4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
2ECVA 5A83A 1F68A 4IR6A 2YQDA 5ENBA 2YURA 4O7AA 4FO9A 4PS5A 2OSSA 4DONA 5F62A 5A81A 5CQ7A 4YK0A 2DVVA 3MB4A 4QEWA 4XY8A 3UVYA 5DW2A 4AYCA 4BBQA 3JVLA 4YYJA 5KH3A 4TT4A 5FE1A 5LUUA 5CY9A 1DVPA 5JG6A 4TT6A 2N9GA 3M99A 2F42A 5A82A 2LGKA 1WE9A 3Q2FA 2LGLA 5FBXA 4FIPA 4C9ZA 4LZRA 4L7XA 4O77A 4S3OB 5JI8A 2YT5A 4YBTA 4N3WA 5I1QA 3LQHA 4HBYA 3P1CA 4HBXA 5HFRA 4CUTA 1VYXA 4XUAA 5F2PA 3O7AA 5IGNA 5FE2A 1U6GB 5DINA 2ECTA 4WA6A 4J0SA 4LRGA 5E9MA 1FP0A 2YQLA 4YY6A 5D26A 2RNXA 2KFTA 3ZVZB 3HCUA 5DKCA 4Z6IA 4MR6A 3NG2A 5ENCA 5CUCA 5CUBA 3LQJA 4A9KA 5CUDA 4NQNA 2DATA 2L43A 5ENJA 5L8TA 4UIVA 4WIVA 4QSVA 5E73A 5IGLA 4ZDTA 5D25A 1WILA 2RFJA 3JVJA 5LCWB 5L97A 3LXJA 4MEOA 5C89A 4N4GA 3MQMA 4YYIA 5CQ3A 4UIWA 5DKAA 1X0JA 3LQIA 1WUMA 2F6JA 4KCXA 1WEMA 4XI1A 1F62A 4Y03A 3SOWA 4UIXA 3L11A 4A0CD 4B7YC 5I29A 4B86C 1EQFA 3U5KA 4XYAA 5HRXA 5D1KB 3UV2A 4TKPB 4QSUA 2MA5A 4N4HA 2YQMA 3K2JA 4RVRA 4O78A 5D3HA 5CGPA 5EGUA 5I83A 2HYED 4NN2A 4UIYA 5B8DA 3RCWA 4V3KC 4LYWA 5EP7A 5FH6A 2FUUA 5ENGA 3O34A 3SOUA 5HQ5A 5D3SA 3UW9A 5CRMA 4NXJA 5LVRA 2G43A 4O7CA 4UYHA 2CT2A 3N9NA 3TLPA 1V87A 4I7BA 4CUQA 5FFWA 2LSPB 4UYFB 5A5RA 2AN6A 2IDAA 3ASLA 3HMEA 2C2LA 2KIZA 5HLSA 2FUIA 5DFBA 2K17A 5HENA 2L5UA 4CLBA 2ECNA 4BHWA 5AMEA 3DPLR 4UYEA 4YH4A 3P1DA 4TYLA 2E6SA 2KYUA 2EGPA 3NXBA 3U5PA 3SHBA 4HXNA 5IIDA 2KWNA 3P1FA 5L99A 1Z60A 4UIUA 5EVAA 4QB3A 1WEPA 5L8UA 3N9PA 2R0VA 5I86A 1MM3A 2NAAA 4IR4A 5FFYA 2MIQA 5D1LB 3G0JA 1WEWA 4LZ2A 4UIZA 4A9OA 5HCLA 2DWWA 1WEEA 5F5ZA 5HQ6A 5TB6A 2ECWA 5CTLA 4IC3A 4GNEA 3U5OA 1WESA 5A5PA 5EWCA 5KTWA 5EISA 5A5QA 3GV4A 3UV5A 4NRAA 4MVTA 2YYNA 4O70A 2LXHC 5LKXA 4QEUA 5FE5A 4YAXA 5D3RA 2VPEA 5CUAA 5H85A 5F3AA 1JOCA 2R0SA 2D9EA 4MEQA 3HMFA 2JRJA 4HXPA 2MA6A 1HYJA 5FE4A 5D3PA 2K16A 4UYGA 5F61A 4N4IA 5FE9A 5D3LA 3D7CA 4HXLA 4AYCB 3O35A 5CPEA 3AQAA 4NR4A 5BT3A 5IBNA 3MHSA 3SVGA 4W4UA 5ENEA 2K4DA 5LKUA 2I7KA 2YU4A 4YYNA 5FB0A 4IR5A 4LR6A 4TTEA 4GNFA 5FE0A 2EA6A 1X4IA 4NUCA 4AVXA 5EU1A 1MM2A 3ZNIA 4YATA 3DQVR 4V3LC 2YEMA 5FE6A 5A5SA 5EV9A 2VP7A 2BAYA 3JVMA 4QEVA 5COIA 1N72A 5FG6A 2NXBA 4MR4A 3HCSA 5CQ6A 1BORA 5F1HA 3I3JA 4O7EA 5DX4A 5HFQA 4J3IA 2YSJA 1WFKA 3MHHA 4LK9A 1JM7B 2ECGA 5FB1A 4HXSA 4O64A 2L75A 2KWKA 2M6MA 4CA1A 2D82A 5D7XA 5CUGA 5G05B 5FE8A 4NR7A 4OGIA 5CQ5A 1K2FA 5TRBA 4O7BA 3T7LA 3UVXA 5J3XA 5AITA 3C6WA 4FJCA 2YEKA 4QSWA 1JM7A 2YYRA 5A7CA 5H1TA 4UITA 5FH8A 4ZC9A 5CS8A 4CUPA 3LRQA 5DKHA 4A49A 1WIMA 2MUMA 3AADA 4NR8A 4NR9A 2L5EA 4QZSA 5E9KA 4GPJA 4NQMA 5EA1A 2MD7B 4J0RA 3ONIA 5D0CA 4YYMA 5LKTA 4BW1A 4NRCA 1ZS5A 4IC2A 2YDWA 4Z6HA 4AP4A 4O71A 2VPDA 2G45A 4MENA 4AUQB 3ZVYA 5DLXA 4IOOA 4A9JA 4NUEA 4O76A 4Q0OA 2CKLB 2I8NA 2I50A 4QSQA 2VPBA 4YYDA 2L0BA 2LXPC 4R7EA 4NRBA 1Z2QA 2YW5A 5CQAA 5I3LA 5DYUA 5EWWA 3PUQA 1CHCA 2RNWA 4QSRA 5I89A 5EYAF 5FFVA 2JMDA 3LJWA 4MEPA 3N9MA 5G0FA 5C8GA 2CKLA 5EI4A 2HDPA 4O72A 2CSZA 2UZGA 5EPRA 5A85A 3P5OA 3DAIA 4NUDA 2DVRA 2G4AA 4HXMA 3O33A 5FDZA 1WEUA 5DBMA 4LKAA 5DY7A 5EK9A 3U5NA 5DKDA 5CQ8A 2KWJA 4LLBA 5LKZA 4BJXA 4Q6FA 2OXQC 2VPGA 4ALHA 3G0LA 5LJ0A 5H9MA 4N4FA 4E96A 2WP1A 4QNSA 2QIZA 5KU3A 3EB5A 2JMIA 5DFCA 5AD2A 5CQ4A 5ETDA 4CUUA 3O36A 5TBNA 3QZSA 4A4CA 4ALGA 4F52B 5F25A 2FSAA 5KO4A 5ENIA 1LDKC 3ZYQA 4I7CA 4QR3A 5CU8A 2KTBB 4MR3A 2OUOA 5H1UA 5C87A 5L96A 5D3NA 3MUKA 2DKWA 2LQ6A 2RS9B 2MNYA 2L84A 5A5OA 3SVHA 5C11A 1WEOA 5AIUA 5EPBA 4HBWA 4PCIA 3N9OA 1VD4A 4UI9B 4NS5A 4R2YA 5F60A 3IU5A 4QSXA 4QYDA 3IU6A 4CURA 4WZ3B 2LN0A 4L58A 2OO1A 5E9LA 5HQ7A 4LJNA 4LYSA 4PY6A 4TU6A 5FE7A 5E3DA 5IGKA 4WHUA 4YYGA 1FBVA 1WGMA 1XWHA 3N9LA 3UV4A 4IR3A 5LJ1A 1ZBDB 3C5KA 1WENA 3M62A 5G4RA 2ECJA 5C4QA 2E6RA 4Z1SA 3MULA 4YYHA 5EICA 2KR4A 5I7YA 4FLPA 4OGJA 2QICA 4XY9A 5DFDA 2F6NA 4UP0A 4IORA 2LGGA 3FKMX 3GG3A 2MNZA 2YREA 5F36A 2K1JA 1HYIA 3HCTA 1X4JA 5B75A 2ECIA 2PUYA 5KH7A 2KE1A 2YELA 3GL6A 1IYMA 2VNFA 2Y1NA 4O7FA 4P5OB 3RPGC 5TDWA 5D1MB 5D3TA 4QF2A 4A9MA 5DYAA 2YUCA 4KV4A 4R8PK 4LADB 5I88A 4QC3A 5FE3A 4A9IA 3UVWA 5KTXA 3U5LA 4NR5A 4QY4A 2KGGA 3EB6A 2KU3A 5FG5A 5LVQA 4HXRA 5L98A 2KGIA 4QSPA 5DLZA 4OUFA 1Z6UA 5EM3A 5FH7A 3U5JA 3M63A 5CRZA 3ZPV1 5HEMA 5C13A 5TCMA 5F63A 4NYWA 5I7XA 4YBSA 5ETBA 4GNDA 4GB0A 5CFWA 4LZSA 4PTBA 5IGMA 4LDFA 5CUEA 1LDJB 5FG4A 5CP5A 3MXFA 2L85A 3O37A 5CQTA 5H1VA 4PPEA 4ZQLA 5ENFA 4FK5A 5DW1A 3JVKA 4J1PA 2PNXA 4QUUA 5HRVA 3VK6A 4NYXA 4YH3A 4F3IA 5D3JA 1VFYA 5BT5A 4QBMA 5G4SA 3SVFA 2MT5A 2VJFB 5B76A 4ZUXU 3ZPVE 5CZGA 5I40A 5E3GA 2E7OA 5E9VA 3HMHA 4BW4A 5TDRA 3UVDA 4YBMA 2LRIC 2WP2A 4A9HA 3SOXA 4TZ8A 4A9EA 4CFLA 5AMFA 4NR6A 3O70A 3S92A 4C67A 2Y1MA 4TS8A 4BW2A 2D8SA 5EWHA 4TT2A 2VJFA 5E74A 4HXOA 5D24A 5I80A 2H60A 4HBVA 4YY4A 4PKLA 2XB1A 2YW8A 5HELA 5HRWA 3MB3A 4QSTA 2VJEB 5TABA 1JM4B 4QC1A 4WZ0A 1WUGA 4Z93A 4QF3A 5E0RA 4IOQA 4QSSA 5KHMA 2ZETC 5KTUA 3QZVA 4CCGX 4QYLA 5DYXA 3L1XA 2R0YA 5ENHA 4S3OC 2YHNA 5FERA 4LYIA 4CL9A 1T1HA 2KWOA 2LDRA 3IHPA 3N9QA 2E7NA 3ZYUA 4WHWA 2DVQA 5JWMA 3PURA 4WZ2A 2GRCA 3RPGB 3FL2A 2VJEA 4MR5A 4A9LA 4A9FA 2DX8A 2RI7A 4YC9A 2Y43A 1N87A 2M1RA 3RTRB 5HJCA 3ZTGA 5EWVA 4CUSA 5EPSA 2DVSA 5LJ2A 1WEQA 5B77A 3T6RA 4KV1A 4PCEA 3PHDA 4QUTA 4YABA 4O74A 2RO1A 3P1EA 2CSYA 1X4UA 4I7DA 5E7DA 5K29A 4LC2A 4UYFA 1E4UA 4YYKA 3KQIA 5IG6A 5G04B 5FEYA 3S91A 5B79A 5EWDA 2YSMA 2YHOA 4BW3A 2LGVA 4HXKA 4TZ2A 2G6QA 4A9NA 5HM0A 4A4BA 4QR5A 4UYDA 5EQ1A 4C66A 2M85A 2L80A 4UP5A 2RSDA 4NYVA 4TU4A 2R10A 2LV9A 2H0DB 5AD3A 1E6IA 2MJVB 4ZW1A 5BT4A 4YADA 5C85A 3V43A 5E9IA 2KREA 5E9YA 4Z1QA 3Q2EA 4GNGA 4QR4A 2JMJA 3HTKC 2M3HA 3QZTA 5KH9A 3DWYA 4XUBA 5DYCA 2EODA 3KNVA 2MD8C 4X2IA 3KV6A 1RMDA 5F1LA 5ACYA 4MSXA 1G25A 3KV5A 5II2A 4TQNA 5J0DA 4Q0NA 5II1A 2H0DA 4X3GA 2C2VS 5A5NA 1JSPB 2E3KA 3I2DA 3U5MA 2RNYA 4CFKA 4AKNA 1WEVA 2QJ0A 5C7NA 4O75A 2XEUA 5B78A 3L1ZB
