2HYED

Crystal structure of the ddb1-cul4a-rbx1-sv5v complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
90
structure length
90
Chain Sequence
KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords DNA damage-binding protein 1
publication title Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 90
sequence length 90
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2006-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2hyeD00
2K17A 4WZ0A 2G45A 2MUMA 2G43A 3ZYQA 1HYIA 2YU4A 3U5MA 2PUYA 4F52B 4W4UA 4LADB 2LGKA 2MT5A 1MM2A 4WZ2A 2L75A 1WEUA 5J3XA 2M1RA 3HCTA 3RPGC 2E6RA 3M63A 2KGGA 3VK6A 3LQJA 4AVXA 2MD7B 1FBVA 3ZTGA 1WFKA 1Z6UA 2MD8C 2ECVA 3O34A 2G6QA 2JMIA 4Q6FA 2LDRA 1F62A 1G25A 2CKLB 2M6MA 4UI9B 3SOXA 2JRJA 5G05B 3O7AA 2VP7A 1WEOA 2KWOA 2VPDA 2L5UA 2MIQA 4UP5A 4NN2A 4N3WA 3C6WA 2BAYA 2MNZA 2EA6A 1T1HA 4A0CD 3U5NA 2LV9A 1WEMA 2CKLA 4FIPA 3ASLA 2ECGA 2EODA 5FERA 1WIMA 3N9PA 1XWHA 2ECJA 3T6RA 3FL2A 3KNVA 4B86C 5B78A 2M85A 3ZPV1 2YQMA 3SOUA 2DX8A 3NG2A 3RTRB 4AP4A 3GV4A 4TKPB 3LQIA 2M3HA 1HYJA 1WESA 4YATA 2QICA 5H9MA 1WEPA 5FB1A 4ZQLA 3PURA 2VPEA 3L1ZB 3KV6A 2LXHC 2LQ6A 4I7BA 5D1MB 3ZVZB 2KWKA 4BBQA 4GNDA 3SOWA 4ZDTA 4CCGX 4A4CA 5B8DA 4P5OB 4B7YC 4I7DA 5TDWA 4R2YA 2H0DA 5H1VA 1WGMA 2YQLA 2VPGA 5I3LA 2OXQC 2HYED 4S3OB 1FP0A 1Z60A 4GNFA 3ZPVE 2UZGA 1DVPA 3O35A 5KH7A 4LLBA 2Y1NA 2AN6A 4AUQB 2L43A 4IC2A 3PUQA 4YBTA 3MHSA 5AIUA 3L1XA 2YT5A 5G0FA 1WENA 2RSDA 4FO9A 1WEWA 4WA6A 2K1JA 3M99A 5TRBA 5H1UA 5JG6A 2LN0A 3DPLR 2VJFB 1RMDA 1X4JA 3O36A 4X3GA 5LKUA 4MSXA 5EYAF 3V43A 5LKXA 5B77A 1LDJB 3O37A 2K4DA 2JMJA 2CSZA 1VYXA 4LKAA 2VJEB 1IYMA 4PPEA 2L0BA 1LDKC 2ECTA 3LQHA 5LCWB 2KR4A 4R8PK 2LGLA 1E4UA 2LXPC 4I7CA 1WEEA 4GNEA 4QF3A 4A4BA 1WE9A 5B79A 1JOCA 2LGGA 2IDAA 3RPGB 2F6JA 3N9MA 1JM7B 2KWJA 2HDPA 2KYUA 4V3KC 2QIZA 2MA5A 2F42A 5D1KB 4YBMA 3I2DA 2FUIA 2YUCA 3MHHA 2C2VS 4XI1A 5KH9A 4WZ3B 2KWNA 2QJ0A 3ZVYA 2CSYA 3PHDA 2RI7A 1WILA 2KU3A 2XB1A 1WEQA 4MVTA 3KQIA 4BHWA 4L58A 5B76A 4FK5A 2CT2A 2YHNA 3N9QA 1CHCA 2KE1A 2XEUA 2MA6A 3C5KA 1ZBDB 2EGPA 2ZETC 4CA1A 4YABA 3EB6A 4IC3A 1X4UA 2VNFA 3U5PA 3HCSA 4LK9A 2Y43A 4R7EA 2ECWA 4PTBA 5FB0A 2Y1MA 5LKZA 2FSAA 3HTKC 5DKAA 3ZNIA 5C13A 2VPBA 5LKTA 4YAXA 3M62A 2FUUA 3U5OA 3HCUA 2ECIA 2YSJA 3IHPA 3SHBA 2KREA 4YC9A 5AITA 1X4IA 4YBSA 2MNYA 2NAAA 3N9NA 3L11A 5DINA 1Z2QA 2YSMA 4ZUXU 1K2FA 1U6GB 2PNXA 4C9ZA 2ECNA 4FJCA 2KGIA 3LRQA 2VJFA 