  3GL6 A;  3O7A A;  4WZ3 B;  5C11 A;  3RTR B;  2HDP A;  4LKA A;  4YBT A;  1X4I A;  3ZVZ B;  2MD7 B;  3IHP A;  2Y1N A;  2QIZ A;  4NN2 A;  4GNF A;  3L11 A;  3HCU A;  1VFY A;  3N9P A;  3PHD A;  4YAT A;  2EA6 A;  2LGL A;  2YU4 A;  3O33 A;  5JG6 A;  3T7L A;  2G6Q A;  1X4U A;  2YW8 A;  5FEY A;  1LDJ B;  2YQL A;  2ECJ A;  1WEE A;  1WIM A;  1F62 A;  2VP7 A;  4N4F A;  1WEV A;  4C9Z A;  1IYM A;  1X4J A;  3N9L A;  5TDR A;  3ZVY A;  4YBM A;  3SHB A;  3ZPV E;  4LK9 A;  5C13 A;  3U5N A;  4V3K C;  4I7B A;  5H1T A;  3DQV R;  3U5O A;  1V87 A;  4A4B A;  2MA6 A;  5LKZ A;  2MUM A;  2NAA A;  4L58 A;  5EYA F;  4WA6 A;  5AIT A;  4IC2 A;  2JMJ A;  2VPD A;  1WEO A;  1WE9 A;  2KE1 A;  4ZUX U;  3C6W A;  2KYU A;  2K16 A;  2VJE B;  3U5P A;  4LAD B;  3LQI A;  2YRE A;  2ECN A;  4CCG X;  1WEW A;  1FP0 A;  1XWH A;  4GND A;  3N9N A;  2EGP A;  2KGG A;  3O70 A;  4N3W A;  2RSD A;  1VD4 A;  2VJF A;  2F6N A;  2YSM A;  3SOW A;  3PUQ A;  2AN6 A;  1JM7 B;  4AP4 A;  2ECV A;  3C5K A;  2FUU A;  2XEU A;  3KV6 A;  4LLB A;  4R2Y A;  2YUR A;  3HCS A;  2H0D A;  1G25 A;  2L75 A;  4S3O C;  5H9M A;  2YSJ A;  4MVT A;  5TAB A;  4AUQ B;  2LN0 A;  4P5O B;  2MA5 A;  5DIN A;  3N9Q A;  2KU3 A;  4ZQL A;  4R8P K;  2CKL B;  3LQH A;  1RMD A;  3MHS A;  3U5M A;  2Y43 A;  3N9O A;  4FIP A;  2LGV A;  4YAD A;  3V43 A;  4XI1 A;  2EOD A;  1Z6U A;  5AIU A;  2BAY A;  1Z60 A;  2LXP C;  2OXQ C;  3ZNI A;  3VK6 A;  1Z2Q A;  4ZDT A;  5B77 A;  2F6J A;  1JOC A;  3O35 A;  1HYI A;  2RI7 A;  2KR4 A;  2JMI A;  4GB0 A;  2KWJ A;  4BHW A;  1K2F A;  2L0B A;  2E6S A;  3KV5 A;  4WZ2 A;  2M1R A;  2CSZ A;  3M62 A;  1T1H A;  4R7E A;  4X3G A;  2L5U A;  2K17 A;  3DPL R;  3M99 A;  2PUY A;  2G43 A;  4O64 A;  4AYC B;  5B78 A;  4GNE A;  2MD8 C;  1WEN A;  3SOU A;  1ZBD B;  3L1X A;  2I50 A;  4W4U A;  2QJ0 A;  5G0F A;  5KH7 A;  3EB5 A;  2KWN A;  5B76 A;  5FER A;  3LRQ A;  5LKT A;  4QF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...