chains in the Genus database with same CATH superfamily
2ECVA 5A83A 1F68A 4IR6A 2YQDA 5ENBA 2YURA 4O7AA 4FO9A 4PS5A 2OSSA 4DONA 5F62A 5A81A 5CQ7A 4Z0OA 4YK0A 2DVVA 3MB4A 4QEWA 4XY8A 3UVYA 5DW2A 4AYCA 4BBQA 3JVLA 4YYJA 5KH3A 4TT4A 5FE1A 5LUUA 5CY9A 1DVPA 2XOYA 5JG6A 4TT6A 3VKGA 2N9GA 3M99A 3T9KA 2F42A 5A82A 2LGKA 1WE9A 3Q2FA 2LGLA 5SVIB 5FBXA 4FIPA 2L7PA 4C9ZA 4LZRA 4L7XA 4O77A 4S3OB 5JI8A 2CSVA 2YT5A 4YBTA 4H9DA 5K3QA 4N3WA 3ERRA 5I1QA 3LQHA 4HBYA 3P1CA 4HBXA 5HFRA 4CUTA 1VYXA 4XUAA 5F2PA 3O7AA 5IGNA 5FE2A 1U6GB 5SVIA 5DINA 2ECTA 4WA6A 4J0SA 4LRGA 5E9MA 1FP0A 2YQLA 4YY6A 5D26A 1MBMA 2RNXA 2KFTA 3ZVZB 3HCUA 5DKCA 4Z6IA 4MR6A 3NG2A 5ENCA 5CUCA 5CUBA 3LQJA 4OGEA 4A9KA 5CUDA 4NQNA 2DATA 2L43A 5ENJA 5L8TA 4UIVA 4WIVA 2FD4A 4QSVA 5E73A 5IGLA 4ZDTA 2EGMA 5D25A 1WILA 2RFJA 3JVJA 3MDBC 5LCWB 5L97A 3LXJA 4MEOA 5C89A 4N4GA 3MQMA 4YYIA 5CQ3A 4UIWA 5DKAA 1X0JA 3LQIA 1WUMA 2F6JA 4KCXA 1WEMA 4XI1A 1F62A 4Y03A 3SOWA 4UIXA 3L11A 4A0CD 4B7YC 5I29A 4B86C 1EQFA 3U5KA 4XYAA 5HRXA 5D1KB 3UV2A 3SUBA 4TKPB 4QSUA 2MA5A 4N4HA 4F1PA 2YQMA 3K2JA 4RVRA 4O78A 5D3HA 5CGPA 5EGUA 5I83A 2D8UA 2HYED 4UIYA 4NN2A 3RCWA 4V3KC 4LYWA 5EP7A 5FH6A 2FUUA 5ENGA 3O34A 3SOUA 5HQ5A 5SVXA 5D3SA 2JM3A 3UW9A 5CRMA 4NXJA 5LVRA 2G43A 4O7CA 4UYHA 2CT2A 3N9NA 3TLPA 1V87A 2RR4A 4I7BA 4CUQA 5FFWA 2LSPB 4UYFB 2P57A 5A5RA 2AN6A 2IDAA 3ASLA 3HMEA 2C2LA 2KIZA 5HLSA 2FUIA 5SVYA 5DFBA 2K17A 5HENA 2L5UA 4CLBA 2ECNA 4BHWA 5AMEA 2OWAA 3DPLR 3PLWA 4UYEA 2IQJA 4YH4A 3P1DA 4TYLA 2E6SA 2KYUA 2EGPA 3NXBA 3U5PA 3SHBA 4HXNA 5IIDA 2KWNA 3P1FA 5L99A 1Z60A 4UIUA 5EVAA 2CRRA 4QB3A 1WEPA 5L8UA 3N9PA 2R0VA 5I86A 1MM3A 2NAAA 4IR4A 5FFYA 2FFWA 2MIQA 5D1LB 3G0JA 1WEWA 4LZ2A 4UIZA 4A9OA 5HCLA 2DWWA 1WEEA 5F5ZA 5HQ6A 5TB6A 2ECWA 3Q1DA 5CTLA 4IC3A 4GNEA 3U5OA 1WESA 5A5PA 5EWCA 5KTWA 5EISA 5A5QA 2EXUA 3GV4A 3UV5A 4NRAA 4MVTA 2YYNA 4O70A 2LXHC 5LKXA 4QEUA 5FE5A 4YAXA 5D3RA 2VPEA 5CUAA 5H85A 5F3AA 1JOCA 2R0SA 2D9EA 4MEQA 3HMFA 2JRJA 4HXPA 2MA6A 1HYJA 5FE4A 5D3PA 2K16A 4UYGA 5F61A 3O47A 4N4IA 5FE9A 5D3LA 3D7CA 4HXLA 2KKXA 4AYCB 3O35A 5CPEA 3AQAA 4NR4A 5BT3A 5IBNA 3MHSA 3SVGA 4W4UA 5B8DA 5ENEA 2K4DA 5LKUA 2I7KA 2YU4A 4YYNA 5FB0A 4IR5A 4LR6A 4TTEA 4GNFA 5FE0A 2EA6A 1X4IA 4NUCA 4AVXA 5EU1A 1MM2A 3ZNIA 4YATA 3DQVR 4V3LC 2YEMA 5FE6A 5A5SA 5EV9A 2VP7A 1DCQA 2BAYA 3JVMA 4QEVA 5COIA 1N72A 5FG6A 2NXBA 4MR4A 3HCSA 5CQ6A 1BORA 5F1HA 3I3JA 2M13A 4O7EA 5DX4A 5HFQA 4J3IA 2YSJA 1WFKA 3MHHA 2XOZA 4LK9A 2ECGA 5FB1A 1JM7B 4HXSA 4O64A 2L75A 2KWKA 2M6MA 4CA1A 2D82A 5D7XA 5CUGA 5G05B 5FE8A 3DWDA 4NR7A 4OGIA 5CQ5A 1K2FA 5TRBA 4O7BA 3T7LA 3UVXA 5J3XA 5AITA 3C6WA 4FJCA 2YEKA 4QSWA 1JM7A 2YYRA 5A7CA 5H1TA 4UITA 5FH8A 4ZC9A 5CS8A 4CUPA 3LRQA 5DKHA 4A49A 1WIMA 2MUMA 3AADA 4NR8A 4NR9A 2L5EA 4QZSA 5E9KA 4GPJA 4NQMA 5EA1A 2MD7B 4J0RA 3ONIA 5D0CA 4YYMA 5LKTA 4BW1A 4NRCA 2EJNA 3KDEC 1ZS5A 4IC2A 2YDWA 4Z6HA 4AP4A 4O71A 2VPDA 2G45A 4MENA 4AUQB 3ZVYA 5DLXA 4IOOA 4A9JA 4NUEA 4O76A 4Q0OA 2CKLB 2I8NA 2I50A 4QSQA 2VPBA 4YYDA 2L0BA 2LXPC 4AKGA 4R7EA 4NRBA 1Z2QA 2YW5A 5CQAA 5I3LA 5DYUA 5EWWA 2XP0A 1CHCA 2RNWA 3PUQA 4QSRA 5I89A 5EYAF 5FFVA 2JMDA 3LJWA 4MEPA 3N9MA 5G0FA 5C8GA 2CKLA 2E61A 5EI4A 2HDPA 1ZKRA 4O72A 2CSZA 5EPRA 2UZGA 5A85A 3P5OA 3DAIA 4NUDA 3FJUB 2DVRA 2G4AA 4HXMA 3O33A 5FDZA 1WEUA 5DBMA 4LKAA 5DY7A 5EK9A 3U5NA 5DKDA 5CQ8A 2KWJA 4O62A 4LLBA 5LKZA 4BJXA 3LDYA 3FAOA 2OXQC 4Q6FA 2VPGA 4ALHA 3G0LA 2B0OE 5LJ0A 5H9MA 4N4FA 4E96A 4QQ4A 2WP1A 4QNSA 2QIZA 5KU3A 3EB5A 2JMIA 5DFCA 5AD2A 5CQ4A 5ETDA 4CUUA 3O36A 5TBNA 3QZSA 4A4CA 4ALGA 4F52B 5F25A 2FSAA 5KO4A 5ENIA 4AI6A 1LDKC 3ZYQA 4I7CA 4QR3A 5CU8A 2KTBB 4MR3A 2OUOA 5H1UA 5C87A 5L96A 5D3NA 3MUKA 2DKWA 2LQ6A 2RS9B 2MNYA 2L84A 5A5OA 3SVHA 5C11A 1WEOA 5AIUA 5EPBA 4HBWA 4PCIA 3N9OA 1VD4A 4UI9B 4NS5A 4R2YA 5F60A 3IU5A 4QSXA 4QYDA 3IU6A 4CURA 3M7KA 4WZ3B 2LN0A 4L58A 2OO1A 5E9LA 5HQ7A 4LJNA 4LYSA 4PY6A 4TU6A 5FE7A 5E3DA 5IGKA 4WHUA 4YYGA 1FBVA 1WGMA 1XWHA 3N9LA 3LVQE 3UV4A 4IR3A 5LJ1A 1ZBDB 3C5KA 1WENA 3M62A 5G4RA 2ECJA 5C4QA 2E6RA 4Z1SA 3MULA 4YYHA 5EICA 2KR4A 5I7YA 4FLPA 4OGJA 2QICA 4XY9A 2F6NA 5DFDA 4UP0A 4IORA 2LGGA 3FKMX 3GG3A 2MNZA 2YREA 5F36A 2K1JA 1HYIA 3HCTA 1X4JA 4OGCA 5B75A 2ECIA 2PUYA 5KH7A 2KE1A 2YELA 3GL6A 1IYMA 3DDTA 2VNFA 3E2DA 2Y1NA 4O7FA 4P5OB 3RPGC 2CRWA 5D1MB 5TDWA 5D3TA 4QF2A 4A9MA 5DYAA 2YUCA 4KV4A 4R8PK 2LAUA 4LADB 3D1DA 5I88A 4QC3A 5FE3A 4A9IA 3UVWA 2DSMA 5KTXA 3U5LA 4NR5A 4QY4A 2KGGA 3EB6A 2KU3A 5FG5A 5LVQA 4HXRA 5L98A 2KGIA 4QSPA 5DLZA 4OUFA 1Z6UA 5EM3A 5FH7A 4Z0RA 3U5JA 3M63A 3LVRE 5CRZA 3ZPV1 5HEMA 3LJUX 5C13A 1PUOA 5TCMA 5F63A 2KKYA 4NYWA 5I7XA 4YBSA 5ETBA 4GNDA 4GB0A 5CFWA 3JUEA 4LZSA 4PTBA 5IGMA 4LDFA 5CUEA 1LDJB 5FG4A 5CP5A 3MXFA 2L85A 3O37A 5CQTA 5H1VA 4PPEA 4ZQLA 5ENFA 4FK5A 5DW1A 3JVKA 4J1PA 2PNXA 4QUUA 5HRVA 3VK6A 4NYXA 4YH3A 3FANA 4F3IA 5D3JA 4AKIA 1VFYA 5BT5A 4QBMA 5G4SA 3SVFA 2MT5A 2VJFB 5B76A 4ZUXU 2MKEA 2CONA 3ZPVE 3FM8C 5CZGA 2JUNA 5I40A 5E3GA 2E7OA 5E9VA 3HMHA 4BW4A 5TDRA 3UVDA 4YBMA 2LRIC 2WP2A 4A9HA 3SOXA 4TZ8A 4A9EA 4CFLA 5AMFA 4NR6A 3O70A 