5G04B 2YW8A 4UP0A 4O64A 2LRIC 4S3OC 2KIZA 4L7XA 2YURA 4A49A 2E6SA 1V87A 2F6NA 3GL6A 5H1TA 3QZVA 2YYRA 4YADA 4AYCB 2VJEA 5D1LB 5C11A 2D8SA 1VFYA 3O33A 5TDRA 4QF2A 3N9OA 2C2LA 2K16A 2I50A 5FEYA 1WEVA 4LJNA 1N87A 5TABA 1VD4A 5TBNA 2L80A 4AYCA 3KV5A 3N9LA 1JM7A 3T7LA 2LGVA 3O70A 4GNGA 4N4FA 1BORA 3EB5A 2YREA 3DQVR 1MM3A 2YHOA 5KH3A 2H0DB 5B75A 2KFTA 4V3LC 4GB0A 2JMDA
chains in the Genus database with same CATH superfamily
2K17A 4WZ0A 2G45A 2MUMA 2G43A 3ZYQA 1HYIA 2YU4A 3U5MA 2PUYA 4F52B 4W4UA 4LADB 5SVYA 2LGKA 2MT5A 2XOZA 2KKXA 1MM2A 3FEHA 4WZ2A 2L75A 1WEUA 2EGMA 5J3XA 2M1RA 3HCTA 3FAOA 3RPGC 4O62A 2E6RA 3M63A 2KGGA 3VK6A 3LQJA 4Z0OA 4AVXA 4OGCA 2MD7B 1FBVA 3ZTGA 1WFKA 1Z6UA 2XOCA 2MD8C 2ECVA 2CSVA 3FJUB 3O34A 1DCQA 2G6QA 2EXUA 2JMIA 4Q6FA 2LDRA 1F62A 1G25A 2CKLB 2M6MA 4UI9B 5K3QA 3SOXA 2YVRA 3JUEA 2JRJA 5G05B 3O7AA 2VP7A 1WEOA 3M7KA 2KWOA 2VPDA 2L5UA 2MIQA 4UP5A 4NN2A 4N3WA 2DJAA 3C6WA 2BAYA 2MNZA 2EA6A 1T1HA 4A0CD 3U5NA 2LV9A 1WEMA 2CKLA 4FIPA 3ASLA 2KKYA 2ECGA 2EODA 5FERA 1WIMA 3N9PA 1XWHA 2ECJA 3T6RA 3FL2A 3KNVA 3Q1DA 4B86C 5B78A 3PLWA 2M85A 3ZPV1 2YQMA 3SOUA 2JM3A 2DX8A 3NG2A 3RTRB 3DDTA 2CRRA 4AP4A 3GV4A 2CRWA 4TKPB 3LQIA 2M3HA 1HYJA 4Z0RA 1WESA 4YATA 2QICA 5H9MA 1WEPA 2JUNA 5FB1A 4ZQLA 3PURA 2VPEA 3L1ZB 4QQ4A 3KV6A 2LXHC 2LQ6A 3H7HA 4I7BA 5D1MB 4OGEA 3ZVZB 2KWKA 4BBQA 4GNDA 3DWDA 3SOWA 4ZDTA 4CCGX 4A4CA 5B8DA 4P5OB 4B7YC 4I7DA 5TDWA 4R2YA 2H0DA 5H1VA 1WGMA 2YQLA 2VPGA 5I3LA 2OXQC 2HYED 4S3OB 1FP0A 1Z60A 2RR4A 4GNFA 3ZPVE 2UZGA 1DVPA 3O35A 5KH7A 4LLBA 2Y1NA 2AN6A 4AUQB 2L43A 4IC2A 3PUQA 4YBTA 3T9KA 3MHSA 2L7PA 5AIUA 3L1XA 2YT5A 5G0FA 1WENA 2FD4A 2RSDA 4FO9A 1WEWA 4WA6A 2K1JA 3M99A 2IQJA 5TRBA 5H1UA 5JG6A 2LN0A 3DPLR 2DSMA 2VJFB 5SVIB 1RMDA 1X4JA 3O36A 4X3GA 5LKUA 4MSXA 5EYAF 3V43A 5LKXA 2M13A 5B77A 1LDJB 3O37A 2K4DA 2JMJA 2CSZA 1VYXA 4LKAA 2VJEB 1IYMA 4PPEA 3LVRE 2L0BA 1LDKC 2ECTA 3LQHA 5LCWB 2KR4A 4R8PK 2LGLA 1E4UA 2LXPC 4I7CA 2P57A 1WEEA 4GNEA 4QF3A 4A4BA 1WE9A 5B79A 2OWAA 1JOCA 2LGGA 2IDAA 3RPGB 2F6JA 3N9MA 1JM7B 2KWJA 2HDPA 2KYUA 4V3KC 2QIZA 2MA5A 2F42A 3SUBA 5D1KB 4YBMA 2CONA 3I2DA 2FUIA 2YUCA 3MHHA 5SVXA 2C2VS 4XI1A 2LAUA 3LJUX 5KH9A 4WZ3B 2KWNA 2QJ0A 3ZVYA 2CSYA 2XOYA 2RI7A 3PHDA 1WILA 2KU3A 2XB1A 1WEQA 4MVTA 3KQIA 2D8UA 4H9DA 4BHWA 4L58A 5B76A 4FK5A 2CT2A 2YHNA 3N9QA 3LVQE 1CHCA 2KE1A 2XEUA 2MA6A 3C5KA 3O47A 1ZBDB 2EGPA 2ZETC 4CA1A 3KDEC 2XP0A 4YABA 3EB6A 