3S92A 4C67A 2Y1MA 4TS8A 4BW2A 2D8SA 5EWHA 4TT2A 2VJFA 5E74A 4HXOA 5D24A 5I80A 2H60A 4HBVA 4YY4A 4PKLA 2XB1A 2YW8A 5HELA 5HRWA 3D1BA 3MB3A 4QSTA 2VJEB 5TABA 1JM4B 4QC1A 4WZ0A 1WUGA 4Z93A 4QF3A 5E0RA 4IOQA 4QSSA 5KHMA 2ZETC 5KTUA 3QZVA 4CCGX 3H7HA 4QYLA 5DYXA 3L1XA 2R0YA 5ENHA 2DJAA 4S3OC 2YHNA 5FERA 4LYIA 4CL9A 1T1HA 2KWOA 2LDRA 3IHPA 3N9QA 2E7NA 3ZYUA 4WHWA 2DVQA 5JWMA 3PURA 4WZ2A 2GRCA 3RPGB 3FL2A 2VJEA 4MR5A 4A9LA 4A9FA 2DX8A 2RI7A 4YC9A 2Y43A 1N87A 2M1RA 3RTRB 5HJCA 3ZTGA 5EWVA 4CUSA 5EPSA 2DVSA 5LJ2A 1WEQA 5B77A 3T6RA 4KV1A 4PCEA 3PHDA 4QUTA 4YABA 4O74A 2RO1A 3P1EA 2CSYA 1X4UA 4I7DA 5E7DA 5K29A 4LC2A 4UYFA 1E4UA 4YYKA 3KQIA 5IG6A 5G04B 5FEYA 3S91A 5B79A 5EWDA 2YSMA 2YHOA 4BW3A 2LGVA 4HXKA 4TZ2A 2G6QA 4A9NA 5HM0A 2XOCA 4AKHA 4A4BA 4QR5A 4UYDA 5EQ1A 4C66A 2M85A 2L80A 4UP5A 2RSDA 3FEHA 4NYVA 4TU4A 2R10A 2LV9A 2H0DB 5AD3A 1E6IA 2MJVB 4ZW1A 5BT4A 4YADA 5C85A 3V43A 5E9IA 2KREA 5E9YA 4Z1QA 3Q2EA 4GNGA 4QR4A 2JMJA 3HTKC 2M3HA 3QZTA 5KH9A 3DWYA 4XUBA 5DYCA 2EODA 3KNVA 2MD8C 4X2IA 3KV6A 1RMDA 5F1LA 5ACYA 4MSXA 1G25A 2YVRA 3KV5A 5II2A 4TQNA 5J0DA 4Q0NA 5II1A 2H0DA 4X3GA 2C2VS 5A5NA 1JSPB 2E3KA 3I2DA 3U5MA 2RNYA 4CFKA 4AKNA 1WEVA 2QJ0A 5C7NA 4O75A 2XEUA 3VKHA 5B78A 3L1ZB
chains in the Genus database with same CATH topology
2ECVA 5A83A 1F68A 4IR6A 2YQDA 5ENBA 2YURA 4O7AA 4FO9A 4PS5A 2OSSA 4DONA 5F62A 5A81A 5CQ7A 4YK0A 2DVVA 3MB4A 4QEWA 4XY8A 3UVYA 5DW2A 4AYCA 4BBQA 3JVLA 4YYJA 5KH3A 4TT4A 5FE1A 5LUUA 5CY9A 1DVPA 5JG6A 4TT6A 2N9GA 3M99A 2F42A 5A82A 2LGKA 1WE9A 3Q2FA 2LGLA 5FBXA 4FIPA 4C9ZA 4LZRA 4L7XA 4O77A 4S3OB 5JI8A 2YT5A 4YBTA 4N3WA 5I1QA 3LQHA 4HBYA 3P1CA 4HBXA 5HFRA 4CUTA 1VYXA 4XUAA 5F2PA 3O7AA 5IGNA 5FE2A 1U6GB 5DINA 2ECTA 4WA6A 4J0SA 4LRGA 5E9MA 1FP0A 2YQLA 4YY6A 5D26A 2RNXA 2KFTA 3ZVZB 3HCUA 5DKCA 4Z6IA 4MR6A 3NG2A 5ENCA 5CUCA 5CUBA 3LQJA 4A9KA 5CUDA 4NQNA 2DATA 2L43A 5ENJA 5L8TA 4UIVA 4WIVA 4QSVA 5E73A 5IGLA 4ZDTA 5D25A 1WILA 2RFJA 3JVJA 5LCWB 5L97A 3LXJA 4MEOA 5C89A 4N4GA 3MQMA 4YYIA 5CQ3A 4UIWA 5DKAA 1X0JA 3LQIA 1WUMA 2F6JA 4KCXA 1WEMA 4XI1A 1F62A 4Y03A 3SOWA 4UIXA 3L11A 4A0CD 4B7YC 5I29A 4B86C 1EQFA 3U5KA 4XYAA 5HRXA 5D1KB 3UV2A 4TKPB 4QSUA 2MA5A 4N4HA 2YQMA 3K2JA 4RVRA 4O78A 5D3HA 5CGPA 5EGUA 5I83A 2HYED 4NN2A 4UIYA 5B8DA 3RCWA 4V3KC 4LYWA 5EP7A 5FH6A 2FUUA 5ENGA 3O34A 3SOUA 5HQ5A 5D3SA 3UW9A 5CRMA 4NXJA 5LVRA 2G43A 4O7CA 4UYHA 2CT2A 3N9NA 3TLPA 1V87A 4I7BA 4CUQA 5FFWA 2LSPB 4UYFB 5A5RA 2AN6A 2IDAA 3ASLA 3HMEA 2C2LA 2KIZA 5HLSA 2FUIA 5DFBA 2K17A 5HENA 2L5UA 4CLBA 2ECNA 4BHWA 5AMEA 3DPLR 4UYEA 4YH4A 3P1DA 4TYLA 2E6SA 2KYUA 2EGPA 3NXBA 3U5PA 3SHBA 4HXNA 5IIDA 2KWNA 3P1FA 5L99A 1Z60A 4UIUA 5EVAA 4QB3A 1WEPA 5L8UA 3N9PA 2R0VA 5I86A 1MM3A 2NAAA 4IR4A 5FFYA 2MIQA 5D1LB 3G0JA 1WEWA 4LZ2A 4UIZA 4A9OA 5HCLA 2DWWA 1WEEA 5F5ZA 5HQ6A 5TB6A 2ECWA 5CTLA 4IC3A 4GNEA 3U5OA 1WESA 5A5PA 5EWCA 5KTWA 5EISA 5A5QA 3GV4A 3UV5A 4NRAA 4MVTA 2YYNA 4O70A 2LXHC 5LKXA 4QEUA 5FE5A 4YAXA 5D3RA 2VPEA 5CUAA 5H85A 5F3AA 1JOCA 2R0SA 2D9EA 4MEQA 3HMFA 2JRJA 4HXPA 2MA6A 1HYJA 5FE4A 5D3PA 2K16A 4UYGA 5F61A 4N4IA 5FE9A 5D3LA 3D7CA 4HXLA 4AYCB 3O35A 5CPEA 3AQAA 4NR4A 5BT3A 5IBNA 3MHSA 3SVGA 4W4UA 5ENEA 2K4DA 5LKUA 2I7KA 2YU4A 4YYNA 5FB0A 4IR5A 4LR6A 4TTEA 4GNFA 5FE0A 2EA6A 1X4IA 4NUCA 4AVXA 5EU1A 1MM2A 3ZNIA 4YATA 3DQVR 4V3LC 2YEMA 5FE6A 5A5SA 5EV9A 2VP7A 2BAYA 3JVMA 4QEVA 5COIA 1N72A 5FG6A 2NXBA 4MR4A 3HCSA 5CQ6A 1BORA 5F1HA 3I3JA 4O7EA 5DX4A 5HFQA 4J3IA 2YSJA 1WFKA 3MHHA 4LK9A 1JM7B 2ECGA 5FB1A 4HXSA 4O64A 2L75A 2KWKA 2M6MA 4CA1A 2D82A 5D7XA 5CUGA 5G05B 5FE8A 4NR7A 4OGIA 5CQ5A 1K2FA 5TRBA 4O7BA 3T7LA 3UVXA 5J3XA 5AITA 3C6WA 4FJCA 2YEKA 4QSWA 1JM7A 2YYRA 5A7CA 5H1TA 4UITA 5FH8A 4ZC9A 5CS8A 4CUPA 3LRQA 5DKHA 4A49A 1WIMA 2MUMA 3AADA 4NR8A 4NR9A 2L5EA 4QZSA 5E9KA 4GPJA 4NQMA 5EA1A 2MD7B 4J0RA 3ONIA 5D0CA 4YYMA 5LKTA 4BW1A 4NRCA 1ZS5A 4IC2A 2YDWA 4Z6HA 4AP4A 4O71A 2VPDA 2G45A 4MENA 4AUQB 3ZVYA 5DLXA 4IOOA 4A9JA 4NUEA 4O76A 4Q0OA 2CKLB 2I8NA 2I50A 4QSQA 2VPBA 4YYDA 2L0BA 2LXPC 4R7EA 4NRBA 1Z2QA 2YW5A 5CQAA 5I3LA 5DYUA 5EWWA 3PUQA 1CHCA 2RNWA 4QSRA 5I89A 5EYAF 5FFVA 2JMDA 3LJWA 4MEPA 3N9MA 5G0FA 5C8GA 2CKLA 5EI4A 2HDPA 4O72A 2CSZA 2UZGA 5EPRA 5A85A 3P5OA 3DAIA 4NUDA 2DVRA 2G4AA 4HXMA 3O33A 5FDZA 1WEUA 5DBMA 4LKAA 5DY7A 5EK9A 3U5NA 5DKDA 5CQ8A 2KWJA 4LLBA 5LKZA 4BJXA 4Q6FA 2OXQC 2VPGA 4ALHA 3G0LA 5LJ0A 5H9MA 4N4FA 4E96A 2WP1A 4QNSA 2QIZA 5KU3A 3EB5A 2JMIA 5DFCA 5AD2A 5CQ4A 5ETDA 4CUUA 3O36A 5TBNA 3QZSA 4A4CA 4ALGA 4F52B 5F25A 2FSAA 5KO4A 5ENIA 1LDKC 3ZYQA 4I7CA 4QR3A 5CU8A 2KTBB 4MR3A 2OUOA 5H1UA 5C87A 5L96A 5D3NA 3MUKA 2DKWA 2LQ6A 2RS9B 2MNYA 2L84A 5A5OA 3SVHA 5C11A 1WEOA 5AIUA 5EPBA 4HBWA 4PCIA 3N9OA 1VD4A 4UI9B 4NS5A 4R2YA 5F60A 3IU5A 4QSXA 4QYDA 3IU6A 4CURA 4WZ3B 2LN0A 4L58A 2OO1A 5E9LA 5HQ7A 4LJNA 4LYSA 4PY6A 4TU6A 5FE7A 5E3DA 5IGKA 4WHUA 4YYGA 1FBVA 1WGMA 1XWHA 3N9LA 3UV4A 4IR3A 5LJ1A 1ZBDB 3C5KA 1WENA 3M62A 5G4RA 2ECJA 5C4QA 2E6RA 4Z1SA 3MULA 4YYHA 5EICA 2KR4A 5I7YA 4FLPA 4OGJA 2QICA 4XY9A 5DFDA 2F6NA 4UP0A 4IORA 2LGGA 3FKMX 3GG3A 2MNZA 2YREA 5F36A 2K1JA 1HYIA 3HCTA 1X4JA 5B75A 2ECIA 2PUYA 5KH7A 2KE1A 2YELA 3GL6A 1IYMA 2VNFA 2Y1NA 4O7FA 4P5OB 3RPGC 5TDWA 5D1MB 5D3TA 4QF2A 4A9MA 5DYAA 2YUCA 4KV4A 4R8PK 4LADB 5I88A 4QC3A 5FE3A 4A9IA 3UVWA 5KTXA 3U5LA 4NR5A 4QY4A 2KGGA 3EB6A 2KU3A 5FG5A 5LVQA 4HXRA 5L98A 2KGIA 4QSPA 5DLZA 4OUFA 1Z6UA 5EM3A 5FH7A 3U5JA 3M63A 5CRZA 3ZPV1 5HEMA 5C13A 