4IC3A 1X4UA 1MBMA 2VNFA 2MKEA 3U5PA 3HCSA 4LK9A 2Y43A 4R7EA 2ECWA 4PTBA 5FB0A 2Y1MA 5LKZA 2B0OE 2FSAA 3HTKC 5DKAA 3FANA 3ZNIA 5C13A 2VPBA 5LKTA 4YAXA 3M62A 2FUUA 3U5OA 3HCUA 3MDBC 2ECIA 2YSJA 3IHPA 3SHBA 2KREA 4F1PA 3LDYA 4YC9A 5AITA 1X4IA 4YBSA 2MNYA 2NAAA 3N9NA 3L11A 5DINA 1Z2QA 2YSMA 4ZUXU 1K2FA 1U6GB 2PNXA 3FM8C 4C9ZA 2ECNA 4FJCA 2KGIA 3LRQA 2VJFA 5G04B 2YW8A 5SVIA 4UP0A 4O64A 2LRIC 4S3OC 2KIZA 4L7XA 2YURA 4A49A 2E6SA 1V87A 2F6NA 3GL6A 5H1TA 3QZVA 2YYRA 4YADA 4AYCB 2VJEA 5D1LB 5C11A 2D8SA 1VFYA 3O33A 5TDRA 4QF2A 2E61A 3N9OA 2C2LA 2FFWA 2K16A 2I50A 5FEYA 1WEVA 4LJNA 1N87A 5TABA 1VD4A 5TBNA 2L80A 4AYCA 3KV5A 3E2DA 3N9LA 1JM7A 3T7LA 2LGVA 3O70A 4GNGA 4N4FA 1BORA 3EB5A 2YREA 3DQVR 1MM3A 2YHOA 5KH3A 2H0DB 5B75A 2KFTA 4V3LC 4GB0A 2JMDA
chains in the Genus database with same CATH topology
2K17A 4WZ0A 2G45A 2MUMA 2G43A 3ZYQA 1HYIA 2YU4A 3U5MA 2PUYA 4F52B 4W4UA 4LADB 2LGKA 2MT5A 1MM2A 4WZ2A 2L75A 1WEUA 5J3XA 2M1RA 3HCTA 3RPGC 2E6RA 3M63A 2KGGA 3VK6A 3LQJA 4AVXA 2MD7B 1FBVA 3ZTGA 1WFKA 1Z6UA 2MD8C 2ECVA 3O34A 2G6QA 2JMIA 4Q6FA 2LDRA 1F62A 1G25A 2CKLB 2M6MA 4UI9B 3SOXA 2JRJA 5G05B 3O7AA 2VP7A 1WEOA 2KWOA 2VPDA 2L5UA 2MIQA 4UP5A 4NN2A 4N3WA 3C6WA 2BAYA 2MNZA 2EA6A 1T1HA 4A0CD 3U5NA 2LV9A 1WEMA 2CKLA 4FIPA 3ASLA 2ECGA 2EODA 5FERA 1WIMA 3N9PA 1XWHA 2ECJA 3T6RA 3FL2A 3KNVA 4B86C 5B78A 2M85A 3ZPV1 2YQMA 3SOUA 2DX8A 3NG2A 3RTRB 4AP4A 3GV4A 4TKPB 3LQIA 2M3HA 1HYJA 1WESA 4YATA 2QICA 5H9MA 1WEPA 5FB1A 4ZQLA 3PURA 2VPEA 3L1ZB 3KV6A 2LXHC 2LQ6A 4I7BA 5D1MB 3ZVZB 2KWKA 4BBQA 4GNDA 3SOWA 4ZDTA 4CCGX 4A4CA 5B8DA 4P5OB 4B7YC 4I7DA 5TDWA 4R2YA 2H0DA 5H1VA 1WGMA 2YQLA 2VPGA 5I3LA 2OXQC 2HYED 4S3OB 1FP0A 1Z60A 4GNFA 3ZPVE 2UZGA 1DVPA 3O35A 5KH7A 4LLBA 2Y1NA 2AN6A 4AUQB 2L43A 4IC2A 3PUQA 4YBTA 3MHSA 5AIUA 3L1XA 2YT5A 5G0FA 1WENA 2RSDA 4FO9A 1WEWA 4WA6A 2K1JA 3M99A 5TRBA 5H1UA 5JG6A 2LN0A 3DPLR 2VJFB 1RMDA 1X4JA 3O36A 4X3GA 5LKUA 4MSXA 5EYAF 3V43A 5LKXA 5B77A 1LDJB 3O37A 2K4DA 2JMJA 2CSZA 1VYXA 4LKAA 2VJEB 1IYMA 4PPEA 2L0BA 1LDKC 2ECTA 3LQHA 5LCWB 2KR4A 4R8PK 2LGLA 1E4UA 2LXPC 4I7CA 1WEEA 4GNEA 4QF3A 4A4BA 1WE9A 5B79A 1JOCA 2LGGA 2IDAA 3RPGB 2F6JA 3N9MA 1JM7B 2KWJA 2HDPA 2KYUA 4V3KC 2QIZA 2MA5A 2F42A 5D1KB 4YBMA 3I2DA 2FUIA 2YUCA 3MHHA 2C2VS 4XI1A 5KH9A 4WZ3B 2KWNA 2QJ0A 3ZVYA 2CSYA 3PHDA 2RI7A 1WILA 2KU3A 2XB1A 1WEQA 4MVTA 3KQIA 4BHWA 4L58A 5B76A 4FK5A 2CT2A 2YHNA 3N9QA 1CHCA 2KE1A 2XEUA 2MA6A 3C5KA 1ZBDB 2EGPA 2ZETC 4CA1A 4YABA 3EB6A 4IC3A 1X4UA 2VNFA 3U5PA 3HCSA 4LK9A 2Y43A 4R7EA 2ECWA 4PTBA 5FB0A 2Y1MA 5LKZA 2FSAA 3HTKC 5DKAA 3ZNIA 5C13A 2VPBA 5LKTA 4YAXA 3M62A 2FUUA 3U5OA 3HCUA 2ECIA 2YSJA 3IHPA 3SHBA 2KREA 4YC9A 5AITA 1X4IA 4YBSA 2MNYA 2NAAA 3N9NA 3L11A 5DINA 1Z2QA 2YSMA 4ZUXU 1K2FA 1U6GB 2PNXA 4C9ZA 2ECNA 4FJCA 2KGIA 3LRQA 2VJFA 5G04B 2YW8A 4UP0A 4O64A 2LRIC 4S3OC 2KIZA 4L7XA 2YURA 4A49A 2E6SA 1V87A 2F6NA 3GL6A 5H1TA 3QZVA 2YYRA 4YADA 4AYCB 2VJEA 5D1LB 5C11A 2D8SA 1VFYA 3O33A 5TDRA 4QF2A 3N9OA 2C2LA 2K16A 2I50A 5FEYA 1WEVA 4LJNA 1N87A 5TABA 1VD4A 5TBNA 2L80A 4AYCA 3KV5A 3N9LA 1JM7A 3T7LA 2LGVA 3O70A 4GNGA 4N4FA 1BORA 3EB5A 2YREA 3DQVR 1MM3A 2YHOA 5KH3A 2H0DB 5B75A 2KFTA 4V3LC 4GB0A 2JMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K17 A;  4WZ0 A;  2G45 A;  2MUM A;  2G43 A;  3ZYQ A;  1HYI A;  2YU4 A;  3U5M A;  2PUY A;  4F52 B;  4W4U A;  4LAD B;  2LGK A;  2MT5 A;  1MM2 A;  4WZ2 A;  2L75 A;  1WEU A;  5J3X A;  2M1R A;  3HCT A;  3RPG C;  2E6R A;  3M63 A;  2KGG A;  3VK6 A;  3LQJ A;  4AVX A;  2MD7 B;  1FBV A;  3ZTG A;  1WFK A;  1Z6U A;  2MD8 C;  2ECV A;  3O34 A;  2G6Q A;  2JMI A;  4Q6F A;  2LDR A;  1F62 A;  1G25 A;  2CKL B;  2M6M A;  4UI9 B;  3SOX A;  2JRJ A;  5G05 B;  3O7A A;  2VP7 A;  1WEO A;  2KWO A;  2VPD A;  2L5U A;  2MIQ A;  4UP5 A;  4NN2 A;  4N3W A;  3C6W A;  2BAY A;  2MNZ A;  2EA6 A;  1T1H A;  4A0C D;  3U5N A;  2LV9 A;  1WEM A;  2CKL A;  4FIP A;  3ASL A;  2ECG A;  2EOD A;  5FER A;  1WIM A;  3N9P A;  1XWH A;  2ECJ A;  3T6R A;  3FL2 A;  3KNV A;  4B86 C;  5B78 A;  2M85 A;  3ZPV 1;  2YQM A;  3SOU A;  2DX8 A;  3NG2 A;  3RTR B;  4AP4 A;  3GV4 A;  4TKP B;  3LQI A;  2M3H A;  1HYJ A;  1WES A;  4YAT A;  2QIC A;  5H9M A;  1WEP A;  5FB1 A;  4ZQL A;  3PUR A;  2VPE A;  3L1Z B;  3KV6 A;  2LXH C;  2LQ6 A;  4I7B A;  5D1M B;  3ZVZ B;  2KWK A;  4BBQ A;  4GND A;  3SOW A;  4ZDT A;  4CCG X;  4A4C A;  5B8D A;  4P5O B;  4B7Y C;  4I7D A;  5TDW A;  4R2Y A;  2H0D A;  5H1V A;  1WGM A;  2YQL A;  2VPG A;  5I3L A;  2OXQ C;  2HYE D;  4S3O B;  1FP0 A;  1Z60 A;  4GNF A;  3ZPV E;  2UZG A;  1DVP A;  3O35 A;  5KH7 A;  4LLB A;  2Y1N A;  2AN6 A;  4AUQ B;  2L43 A;  4IC2 A;  3PUQ A;  4YBT A;  3MHS A;  5AIU A;  3L1X A;  2YT5 A;  5G0F A;  1WEN A;  2RSD A;  4FO9 A;  1WEW A;  4WA6 A;  2K1J A;  3M99 A;  5TRB A;  5H1U A;  5JG6 A;  2LN0 A;  3DPL R;  2VJF B;  1RMD A;  1X4J A;  3O36 A;  4X3G