5TCMA 5F63A 4NYWA 5I7XA 4YBSA 5ETBA 4GNDA 4GB0A 5CFWA 4LZSA 4PTBA 5IGMA 4LDFA 5CUEA 1LDJB 5FG4A 5CP5A 3MXFA 2L85A 3O37A 5CQTA 5H1VA 4PPEA 4ZQLA 5ENFA 4FK5A 5DW1A 3JVKA 4J1PA 2PNXA 4QUUA 5HRVA 3VK6A 4NYXA 4YH3A 4F3IA 5D3JA 1VFYA 5BT5A 4QBMA 5G4SA 3SVFA 2MT5A 2VJFB 5B76A 4ZUXU 3ZPVE 5CZGA 5I40A 5E3GA 2E7OA 5E9VA 3HMHA 4BW4A 5TDRA 3UVDA 4YBMA 2LRIC 2WP2A 4A9HA 3SOXA 4TZ8A 4A9EA 4CFLA 5AMFA 4NR6A 3O70A 3S92A 4C67A 2Y1MA 4TS8A 4BW2A 2D8SA 5EWHA 4TT2A 2VJFA 5E74A 4HXOA 5D24A 5I80A 2H60A 4HBVA 4YY4A 4PKLA 2XB1A 2YW8A 5HELA 5HRWA 3MB3A 4QSTA 2VJEB 5TABA 1JM4B 4QC1A 4WZ0A 1WUGA 4Z93A 4QF3A 5E0RA 4IOQA 4QSSA 5KHMA 2ZETC 5KTUA 3QZVA 4CCGX 4QYLA 5DYXA 3L1XA 2R0YA 5ENHA 4S3OC 2YHNA 5FERA 4LYIA 4CL9A 1T1HA 2KWOA 2LDRA 3IHPA 3N9QA 2E7NA 3ZYUA 4WHWA 2DVQA 5JWMA 3PURA 4WZ2A 2GRCA 3RPGB 3FL2A 2VJEA 4MR5A 4A9LA 4A9FA 2DX8A 2RI7A 4YC9A 2Y43A 1N87A 2M1RA 3RTRB 5HJCA 3ZTGA 5EWVA 4CUSA 5EPSA 2DVSA 5LJ2A 1WEQA 5B77A 3T6RA 4KV1A 4PCEA 3PHDA 4QUTA 4YABA 4O74A 2RO1A 3P1EA 2CSYA 1X4UA 4I7DA 5E7DA 5K29A 4LC2A 4UYFA 1E4UA 4YYKA 3KQIA 5IG6A 5G04B 5FEYA 3S91A 5B79A 5EWDA 2YSMA 2YHOA 4BW3A 2LGVA 4HXKA 4TZ2A 2G6QA 4A9NA 5HM0A 4A4BA 4QR5A 4UYDA 5EQ1A 4C66A 2M85A 2L80A 4UP5A 2RSDA 4NYVA 4TU4A 2R10A 2LV9A 2H0DB 5AD3A 1E6IA 2MJVB 4ZW1A 5BT4A 4YADA 5C85A 3V43A 5E9IA 2KREA 5E9YA 4Z1QA 3Q2EA 4GNGA 4QR4A 2JMJA 3HTKC 2M3HA 3QZTA 5KH9A 3DWYA 4XUBA 5DYCA 2EODA 3KNVA 2MD8C 4X2IA 3KV6A 1RMDA 5F1LA 5ACYA 4MSXA 1G25A 3KV5A 5II2A 4TQNA 5J0DA 4Q0NA 5II1A 2H0DA 4X3GA 2C2VS 5A5NA 1JSPB 2E3KA 3I2DA 3U5MA 2RNYA 4CFKA 4AKNA 1WEVA 2QJ0A 5C7NA 4O75A 2XEUA 5B78A 3L1ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECV A;  5A83 A;  1F68 A;  4IR6 A;  2YQD A;  5ENB A;  2YUR A;  4O7A A;  4FO9 A;  4PS5 A;  2OSS A;  4DON A;  5F62 A;  5A81 A;  5CQ7 A;  4YK0 A;  2DVV A;  3MB4 A;  4QEW A;  4XY8 A;  3UVY A;  5DW2 A;  4AYC A;  4BBQ A;  3JVL A;  4YYJ A;  5KH3 A;  4TT4 A;  5FE1 A;  5LUU A;  5CY9 A;  1DVP A;  5JG6 A;  4TT6 A;  2N9G A;  3M99 A;  2F42 A;  5A82 A;  2LGK A;  1WE9 A;  3Q2F A;  2LGL A;  5FBX A;  4FIP A;  4C9Z A;  4LZR A;  4L7X A;  4O77 A;  4S3O B;  5JI8 A;  2YT5 A;  4YBT A;  4N3W A;  5I1Q A;  3LQH A;  4HBY A;  3P1C A;  4HBX A;  5HFR A;  4CUT A;  1VYX A;  4XUA A;  5F2P A;  3O7A A;  5IGN A;  5FE2 A;  1U6G B;  5DIN A;  2ECT A;  4WA6 A;  4J0S A;  4LRG A;  5E9M A;  1FP0 A;  2YQL A;  4YY6 A;  5D26 A;  2RNX A;  2KFT A;  3ZVZ B;  3HCU A;  5DKC A;  4Z6I A;  4MR6 A;  3NG2 A;  5ENC A;  5CUC A;  5CUB A;  3LQJ A;  4A9K A;  5CUD A;  4NQN A;  2DAT A;  2L43 A;  5ENJ A;  5L8T A;  4UIV A;  4WIV A;  4QSV A;  5E73 A;  5IGL A;  4ZDT A;  5D25 A;  1WIL A;  2RFJ A;  3JVJ A;  5LCW B;  5L97 A;  3LXJ A;  4MEO A;  5C89 A;  4N4G A;  3MQM A;  4YYI A;  5CQ3 A;  4UIW A;  5DKA A;  1X0J A;  3LQI A;  1WUM A;  2F6J A;  4KCX A;  1WEM A;  4XI1 A;  1F62 A;  4Y03 A;  3SOW A;  4UIX A;  3L11 A;  4A0C D;  4B7Y C;  5I29 A;  4B86 C;  1EQF A;  3U5K A;  4XYA A;  5HRX A;  5D1K B;  3UV2 A;  4TKP B;  4QSU A;  2MA5 A;  4N4H A;  2YQM A;  3K2J A;  4RVR A;  4O78 A;  5D3H A;  5CGP A;  5EGU A;  5I83 A;  2HYE D;  4NN2 A;  4UIY A;  5B8D A;  3RCW A;  4V3K C;  4LYW A;  5EP7 A;  5FH6 A;  2FUU A;  5ENG A;  3O34 A;  3SOU A;  5HQ5 A;  5D3S A;  3UW9 A;  5CRM A;  4NXJ A;  5LVR A;  2G43 A;  4O7C A;  4UYH A;  2CT2 A;  3N9N A;  3TLP A;  1V87 A;  4I7B A;  4CUQ A;  5FFW A;  2LSP B;  4UYF B;  5A5R A;  2AN6 A;  2IDA A;  3ASL A;  3HME A;  2C2L A;  2KIZ A;  5HLS A;  2FUI A;  5DFB A;  2K17 A;  5HEN A;  2L5U A;  4CLB A;  2ECN A;  4BHW A;  5AME A;  3DPL R;  4UYE A;  4YH4 A;  3P1D A;  4TYL A;  2E6S A;  2KYU A;  2EGP A;  3NXB A;  3U5P A;  3SHB A;  4HXN A;  5IID A;  2KWN A;  3P1F A;  5L99 A;  1Z60 A;  4UIU A;  5EVA A;  4QB3 A;  1WEP A;  5L8U A;  3N9P A;  2R0V A;  5I86 A;  1MM3 A;  2NAA A;  4IR4 A;  5FFY A;  2MIQ A;  5D1L B;  3G0J A;  1WEW A;  4LZ2 A;  4UIZ A;  4A9O A;  5HCL A;  2DWW A;  1WEE A;  5F5Z A;  5HQ6 A;  5TB6 A;  2ECW A;  5CTL A;  4IC3 A;  4GNE A;  3U5O A;  1WES A;  5A5P A;  5EWC A;  5KTW A;  5EIS A;  5A5Q A;  3GV4 A;  3UV5 A;  4NRA A;  4MVT A;  2YYN A;  4O70 A;  2LXH C;  5LKX A;  4QEU A;  5FE5 A;  4YAX A;  5D3R A;  2VPE A;  5CUA A;  5H85 A;  5F3A A;  1JOC A;  2R0S A;  2D9E A;  4MEQ A;  3HMF A;  2JRJ A;  4HXP A;  2MA6 A;  1HYJ A;  5FE4 A;  5D3P A;  2K16 A;  4UYG A;  5F61 A;  4N4I A;  5FE9 A;  5D3L A;  3D7C A;  4HXL A;  4AYC B;  3O35 A;  5CPE A;  3AQA A;  4NR4 A;  5BT3 A;  5IBN A;  3MHS A;  3SVG A;  4W4U A;  5ENE A;  2K4D A;  5LKU A;  2I7K A;  2YU4 A;  4YYN A;  5FB0 A;  4IR5 A;  4LR6 A;  4TTE A;  4GNF A;  5FE0 A;  2EA6 A;  1X4I A;  4NUC A;  4AVX A;  5EU1 A;  1MM2 A;  3ZNI A;  4YAT A;  3DQV R;  4V3L C;  2YEM A;  5FE6 A;  5A5S A;  5EV9 A;  2VP7 A;  2BAY A;  3JVM A;  4QEV A;  5COI A;  1N72 A;  5FG6 A;  2NXB A;  4MR4 A;  3HCS A;  5CQ6 A;  1BOR A;  5F1H A;  3I3J A;  4O7E A;  5DX4 A;  5HFQ A;  4J3I A;  2YSJ A;  1WFK A;  3MHH A;  4LK9 A;  1JM7 B;  2ECG A;  5FB1 A;  4HXS A;  4O64 A;  2L75 A;  2KWK A;  2M6M A;  4CA1 A;  2D82 A;  5D7X A;  5CUG A;  5G05 B;  5FE8 A;  4NR7 A;  4OGI A;  5CQ5 A;  1K2F A;  5TRB A;  4O7B A;  3T7L A;  3UVX A;  5J3X A;  5AIT A;  3C6W A;  4FJC A;  2YEK A;  4QSW A;  1JM7 A;  2YYR A;  5A7C A;  5H1T A;  4UIT A;  5FH8 A;  4ZC9 A;  5CS8 A;  4CUP A;  3LRQ A;  5DKH A;  4A49 A;  1WIM A;  2MUM A;  3AAD A;  4NR8 A;  4NR9 A;  2L5E A;  4QZS A;  5E9K A;  4GPJ A;  4NQM A;  