A;  5LKU A;  4MSX A;  5EYA F;  3V43 A;  5LKX A;  5B77 A;  1LDJ B;  3O37 A;  2K4D A;  2JMJ A;  2CSZ A;  1VYX A;  4LKA A;  2VJE B;  1IYM A;  4PPE A;  2L0B A;  1LDK C;  2ECT A;  3LQH A;  5LCW B;  2KR4 A;  4R8P K;  2LGL A;  1E4U A;  2LXP C;  4I7C A;  1WEE A;  4GNE A;  4QF3 A;  4A4B A;  1WE9 A;  5B79 A;  1JOC A;  2LGG A;  2IDA A;  3RPG B;  2F6J A;  3N9M A;  1JM7 B;  2KWJ A;  2HDP A;  2KYU A;  4V3K C;  2QIZ A;  2MA5 A;  2F42 A;  5D1K B;  4YBM A;  3I2D A;  2FUI A;  2YUC A;  3MHH A;  2C2V S;  4XI1 A;  5KH9 A;  4WZ3 B;  2KWN A;  2QJ0 A;  3ZVY A;  2CSY A;  3PHD A;  2RI7 A;  1WIL A;  2KU3 A;  2XB1 A;  1WEQ A;  4MVT A;  3KQI A;  4BHW A;  4L58 A;  5B76 A;  4FK5 A;  2CT2 A;  2YHN A;  3N9Q A;  1CHC A;  2KE1 A;  2XEU A;  2MA6 A;  3C5K A;  1ZBD B;  2EGP A;  2ZET C;  4CA1 A;  4YAB A;  3EB6 A;  4IC3 A;  1X4U A;  2VNF A;  3U5P A;  3HCS A;  4LK9 A;  2Y43 A;  4R7E A;  2ECW A;  4PTB A;  5FB0 A;  2Y1M A;  5LKZ A;  2FSA A;  3HTK C;  5DKA A;  3ZNI A;  5C13 A;  2VPB A;  5LKT A;  4YAX A;  3M62 A;  2FUU A;  3U5O A;  3HCU A;  2ECI A;  2YSJ A;  3IHP A;  3SHB A;  2KRE A;  4YC9 A;  5AIT A;  1X4I A;  4YBS A;  2MNY A;  2NAA A;  3N9N A;  3L11 A;  5DIN A;  1Z2Q A;  2YSM A;  4ZUX U;  1K2F A;  1U6G B;  2PNX A;  4C9Z A;  2ECN A;  4FJC A;  2KGI A;  3LRQ A;  2VJF A;  5G04 B;  2YW8 A;  4UP0 A;  4O64 A;  2LRI C;  4S3O C;  2KIZ A;  4L7X A;  2YUR A;  4A49 A;  2E6S A;  1V87 A;  2F6N A;  3GL6 A;  5H1T A;  3QZV A;  2YYR A;  4YAD A;  4AYC B;  2VJE A;  5D1L B;  5C11 A;  2D8S A;  1VFY A;  3O33 A;  5TDR A;  4QF2 A;  3N9O A;  2C2L A;  2K16 A;  2I50 A;  5FEY A;  1WEV A;  4LJN A;  1N87 A;  5TAB A;  1VD4 A;  5TBN A;  2L80 A;  4AYC A;  3KV5 A;  3N9L A;  1JM7 A;  3T7L A;  2LGV A;  3O70 A;  4GNG A;  4N4F A;  1BOR A;  3EB5 A;  2YRE A;  3DQV R;  1MM3 A;  2YHO A;  5KH3 A;  2H0D B;  5B75 A;  2KFT A;  4V3L C;  4GB0 A;  2JMD A; 
#chains in the Genus database with same CATH topology
 2K17 A;  4WZ0 A;  2G45 A;  2MUM A;  2G43 A;  3ZYQ A;  1HYI A;  2YU4 A;  3U5M A;  2PUY A;  4F52 B;  4W4U A;  4LAD B;  5SVY A;  2LGK A;  2MT5 A;  2XOZ A;  2KKX A;  1MM2 A;  3FEH A;  4WZ2 A;  2L75 A;  1WEU A;  2EGM A;  5J3X A;  2M1R A;  3HCT A;  3FAO A;  3RPG C;  4O62 A;  2E6R A;  3M63 A;  2KGG A;  3VK6 A;  3LQJ A;  4Z0O A;  4AVX A;  4OGC A;  2MD7 B;  1FBV A;  3ZTG A;  1WFK A;  1Z6U A;  2XOC A;  2MD8 C;  2ECV A;  2CSV A;  3FJU B;  3O34 A;  1DCQ A;  2G6Q A;  2EXU A;  2JMI A;  4Q6F A;  2LDR A;  1F62 A;  1G25 A;  2CKL B;  2M6M A;  4UI9 B;  5K3Q A;  3SOX A;  2YVR A;  3JUE A;  2JRJ A;  5G05 B;  3O7A A;  2VP7 A;  1WEO A;  3M7K A;  2KWO A;  2VPD A;  2L5U A;  2MIQ A;  4UP5 A;  4NN2 A;  4N3W A;  2DJA A;  3C6W A;  2BAY A;  2MNZ A;  2EA6 A;  1T1H A;  4A0C D;  3U5N A;  2LV9 A;  1WEM A;  2CKL A;  4FIP A;  3ASL A;  2KKY A;  2ECG A;  2EOD A;  5FER A;  1WIM A;  3N9P A;  1XWH A;  2ECJ A;  3T6R A;  3FL2 A;  3KNV A;  3Q1D A;  4B86 C;  5B78 A;  3PLW A;  2M85 A;  3ZPV 1;  2YQM A;  3SOU A;  2JM3 A;  2DX8 A;  3NG2 A;  3RTR B;  3DDT A;  2CRR A;  4AP4 A;  3GV4 A;  2CRW A;  4TKP B;  3LQI A;  2M3H A;  1HYJ A;  4Z0R A;  1WES A;  4YAT A;  2QIC A;  5H9M A;  1WEP A;  2JUN A;  5FB1 A;  4ZQL A;  3PUR A;  2VPE A;  3L1Z B;  4QQ4 A;  3KV6 A;  2LXH C;  2LQ6 A;  3H7H A;  4I7B A;  5D1M B;  4OGE A;  3ZVZ B;  2KWK A;  4BBQ A;  4GND A;  3DWD A;  3SOW A;  4ZDT A;  4CCG X;  4A4C A;  5B8D A;  4P5O B;  4B7Y C;  4I7D A;  5TDW A;  4R2Y A;  2H0D A;  5H1V A;  1WGM A;  2YQL A;  2VPG A;  5I3L A;  2OXQ C;  2HYE D;  4S3O B;  1FP0 A;  1Z60 A;  2RR4 A;  4GNF A;  3ZPV E;  2UZG A;  1DVP A;  3O35 A;  5KH7 A;  4LLB A;  2Y1N A;  2AN6 A;  4AUQ B;  2L43 A;  4IC2 A;  3PUQ A;  4YBT A;  3T9K A;  3MHS A;  2L7P A;  5AIU A;  3L1X A;  2YT5 A;  5G0F A;  1WEN A;  2FD4 A;  2RSD A;  4FO9 A;  1WEW A;  4WA6 A;  2K1J A;  3M99 A;  2IQJ A;  5TRB A;  5H1U A;  5JG6 A;  2LN0 A;  3DPL R;  2DSM A;  2VJF B;  5SVI B;  1RMD A;  1X4J A;  3O36 A;  4X3G A;  5LKU A;  4MSX A;  5EYA F;  3V43 A;  5LKX A;  2M13 A;  5B77 A;  1LDJ B;  3O37 A;  2K4D A;  2JMJ A;  2CSZ A;  1VYX A;  4LKA A;  2VJE B;  1IYM A;  4PPE A;  3LVR E;  2L0B A;  1LDK C;  2ECT A;  3LQH A;  5LCW B;  2KR4 A;  4R8P K;  2LGL A;  1E4U A;  2LXP C;  4I7C A;  2P57 A;  1WEE A;  4GNE A;  4QF3 A;  4A4B A;  1WE9 A;  5B79 A;  2OWA A;  1JOC A;  2LGG A;  2IDA A;  3RPG B;  2F6J A;  3N9M A;  1JM7 B;  2KWJ A;  2HDP A;  2KYU A;  4V3K C;  2QIZ A;  2MA5 A;  2F42 A;  3SUB A;  5D1K B;  4YBM A;  2CON A;  3I2D A;  2FUI A;  2YUC A;  3MHH A;  5SVX A;  2C2V S;  4XI1 A;  2LAU A;  3LJU X;  5KH9 A;  4WZ3 B;  2KWN A;  2QJ0 A;  3ZVY A;  2CSY A;  2XOY A;  2RI7 A;  3PHD A;  1WIL A;  2KU3 A;  2XB1 A;  1WEQ A;  4MVT A;  3KQI A;  2D8U A;  4H9D A;  4BHW A;  4L58 A;  5B76 A;  4FK5 A;  2CT2 A;  2YHN A;  3N9Q A;  3LVQ E;  1CHC A;  2KE1 A;  2XEU A;  2MA6 A;  3C5K A;  3O47 A;  1ZBD B;  2EGP A;  2ZET C;  4CA1 A;  3KDE C;  2XP0 A;  4YAB A;  3EB6 A;  4IC3 A;  1X4U A;  1MBM A;  2VNF A;  2MKE A;  3U5P A;  3HCS A;  4LK9 A;  2Y43 A;  4R7E A;  2ECW A;  4PTB A;  5FB0 A;  2Y1M A;  5LKZ A;  2B0O E;  2FSA A;  3HTK C;  5DKA A;  3FAN A;  3ZNI A;  5C13 A;  2VPB A;  5LKT A;  4YAX A;  3M62 A;  2FUU A;  3U5O A;  3HCU A;  3MDB C;  2ECI A;  2YSJ A;  3IHP A;  3SHB A;  2KRE A;  4F1P A;  3LDY A;  4YC9 A;  5AIT A;  1X4I A;  4YBS A;  2MNY A;  2NAA A;  3N9N A;  3L11 A;  5DIN A;  1Z2Q A;  2YSM A;  4ZUX U;  1K2F A;  1U6G B;  2PNX A;  3FM8 C;  4C9Z A;  2ECN A;  4FJC A;  2KGI A;  3LRQ A;  2VJF A;  5G04 B;  2YW8 A;  5SVI A;  4UP0 A;  4O64 A;  2LRI C;  4S3O C;  2KIZ A;  4L7X A;  2YUR A;  4A49 A;  2E6S A;  1V87 A;  2F6N A;  3GL6 A;  5H1T A;  3QZV A;  2YYR A;  4YAD A;  4AYC B;  2VJE A;  5D1L B;  5C11 A;  2D8S A;  1VFY A;  3O33 A;  5TDR A;  4QF2 A;  2E61 A;  3N9O A;  2C2L A;  2FFW A;  2K16 A;  2I50 A;  5FEY A;  1WEV A;  4LJN A;  1N87 A;  5TAB A;  1VD4 A;  5TBN A;  2L80 A;  4AYC A;  3KV5 A;  3E2D A;  3N9L A;  1JM7 A;  3T7L A;  2LGV A;  3O70 A;  4GNG A;  4N4F A;  1BOR A;  3EB5 A;  2YRE A;  3DQV R;  1MM3 A;  2YHO A;  5KH3 A;  2H0D B;  5B75 A;  2KFT A;  4V3L C;  4GB0 A;  2JMD A; 
#chains in the Genus database with same CATH homology
 2K17 A;  4WZ0 A;  2G45 A;  2MUM A;  2G43 A;  3ZYQ A;  1HYI A;  2YU4 A;  3U5M A;  2PUY A;  4F52 B;  4W4U A;  4LAD B;  2LGK A;  2MT5 A;  1MM2 A;  4WZ2 A;  2L75 A;  1WEU A;  5J3X A;  2M1R A;  3HCT A;  3RPG C;  2E6R A;  3M63 A;  2KGG A;  3VK6 A;  3LQJ A;  4AVX A;  2MD7 B;  1FBV A;  3ZTG A;  1WFK A;  1Z6U A;  2MD8 C;  2ECV A;  3O34 A;  2G6Q A;  2JMI A;  4Q6F A;  2LDR A;  1F62 A;  1G25 A;  2CKL B;  2M6M A;  4UI9 B;  3SOX A;  2JRJ A;  5G05 B;  3O7A A;  2VP7 A;  1WEO A;  2KWO A;  2VPD A;  2L5U A;  2MIQ A;  4UP5 A;  4NN2 A;  4N3W A;  3C6W A;  2BAY A;  2MNZ A;  2EA6 A;  1T1H A;  4A0C D;  3U5N A;  2LV9 A;  1WEM A;  2CKL A;  4FIP A;  3ASL A;  2ECG A;  2EOD A;  5FER A;  1WIM A;  3N9P A;  1XWH A;  2ECJ A;  3T6R A;  3FL2 A;  3KNV A;  4B86 C;  5B78 A;  2M85 A;  3ZPV 1;  2YQM A;  3SOU A;  2DX8 A;  3NG2 A;  3RTR B;  4AP4 A;  3GV4 A;  4TKP B;  3LQI A;  2M3H A;  1HYJ A;  1WES A;  4YAT A;  2QIC A;  5H9M A;  1WEP A;  5FB1 A;  4ZQL A;  3PUR A;  2VPE A;  3L1Z B;  3KV6 A;  2LXH C;  2LQ6 A;  4I7B A;  5D1M B;  3ZVZ B;  2KWK A;  4BBQ A;  4GND A;  3SOW A;  4ZDT A;  4CCG X;  4A4C A;  5B8D A;  