5EA1 A;  2MD7 B;  4J0R A;  3ONI A;  5D0C A;  4YYM A;  5LKT A;  4BW1 A;  4NRC A;  1ZS5 A;  4IC2 A;  2YDW A;  4Z6H A;  4AP4 A;  4O71 A;  2VPD A;  2G45 A;  4MEN A;  4AUQ B;  3ZVY A;  5DLX A;  4IOO A;  4A9J A;  4NUE A;  4O76 A;  4Q0O A;  2CKL B;  2I8N A;  2I50 A;  4QSQ A;  2VPB A;  4YYD A;  2L0B A;  2LXP C;  4R7E A;  4NRB A;  1Z2Q A;  2YW5 A;  5CQA A;  5I3L A;  5DYU A;  5EWW A;  3PUQ A;  1CHC A;  2RNW A;  4QSR A;  5I89 A;  5EYA F;  5FFV A;  2JMD A;  3LJW A;  4MEP A;  3N9M A;  5G0F A;  5C8G A;  2CKL A;  5EI4 A;  2HDP A;  4O72 A;  2CSZ A;  2UZG A;  5EPR A;  5A85 A;  3P5O A;  3DAI A;  4NUD A;  2DVR A;  2G4A A;  4HXM A;  3O33 A;  5FDZ A;  1WEU A;  5DBM A;  4LKA A;  5DY7 A;  5EK9 A;  3U5N A;  5DKD A;  5CQ8 A;  2KWJ A;  4LLB A;  5LKZ A;  4BJX A;  4Q6F A;  2OXQ C;  2VPG A;  4ALH A;  3G0L A;  5LJ0 A;  5H9M A;  4N4F A;  4E96 A;  2WP1 A;  4QNS A;  2QIZ A;  5KU3 A;  3EB5 A;  2JMI A;  5DFC A;  5AD2 A;  5CQ4 A;  5ETD A;  4CUU A;  3O36 A;  5TBN A;  3QZS A;  4A4C A;  4ALG A;  4F52 B;  5F25 A;  2FSA A;  5KO4 A;  5ENI A;  1LDK C;  3ZYQ A;  4I7C A;  4QR3 A;  5CU8 A;  2KTB B;  4MR3 A;  2OUO A;  5H1U A;  5C87 A;  5L96 A;  5D3N A;  3MUK A;  2DKW A;  2LQ6 A;  2RS9 B;  2MNY A;  2L84 A;  5A5O A;  3SVH A;  5C11 A;  1WEO A;  5AIU A;  5EPB A;  4HBW A;  4PCI A;  3N9O A;  1VD4 A;  4UI9 B;  4NS5 A;  4R2Y A;  5F60 A;  3IU5 A;  4QSX A;  4QYD A;  3IU6 A;  4CUR A;  4WZ3 B;  2LN0 A;  4L58 A;  2OO1 A;  5E9L A;  5HQ7 A;  4LJN A;  4LYS A;  4PY6 A;  4TU6 A;  5FE7 A;  5E3D A;  5IGK A;  4WHU A;  4YYG A;  1FBV A;  1WGM A;  1XWH A;  3N9L A;  3UV4 A;  4IR3 A;  5LJ1 A;  1ZBD B;  3C5K A;  1WEN A;  3M62 A;  5G4R A;  2ECJ A;  5C4Q A;  2E6R A;  4Z1S A;  3MUL A;  4YYH A;  5EIC A;  2KR4 A;  5I7Y A;  4FLP A;  4OGJ A;  2QIC A;  4XY9 A;  5DFD A;  2F6N A;  4UP0 A;  4IOR A;  2LGG A;  3FKM X;  3GG3 A;  2MNZ A;  2YRE A;  5F36 A;  2K1J A;  1HYI A;  3HCT A;  1X4J A;  5B75 A;  2ECI A;  2PUY A;  5KH7 A;  2KE1 A;  2YEL A;  3GL6 A;  1IYM A;  2VNF A;  2Y1N A;  4O7F A;  4P5O B;  3RPG C;  5TDW A;  5D1M B;  5D3T A;  4QF2 A;  4A9M A;  5DYA A;  2YUC A;  4KV4 A;  4R8P K;  4LAD B;  5I88 A;  4QC3 A;  5FE3 A;  4A9I A;  3UVW A;  5KTX A;  3U5L A;  4NR5 A;  4QY4 A;  2KGG A;  3EB6 A;  2KU3 A;  5FG5 A;  5LVQ A;  4HXR A;  5L98 A;  2KGI A;  4QSP A;  5DLZ A;  4OUF A;  1Z6U A;  5EM3 A;  5FH7 A;  3U5J A;  3M63 A;  5CRZ A;  3ZPV 1;  5HEM A;  5C13 A;  5TCM A;  5F63 A;  4NYW A;  5I7X A;  4YBS A;  5ETB A;  4GND A;  4GB0 A;  5CFW A;  4LZS A;  4PTB A;  5IGM A;  4LDF A;  5CUE A;  1LDJ B;  5FG4 A;  5CP5 A;  3MXF A;  2L85 A;  3O37 A;  5CQT A;  5H1V A;  4PPE A;  4ZQL A;  5ENF A;  4FK5 A;  5DW1 A;  3JVK A;  4J1P A;  2PNX A;  4QUU A;  5HRV A;  3VK6 A;  4NYX A;  4YH3 A;  4F3I A;  5D3J A;  1VFY A;  5BT5 A;  4QBM A;  5G4S A;  3SVF A;  2MT5 A;  2VJF B;  5B76 A;  4ZUX U;  3ZPV E;  5CZG A;  5I40 A;  5E3G A;  2E7O A;  5E9V A;  3HMH A;  4BW4 A;  5TDR A;  3UVD A;  4YBM A;  2LRI C;  2WP2 A;  4A9H A;  3SOX A;  4TZ8 A;  4A9E A;  4CFL A;  5AMF A;  4NR6 A;  3O70 A;  3S92 A;  4C67 A;  2Y1M A;  4TS8 A;  4BW2 A;  2D8S A;  5EWH A;  4TT2 A;  2VJF A;  5E74 A;  4HXO A;  5D24 A;  5I80 A;  2H60 A;  4HBV A;  4YY4 A;  4PKL A;  2XB1 A;  2YW8 A;  5HEL A;  5HRW A;  3MB3 A;  4QST A;  2VJE B;  5TAB A;  1JM4 B;  4QC1 A;  4WZ0 A;  1WUG A;  4Z93 A;  4QF3 A;  5E0R A;  4IOQ A;  4QSS A;  5KHM A;  2ZET C;  5KTU A;  3QZV A;  4CCG X;  4QYL A;  5DYX A;  3L1X A;  2R0Y A;  5ENH A;  4S3O C;  2YHN A;  5FER A;  4LYI A;  4CL9 A;  1T1H A;  2KWO A;  2LDR A;  3IHP A;  3N9Q A;  2E7N A;  3ZYU A;  4WHW A;  2DVQ A;  5JWM A;  3PUR A;  4WZ2 A;  2GRC A;  3RPG B;  3FL2 A;  2VJE A;  4MR5 A;  4A9L A;  4A9F A;  2DX8 A;  2RI7 A;  4YC9 A;  2Y43 A;  1N87 A;  2M1R A;  3RTR B;  5HJC A;  3ZTG A;  5EWV A;  4CUS A;  5EPS A;  2DVS A;  5LJ2 A;  1WEQ A;  5B77 A;  3T6R A;  4KV1 A;  4PCE A;  3PHD A;  4QUT A;  4YAB A;  4O74 A;  2RO1 A;  3P1E A;  2CSY A;  1X4U A;  4I7D A;  5E7D A;  5K29 A;  4LC2 A;  4UYF A;  1E4U A;  4YYK A;  3KQI A;  5IG6 A;  5G04 B;  5FEY A;  3S91 A;  5B79 A;  5EWD A;  2YSM A;  2YHO A;  4BW3 A;  2LGV A;  4HXK A;  4TZ2 A;  2G6Q A;  4A9N A;  5HM0 A;  4A4B A;  4QR5 A;  4UYD A;  5EQ1 A;  4C66 A;  2M85 A;  2L80 A;  4UP5 A;  2RSD A;  4NYV A;  4TU4 A;  2R10 A;  2LV9 A;  2H0D B;  5AD3 A;  1E6I A;  2MJV B;  4ZW1 A;  5BT4 A;  4YAD A;  5C85 A;  3V43 A;  5E9I A;  2KRE A;  5E9Y A;  4Z1Q A;  3Q2E A;  4GNG A;  4QR4 A;  2JMJ A;  3HTK C;  2M3H A;  3QZT A;  5KH9 A;  3DWY A;  4XUB A;  5DYC A;  2EOD A;  3KNV A;  2MD8 C;  4X2I A;  3KV6 A;  1RMD A;  5F1L A;  5ACY A;  4MSX A;  1G25 A;  3KV5 A;  5II2 A;  4TQN A;  5J0D A;  4Q0N A;  5II1 A;  2H0D A;  4X3G A;  2C2V S;  5A5N A;  1JSP B;  2E3K A;  3I2D A;  3U5M A;  2RNY A;  4CFK A;  4AKN A;  1WEV A;  2QJ0 A;  5C7N A;  4O75 A;  2XEU A;  5B78 A;  3L1Z B; 
#chains in the Genus database with same CATH topology