4P5O B;  4B7Y C;  4I7D A;  5TDW A;  4R2Y A;  2H0D A;  5H1V A;  1WGM A;  2YQL A;  2VPG A;  5I3L A;  2OXQ C;  2HYE D;  4S3O B;  1FP0 A;  1Z60 A;  4GNF A;  3ZPV E;  2UZG A;  1DVP A;  3O35 A;  5KH7 A;  4LLB A;  2Y1N A;  2AN6 A;  4AUQ B;  2L43 A;  4IC2 A;  3PUQ A;  4YBT A;  3MHS A;  5AIU A;  3L1X A;  2YT5 A;  5G0F A;  1WEN A;  2RSD A;  4FO9 A;  1WEW A;  4WA6 A;  2K1J A;  3M99 A;  5TRB A;  5H1U A;  5JG6 A;  2LN0 A;  3DPL R;  2VJF B;  1RMD A;  1X4J A;  3O36 A;  4X3G A;  5LKU A;  4MSX A;  5EYA F;  3V43 A;  5LKX A;  5B77 A;  1LDJ B;  3O37 A;  2K4D A;  2JMJ A;  2CSZ A;  1VYX A;  4LKA A;  2VJE B;  1IYM A;  4PPE A;  2L0B A;  1LDK C;  2ECT A;  3LQH A;  5LCW B;  2KR4 A;  4R8P K;  2LGL A;  1E4U A;  2LXP C;  4I7C A;  1WEE A;  4GNE A;  4QF3 A;  4A4B A;  1WE9 A;  5B79 A;  1JOC A;  2LGG A;  2IDA A;  3RPG B;  2F6J A;  3N9M A;  1JM7 B;  2KWJ A;  2HDP A;  2KYU A;  4V3K C;  2QIZ A;  2MA5 A;  2F42 A;  5D1K B;  4YBM A;  3I2D A;  2FUI A;  2YUC A;  3MHH A;  2C2V S;  4XI1 A;  5KH9 A;  4WZ3 B;  2KWN A;  2QJ0 A;  3ZVY A;  2CSY A;  3PHD A;  2RI7 A;  1WIL A;  2KU3 A;  2XB1 A;  1WEQ A;  4MVT A;  3KQI A;  4BHW A;  4L58 A;  5B76 A;  4FK5 A;  2CT2 A;  2YHN A;  3N9Q A;  1CHC A;  2KE1 A;  2XEU A;  2MA6 A;  3C5K A;  1ZBD B;  2EGP A;  2ZET C;  4CA1 A;  4YAB A;  3EB6 A;  4IC3 A;  1X4U A;  2VNF A;  3U5P A;  3HCS A;  4LK9 A;  2Y43 A;  4R7E A;  2ECW A;  4PTB A;  5FB0 A;  2Y1M A;  5LKZ A;  2FSA A;  3HTK C;  5DKA A;  3ZNI A;  5C13 A;  2VPB A;  5LKT A;  4YAX A;  3M62 A;  2FUU A;  3U5O A;  3HCU A;  2ECI A;  2YSJ A;  3IHP A;  3SHB A;  2KRE A;  4YC9 A;  5AIT A;  1X4I A;  4YBS A;  2MNY A;  2NAA A;  3N9N A;  3L11 A;  5DIN A;  1Z2Q A;  2YSM A;  4ZUX U;  1K2F A;  1U6G B;  2PNX A;  4C9Z A;  2ECN A;  4FJC A;  2KGI A;  3LRQ A;  2VJF A;  5G04 B;  2YW8 A;  4UP0 A;  4O64 A;  2LRI C;  4S3O C;  2KIZ A;  4L7X A;  2YUR A;  4A49 A;  2E6S A;  1V87 A;  2F6N A;  3GL6 A;  5H1T A;  3QZV A;  2YYR A;  4YAD A;  4AYC B;  2VJE A;  5D1L B;  5C11 A;  2D8S A;  1VFY A;  3O33 A;  5TDR A;  4QF2 A;  3N9O A;  2C2L A;  2K16 A;  2I50 A;  5FEY A;  1WEV A;  4LJN A;  1N87 A;  5TAB A;  1VD4 A;  5TBN A;  2L80 A;  4AYC A;  3KV5 A;  3N9L A;  1JM7 A;  3T7L A;  2LGV A;  3O70 A;  4GNG A;  4N4F A;  1BOR A;  3EB5 A;  2YRE A;  3DQV R;  1MM3 A;  2YHO A;  5KH3 A;  2H0D B;  5B75 A;  2KFT A;  4V3L C;  4GB0 A;  2JMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...