 2ECV A;  5A83 A;  1F68 A;  4IR6 A;  2YQD A;  5ENB A;  2YUR A;  4O7A A;  4FO9 A;  4PS5 A;  2OSS A;  4DON A;  5F62 A;  5A81 A;  5CQ7 A;  4Z0O A;  4YK0 A;  2DVV A;  3MB4 A;  4QEW A;  4XY8 A;  3UVY A;  5DW2 A;  4AYC A;  4BBQ A;  3JVL A;  4YYJ A;  5KH3 A;  4TT4 A;  5FE1 A;  5LUU A;  5CY9 A;  1DVP A;  2XOY A;  5JG6 A;  4TT6 A;  3VKG A;  2N9G A;  3M99 A;  3T9K A;  2F42 A;  5A82 A;  2LGK A;  1WE9 A;  3Q2F A;  2LGL A;  5SVI B;  5FBX A;  4FIP A;  2L7P A;  4C9Z A;  4LZR A;  4L7X A;  4O77 A;  4S3O B;  5JI8 A;  2CSV A;  2YT5 A;  4YBT A;  4H9D A;  5K3Q A;  4N3W A;  3ERR A;  5I1Q A;  3LQH A;  4HBY A;  3P1C A;  4HBX A;  5HFR A;  4CUT A;  1VYX A;  4XUA A;  5F2P A;  3O7A A;  5IGN A;  5FE2 A;  1U6G B;  5SVI A;  5DIN A;  2ECT A;  4WA6 A;  4J0S A;  4LRG A;  5E9M A;  1FP0 A;  2YQL A;  4YY6 A;  5D26 A;  1MBM A;  2RNX A;  2KFT A;  3ZVZ B;  3HCU A;  5DKC A;  4Z6I A;  4MR6 A;  3NG2 A;  5ENC A;  5CUC A;  5CUB A;  3LQJ A;  4OGE A;  4A9K A;  5CUD A;  4NQN A;  2DAT A;  2L43 A;  5ENJ A;  5L8T A;  4UIV A;  4WIV A;  2FD4 A;  4QSV A;  5E73 A;  5IGL A;  4ZDT A;  2EGM A;  5D25 A;  1WIL A;  2RFJ A;  3JVJ A;  3MDB C;  5LCW B;  5L97 A;  3LXJ A;  4MEO A;  5C89 A;  4N4G A;  3MQM A;  4YYI A;  5CQ3 A;  4UIW A;  5DKA A;  1X0J A;  3LQI A;  1WUM A;  2F6J A;  4KCX A;  1WEM A;  4XI1 A;  1F62 A;  4Y03 A;  3SOW A;  4UIX A;  3L11 A;  4A0C D;  4B7Y C;  5I29 A;  4B86 C;  1EQF A;  3U5K A;  4XYA A;  5HRX A;  5D1K B;  3UV2 A;  3SUB A;  4TKP B;  4QSU A;  2MA5 A;  4N4H A;  4F1P A;  2YQM A;  3K2J A;  4RVR A;  4O78 A;  5D3H A;  5CGP A;  5EGU A;  5I83 A;  2D8U A;  2HYE D;  4UIY A;  4NN2 A;  3RCW A;  4V3K C;  4LYW A;  5EP7 A;  5FH6 A;  2FUU A;  5ENG A;  3O34 A;  3SOU A;  5HQ5 A;  5SVX A;  5D3S A;  2JM3 A;  3UW9 A;  5CRM A;  4NXJ A;  5LVR A;  2G43 A;  4O7C A;  4UYH A;  2CT2 A;  3N9N A;  3TLP A;  1V87 A;  2RR4 A;  4I7B A;  4CUQ A;  5FFW A;  2LSP B;  4UYF B;  2P57 A;  5A5R A;  2AN6 A;  2IDA A;  3ASL A;  3HME A;  2C2L A;  2KIZ A;  5HLS A;  2FUI A;  5SVY A;  5DFB A;  2K17 A;  5HEN A;  2L5U A;  4CLB A;  2ECN A;  4BHW A;  5AME A;  2OWA A;  3DPL R;  3PLW A;  4UYE A;  2IQJ A;  4YH4 A;  3P1D A;  4TYL A;  2E6S A;  2KYU A;  2EGP A;  3NXB A;  3U5P A;  3SHB A;  4HXN A;  5IID A;  2KWN A;  3P1F A;  5L99 A;  1Z60 A;  4UIU A;  5EVA A;  2CRR A;  4QB3 A;  1WEP A;  5L8U A;  3N9P A;  2R0V A;  5I86 A;  1MM3 A;  2NAA A;  4IR4 A;  5FFY A;  2FFW A;  2MIQ A;  5D1L B;  3G0J A;  1WEW A;  4LZ2 A;  4UIZ A;  4A9O A;  5HCL A;  2DWW A;  1WEE A;  5F5Z A;  5HQ6 A;  5TB6 A;  2ECW A;  3Q1D A;  5CTL A;  4IC3 A;  4GNE A;  3U5O A;  1WES A;  5A5P A;  5EWC A;  5KTW A;  5EIS A;  5A5Q A;  2EXU A;  3GV4 A;  3UV5 A;  4NRA A;  4MVT A;  2YYN A;  4O70 A;  2LXH C;  5LKX A;  4QEU A;  5FE5 A;  4YAX A;  5D3R A;  2VPE A;  5CUA A;  5H85 A;  5F3A A;  1JOC A;  2R0S A;  2D9E A;  4MEQ A;  3HMF A;  2JRJ A;  4HXP A;  2MA6 A;  1HYJ A;  5FE4 A;  5D3P A;  2K16 A;  4UYG A;  5F61 A;  3O47 A;  4N4I A;  5FE9 A;  5D3L A;  3D7C A;  4HXL A;  2KKX A;  4AYC B;  3O35 A;  5CPE A;  3AQA A;  4NR4 A;  5BT3 A;  5IBN A;  3MHS A;  3SVG A;  4W4U A;  5B8D A;  5ENE A;  2K4D A;  5LKU A;  2I7K A;  2YU4 A;  4YYN A;  5FB0 A;  4IR5 A;  4LR6 A;  4TTE A;  4GNF A;  5FE0 A;  2EA6 A;  1X4I A;  4NUC A;  4AVX A;  5EU1 A;  1MM2 A;  3ZNI A;  4YAT A;  3DQV R;  4V3L C;  2YEM A;  5FE6 A;  5A5S A;  5EV9 A;  2VP7 A;  1DCQ A;  2BAY A;  3JVM A;  4QEV A;  5COI A;  1N72 A;  5FG6 A;  2NXB A;  4MR4 A;  3HCS A;  5CQ6 A;  1BOR A;  5F1H A;  3I3J A;  2M13 A;  4O7E A;  5DX4 A;  5HFQ A;  4J3I A;  2YSJ A;  1WFK A;  3MHH A;  2XOZ A;  4LK9 A;  2ECG A;  5FB1 A;  1JM7 B;  4HXS A;  4O64 A;  2L75 A;  2KWK A;  2M6M A;  4CA1 A;  2D82 A;  5D7X A;  5CUG A;  5G05 B;  5FE8 A;  3DWD A;  4NR7 A;  4OGI A;  5CQ5 A;  1K2F A;  5TRB A;  4O7B A;  3T7L A;  3UVX A;  5J3X A;  5AIT A;  3C6W A;  4FJC A;  2YEK A;  4QSW A;  1JM7 A;  2YYR A;  5A7C A;  5H1T A;  4UIT A;  5FH8 A;  4ZC9 A;  5CS8 A;  4CUP A;  3LRQ A;  5DKH A;  4A49 A;  1WIM A;  2MUM A;  3AAD A;  4NR8 A;  4NR9 A;  2L5E A;  4QZS A;  5E9K A;  4GPJ A;  4NQM A;  5EA1 A;  2MD7 B;  4J0R A;  3ONI A;  5D0C A;  4YYM A;  5LKT A;  4BW1 A;  4NRC A;  2EJN A;  3KDE C;  1ZS5 A;  4IC2 A;  2YDW A;  4Z6H A;  4AP4 A;  4O71 A;  2VPD A;  2G45 A;  4MEN A;  4AUQ B;  3ZVY A;  5DLX A;  4IOO A;  4A9J A;  4NUE A;  4O76 A;  4Q0O A;  2CKL B;  2I8N A;  2I50 A;  4QSQ A;  2VPB A;  4YYD A;  2L0B A;  2LXP C;  4AKG A;  4R7E A;  4NRB A;  1Z2Q A;  2YW5 A;  5CQA A;  5I3L A;  5DYU A;  5EWW A;  2XP0 A;  1CHC A;  2RNW A;  3PUQ A;  4QSR A;  5I89 A;  5EYA F;  5FFV A;  2JMD A;  3LJW A;  4MEP A;  3N9M A;  5G0F A;  5C8G A;  2CKL A;  2E61 A;  5EI4 A;  2HDP A;  1ZKR A;  4O72 A;  2CSZ A;  5EPR A;  2UZG A;  5A85 A;  3P5O A;  3DAI A;  4NUD A;  3FJU B;  2DVR A;  2G4A A;  4HXM A;  3O33 A;  5FDZ A;  1WEU A;  5DBM A;  4LKA A;  5DY7 A;  5EK9 A;  3U5N A;  5DKD A;  5CQ8 A;  2KWJ A;  4O62 A;  4LLB A;  5LKZ A;  4BJX A;  3LDY A;  3FAO A;  2OXQ C;  4Q6F A;  2VPG A;  4ALH A;  3G0L A;  2B0O E;  5LJ0 A;  5H9M A;  4N4F A;  4E96 A;  4QQ4 A;  2WP1 A;  4QNS A;  2QIZ A;  5KU3 A;  3EB5 A;  2JMI A;  5DFC A;  5AD2 A;  5CQ4 A;  5ETD A;  4CUU A;  3O36 A;  5TBN A;  3QZS A;  4A4C A;  4ALG A;  4F52 B;  5F25 A;  2FSA A;  5KO4 A;  5ENI A;  4AI6 A;  1LDK C;  3ZYQ A;  4I7C A;  4QR3 A;  5CU8 A;  2KTB B;  4MR3 A;  2OUO A;  5H1U A;  5C87 A;  5L96 A;  5D3N A;  3MUK A;  2DKW A;  2LQ6 A;  2RS9 B;  2MNY A;  2L84 A;  5A5O A;  3SVH A;  5C11 A;  1WEO A;  5AIU A;  5EPB A;  4HBW A;  4PCI A;  3N9O A;  1VD4 A;  4UI9 B;  4NS5 A;  4R2Y A;  5F60 A;  3IU5 A;  4QSX A;  4QYD A;  3IU6 A;  4CUR A;  3M7K A;  4WZ3 B;  2LN0 A;  4L58 A;  2OO1 A;  5E9L A;  5HQ7 A;  4LJN A;  4LYS A;  4PY6 A;  4TU6 A;  5FE7 A;  5E3D A;  5IGK A;  4WHU A;  4YYG A;  1FBV A;  1WGM A;  1XWH A;  3N9L A;  3LVQ E;  3UV4 A;  4IR3 A;  5LJ1 A;  1ZBD B;  3C5K A;  1WEN A;  3M62 A;  5G4R A;  2ECJ A;  5C4Q A;  2E6R A;  4Z1S A;  3MUL A;  4YYH A;  5EIC A;  2KR4 A;  5I7Y A;  4FLP A;  4OGJ A;  2QIC A;  4XY9 A;  2F6N A;  5DFD A;  4UP0 A;  4IOR A;  2LGG A;  3FKM X;  3GG3 A;  2MNZ A;  2YRE A;  5F36 A;  2K1J A;  1HYI A;  3HCT A;  1X4J A;  4OGC A;  5B75 A;  2ECI A;  2PUY A;  5KH7 A;  2KE1 A;  2YEL A;  3GL6 A;  1IYM A;  3DDT A;  2VNF A;  3E2D A;  2Y1N A;  4O7F A;  4P5O B;  3RPG C;  2CRW A;  5D1M B;  5TDW A;  5D3T A;  4QF2 A;  4A9M A;  5DYA A;  2YUC A;  4KV4 A;  4R8P K;  2LAU A;  4LAD B;  3D1D A;  5I88 A;  4QC3 A;  5FE3 A;  4A9I A;  3UVW A;  2DSM A;  5KTX A;  3U5L A;  4NR5 A;  4QY4 A;  2KGG A;  3EB6 A;  2KU3 A;  5FG5 A;  5LVQ A;  4HXR A;  5L98 A;  2KGI A;  4QSP A;  5DLZ A;  4OUF A;  1Z6U A;  5EM3 A;  5FH7 A;  4Z0R A;  3U5J A;  3M63 A;  3LVR E;  5CRZ A;  3ZPV 1;  5HEM A;  3LJU X;  5C13 A;  1PUO A;  5TCM A;  5F63 A;  2KKY A;  4NYW A;  5I7X A;  4YBS A;  5ETB A;  4GND A;  4GB0 A;  5CFW A;  3JUE A;  4LZS A;  4PTB A;  5IGM A;  4LDF A;  5CUE A;  1LDJ B;  5FG4 A;  5CP5 A;  3MXF A;  2L85 A;  3O37 A;  5CQT A;  5H1V A;  4PPE A;  4ZQL A;  5ENF A;  4FK5 A;  5DW1 A;  3JVK A;  4J1P A;  2PNX A;  4QUU A;  5HRV A;  3VK6 A;  4NYX A;  4YH3 A;  3FAN A;  4F3I A;  5D3J A;  4AKI A;  1VFY A;  5BT5 A;  4QBM A;  5G4S A;  3SVF A;  2MT5 A;  2VJF B;  5B76 A;  4ZUX U;  2MKE A;  2CON A;  3ZPV E;  3FM8 C;  5CZG A;  2JUN A;  5I40 A;  5E3G A;  2E7O A;  5E9V A;  3HMH A;  4BW4 A;  5TDR A;  3UVD A;  4YBM A;  2LRI C;  2WP2 A;  4A9H A;  3SOX A;  4TZ8 A;  4A9E A;  4CFL A;  5AMF A;  4NR6 A;  3O70 A;  3S92 A;  4C67 A;  2Y1M A;  4TS8 A;  4BW2 A;  2D8S A;  5EWH A;  4TT2 A;  2VJF A;  5E74 A;  4HXO A;  5D24 A;  5I80 A;  2H60 A;  4HBV A;  4YY4 A;  4PKL A;  2XB1 A;  2YW8 A;  5HEL A;  5HRW A;  3D1B A;  3MB3 A;  4QST A;  2VJE B;  5TAB A;  1JM4 B;  4QC1 A;  4WZ0 A;  1WUG A;  4Z93 A;  4QF3 A;  5E0R A;  4IOQ A;  4QSS A;  5KHM A;  2ZET C;  5KTU A;  3QZV A;  4CCG X;  3H7H A;  4QYL A;  5DYX A;  3L1X A;  2R0Y A;  5ENH A;  2DJA A;  4S3O C;  2YHN A;  5FER A;  4LYI A;  4CL9 A;  1T1H A;  2KWO A;  2LDR A;  3IHP A;  3N9Q A;  2E7N A;  3ZYU A;  4WHW A;  2DVQ A;  5JWM A;  3PUR A;  4WZ2 A;  2GRC A;  3RPG B;  3FL2 A;  2VJE A;  4MR5 A;  4A9L A;  4A9F A;  2DX8 A;  2RI7 A;  4YC9 A;  2Y43 A;  1N87 A;  2M1R A;  3RTR B;  5HJC A;  3ZTG A;  5EWV A;  4CUS A;  5EPS A;  2DVS A;  5LJ2 A;  1WEQ A;  5B77 A;  3T6R A;  4KV1 A;  4PCE A;  3PHD A;  4QUT A;  4YAB A;  4O74 A;  2RO1 A;  3P1E A;  2CSY A;  1X4U A;  4I7D A;  5E7D A;  5K29 A;  4LC2 A;  4UYF A;  1E4U A;  4YYK A;  3KQI A;  5IG6 A;  5G04 B;  5FEY A;  3S91 A;  5B79 A;  5EWD A;  2YSM A;  2YHO A;  4BW3 A;  2LGV A;  4HXK A;  4TZ2 A;  2G6Q A;  4A9N A;  5HM0 A;  2XOC A;  4AKH A;  4A4B A;  4QR5 A;  4UYD A;  5EQ1 A;  4C66 A;  2M85 A;  2L80 A;  4UP5 A;  2RSD A;  3FEH A;  4NYV A;  4TU4 A;  2R10 A;  2LV9 A;  2H0D B;  5AD3 A;  1E6I A;  2MJV B;  4ZW1 A;  5BT4 A;  4YAD A;  5C85 A;  3V43 A;  5E9I A;  2KRE A;  5E9Y A;  4Z1Q A;  3Q2E A;  4GNG A;  4QR4 A;  2JMJ A;  3HTK C;  2M3H A;  3QZT A;  5KH9 A;  3DWY A;  4XUB A;  5DYC A;  2EOD A;  3KNV A;  2MD8 C;  4X2I A;  3KV6 A;  1RMD A;  5F1L A;  5ACY A;  4MSX A;  1G25 A;  2YVR A;  3KV5 A;  5II2 A;  4TQN A;  5J0D A;  4Q0N A;  5II1 A;  2H0D A;  4X3G A;  2C2V S;  5A5N A;  1JSP B;  2E3K A;  3I2D A;  3U5M A;  2RNY A;  4CFK A;  4AKN A;  1WEV A;  2QJ0 A;  5C7N A;  4O75 A;  2XEU A;  3VKH A;  5B78 A;  3L1Z B; 
#chains in the Genus database with same CATH homology
 2ECV A;  5A83 A;  1F68 A;  4IR6 A;  2YQD A;  5ENB A;  2YUR A;  4O7A A;  4FO9 A;  4PS5 A;  2OSS A;  4DON A;  5F62 A;  5A81 A;  5CQ7 A;  4YK0 A;  2DVV A;  3MB4 A;  4QEW A;  4XY8 A;  3UVY A;  5DW2 A;  4AYC A;  4BBQ A;  3JVL A;  4YYJ A;  5KH3 A;  4TT4 A;  5FE1 A;  5LUU A;  5CY9 A;  1DVP A;  5JG6 A;  4TT6 A;  2N9G A;  3M99 A;  2F42 A;  5A82 A;  2LGK A;  1WE9 A;  3Q2F A;  2LGL A;  5FBX A;  4FIP A;  4C9Z A;  4LZR A;  4L7X A;  4O77 A;  4S3O B;  5JI8 A;  2YT5 A;  4YBT A;  4N3W A;  5I1Q A;  3LQH A;  4HBY A;  3P1C A;  4HBX A;  5HFR A;  4CUT A;  1VYX A;  4XUA A;  5F2P A;  3O7A A;  5IGN A;  5FE2 A;  1U6G B;  5DIN A;  2ECT A;  4WA6 A;  4J0S A;  4LRG A;  5E9M A;  1FP0 A;  2YQL A;  4YY6 A;  5D26 A;  2RNX A;  2KFT A;  3ZVZ B;  3HCU A;  5DKC A;  4Z6I A;  4MR6 A;  3NG2 A;  5ENC A;  5CUC A;  5CUB A;  3LQJ A;  4A9K A;  5CUD A;  4NQN A;  2DAT A;  2L43 A;  5ENJ A;  5L8T A;  4UIV A;  4WIV A;  4QSV A;  5E73 A;  5IGL A;  4ZDT A;  5D25 A;  1WIL A;  2RFJ A;  3JVJ A;  5LCW B;  5L97 A;  3LXJ A;  4MEO A;  5C89 A;  4N4G A;  3MQM A;  4YYI A;  5CQ3 A;  4UIW A;  5DKA A;  1X0J A;  3LQI A;  1WUM A;  2F6J A;  4KCX A;  1WEM A;  4XI1 A;  1F62 A;  4Y03 A;  3SOW A;  4UIX A;  3L11 A;  4A0C D;  4B7Y C;  5I29 A;  4B86 C;  1EQF A;  3U5K A;  4XYA A;  5HRX A;  5D1K B;  3UV2 A;  4TKP B;  4QSU A;  2MA5 A;  4N4H A;  2YQM A;  3K2J A;  4RVR A;  4O78 A;  5D3H A;  5CGP A;  5EGU A;  5I83 A;  2HYE D;  4NN2 A;  4UIY A;  5B8D A;  3RCW A;  4V3K C;  4LYW A;  5EP7 A;  5FH6 A;  2FUU A;  5ENG A;  3O34 A;  3SOU A;  5HQ5 A;  5D3S A;  3UW9 A;  5CRM A;  4NXJ A;  5LVR A;  2G43 A;  4O7C A;  4UYH A;  2CT2 A;  3N9N A;  3TLP A;  1V87 A;  4I7B A;  4CUQ A;  5FFW A;  2LSP B;  4UYF B;  5A5R A;  2AN6 A;  2IDA A;  3ASL A;  3HME A;  2C2L A;  2KIZ A;  5HLS A;  2FUI A;  5DFB A;  2K17 A;  5HEN A;  2L5U A;  4CLB A;  2ECN A;  4BHW A;  5AME A;  3DPL R;  4UYE A;  4YH4 A;  3P1D A;  4TYL A;  2E6S A;  2KYU A;  2EGP A;  3NXB A;  3U5P A;  3SHB A;  4HXN A;  5IID A;  2KWN A;  3P1F A;  5L99 A;  1Z60 A;  4UIU A;  5EVA A;  4QB3 A;  1WEP A;  5L8U A;  3N9P A;  2R0V A;  5I86 A;  1MM3 A;  2NAA A;  4IR4 A;  5FFY A;  2MIQ A;  5D1L B;  3G0J A;  1WEW A;  4LZ2 A;  4UIZ A;  4A9O A;  5HCL A;  2DWW A;  1WEE A;  5F5Z A;  5HQ6 A;  5TB6 A;  2ECW A;  5CTL A;  4IC3 A;  4GNE A;  3U5O A;  1WES A;  5A5P A;  5EWC A;  5KTW A;  5EIS A;  5A5Q A;  3GV4 A;  3UV5 A;  4NRA A;  4MVT A;  2YYN A;  4O70 A;  2LXH C;  5LKX A;  4QEU A;  5FE5 A;  4YAX A;  5D3R A;  2VPE A;  5CUA A;  5H85 A;  5F3A A;  1JOC A;  2R0S A;  2D9E A;  4MEQ A;  3HMF A;  2JRJ A;  4HXP A;  2MA6 A;  1HYJ A;  5FE4 A;  5D3P A;  2K16 A;  4UYG A;  5F61 A;  4N4I A;  5FE9 A;  5D3L A;  3D7C A;  4HXL A;  4AYC B;  3O35 A;  5CPE A;  3AQA A;  4NR4 A;  5BT3 A;  5IBN A;  3MHS A;  3SVG A;  4W4U A;  5ENE A;  2K4D A;  5LKU A;  2I7K A;  2YU4 A;  4YYN A;  5FB0 A;  4IR5 A;  4LR6 A;  4TTE A;  4GNF A;  5FE0 A;  2EA6 A;  1X4I A;  4NUC A;  4AVX A;  5EU1 A;  1MM2 A;  3ZNI A;  4YAT A;  3DQV R;  4V3L C;  2YEM A;  5FE6 A;  5A5S A;  5EV9 A;  2VP7 A;  2BAY A;  3JVM A;  4QEV A;  5COI A;  1N72 A;  5FG6 A;  2NXB A;  4MR4 A;  3HCS A;  5CQ6 A;  1BOR A;  5F1H A;  3I3J A;  4O7E A;  5DX4 A;  5HFQ A;  4J3I A;  2YSJ A;  1WFK A;  3MHH A;  4LK9 A;  1JM7 B;  2ECG A;  5FB1 A;  4HXS A;  4O64 A;  2L75 A;  2KWK A;  2M6M A;  4CA1 A;  2D82 A;  5D7X A;  5CUG A;  5G05 B;  5FE8 A;  4NR7 A;  4OGI A;  5CQ5 A;  1K2F A;  5TRB A;  4O7B A;  3T7L A;  3UVX A;  5J3X A;  5AIT A;  3C6W A;  4FJC A;  2YEK A;  4QSW A;  1JM7 A;  2YYR A;  5A7C A;  5H1T A;  4UIT A;  5FH8 A;  4ZC9 A;  5CS8 A;  4CUP A;  3LRQ A;  5DKH A;  4A49 A;  1WIM A;  2MUM A;  3AAD A;  4NR8 A;  4NR9 A;  2L5E A;  4QZS A;  5E9K A;  4GPJ A;  4NQM A;  5EA1 A;  2MD7 B;  4J0R A;  3ONI A;  5D0C A;  4YYM A;  5LKT A;  4BW1 A;  4NRC A;  1ZS5 A;  4IC2 A;  2YDW A;  4Z6H A;  4AP4 A;  4O71 A;  2VPD A;  2G45 A;  4MEN A;  4AUQ B;  3ZVY A;  5DLX A;  4IOO A;  4A9J A;  4NUE A;  4O76 A;  4Q0O A;  2CKL B;  2I8N A;  2I50 A;  4QSQ A;  2VPB A;  4YYD A;  2L0B A;  2LXP C;  4R7E A;  4NRB A;  1Z2Q A;  2YW5 A;  5CQA A;  5I3L A;  5DYU A;  5EWW A;  3PUQ A;  1CHC A;  2RNW A;  4QSR A;  5I89 A;  5EYA F;  5FFV A;  2JMD A;  3LJW A;  4MEP A;  3N9M A;  5G0F A;  5C8G A;  2CKL A;  5EI4 A;  2HDP A;  4O72 A;  2CSZ A;  2UZG A;  5EPR A;  5A85 A;  3P5O A;  3DAI A;  4NUD A;  2DVR A;  2G4A A;  4HXM A;  3O33 A;  5FDZ A;  1WEU A;  5DBM A;  4LKA A;  5DY7 A;  5EK9 A;  3U5N A;  5DKD A;  5CQ8 A;  2KWJ A;  4LLB A;  5LKZ A;  4BJX A;  4Q6F A;  2OXQ C;  2VPG A;  4ALH A;  3G0L A;  5LJ0 A;  5H9M A;  4N4F A;  4E96 A;  2WP1 A;  4QNS A;  2QIZ A;  5KU3 A;  3EB5 A;  2JMI A;  5DFC A;  5AD2 A;  5CQ4 A;  5ETD A;  4CUU A;  3O36 A;  5TBN A;  3QZS A;  4A4C A;  4ALG A;  4F52 B;  5F25 A;  2FSA A;  5KO4 A;  5ENI A;  1LDK C;  3ZYQ A;  4I7C A;  4QR3 A;  5CU8 A;  2KTB B;  4MR3 A;  2OUO A;  5H1U A;  5C87 A;  5L96 A;  5D3N A;  3MUK A;  2DKW A;  2LQ6 A;  2RS9 B;  2MNY A;  2L84 A;  5A5O A;  3SVH A;  5C11 A;  1WEO A;  5AIU A;  5EPB A;  4HBW A;  4PCI A;  3N9O A;  1VD4 A;  4UI9 B;  4NS5 A;  4R2Y A;  5F60 A;  3IU5 A;  4QSX A;  4QYD A;  3IU6 A;  4CUR A;  4WZ3 B;  2LN0 A;  4L58 A;  2OO1 A;  5E9L A;  5HQ7 A;  4LJN A;  4LYS A;  4PY6 A;  4TU6 A;  5FE7 A;  5E3D A;  5IGK A;  4WHU A;  4YYG A;  1FBV A;  1WGM A;  1XWH A;  3N9L A;  3UV4 A;  4IR3 A;  5LJ1 A;  1ZBD B;  3C5K A;  1WEN A;  3M62 A;  5G4R A;  2ECJ A;  5C4Q A;  2E6R A;  4Z1S A;  3MUL A;  4YYH A;  5EIC A;  2KR4 A;  5I7Y A;  4FLP A;  4OGJ A;  2QIC A;  4XY9 A;  5DFD A;  2F6N A;  4UP0 A;  4IOR A;  2LGG A;  3FKM X;  3GG3 A;  2MNZ A;  2YRE A;  5F36 A;  2K1J A;  1HYI A;  3HCT A;  1X4J A;  5B75 A;  2ECI A;  2PUY A;  5KH7 A;  2KE1 A;  2YEL A;  3GL6 A;  1IYM A;  2VNF A;  2Y1N A;  4O7F A;  4P5O B;  3RPG C;  5TDW A;  5D1M B;  5D3T A;  4QF2 A;  4A9M A;  5DYA A;  2YUC A;  4KV4 A;  4R8P K;  4LAD B;  5I88 A;  4QC3 A;  5FE3 A;  4A9I A;  3UVW A;  5KTX A;  3U5L A;  4NR5 A;  4QY4 A;  2KGG A;  3EB6 A;  2KU3 A;  5FG5 A;  5LVQ A;  4HXR A;  5L98 A;  2KGI A;  4QSP A;  5DLZ A;  4OUF A;  1Z6U A;  5EM3 A;  5FH7 A;  3U5J A;  3M63 A;  5CRZ A;  3ZPV 1;  5HEM A;  5C13 A;  5TCM A;  5F63 A;  4NYW A;  5I7X A;  4YBS A;  5ETB A;  4GND A;  4GB0 A;  5CFW A;  4LZS A;  4PTB A;  5IGM A;  4LDF A;  5CUE A;  1LDJ B;  5FG4 A;  5CP5 A;  3MXF A;  2L85 A;  3O37 A;  5CQT A;  5H1V A;  4PPE A;  4ZQL A;  5ENF A;  4FK5 A;  5DW1 A;  3JVK A;  4J1P A;  2PNX A;  4QUU A;  5HRV A;  3VK6 A;  4NYX A;  4YH3 A;  4F3I A;  5D3J A;  1VFY A;  5BT5 A;  4QBM A;  5G4S A;  3SVF A;  2MT5 A;  2VJF B;  5B76 A;  4ZUX U;  3ZPV E;  5CZG A;  5I40 A;  5E3G A;  2E7O A;  5E9V A;  3HMH A;  4BW4 A;  5TDR A;  3UVD A;  4YBM A;  2LRI C;  2WP2 A;  4A9H A;  3SOX A;  4TZ8 A;  4A9E A;  4CFL A;  5AMF A;  4NR6 A;  3O70 A;  3S92 A;  4C67 A;  2Y1M A;  4TS8 A;  4BW2 A;  2D8S A;  5EWH A;  4TT2 A;  2VJF A;  5E74 A;  4HXO A;  5D24 A;  5I80 A;  2H60 A;  4HBV A;  4YY4 A;  4PKL A;  2XB1 A;  2YW8 A;  5HEL A;  5HRW A;  3MB3 A;  4QST A;  2VJE B;  5TAB A;  1JM4 B;  4QC1 A;  4WZ0 A;  1WUG A;  4Z93 A;  4QF3 A;  5E0R A;  4IOQ A;  4QSS A;  5KHM A;  2ZET C;  5KTU A;  3QZV A;  4CCG X;  4QYL A;  5DYX A;  3L1X A;  2R0Y A;  5ENH A;  4S3O C;  2YHN A;  5FER A;  4LYI A;  4CL9 A;  1T1H A;  2KWO A;  2LDR A;  3IHP A;  3N9Q A;  2E7N A;  3ZYU A;  4WHW A;  2DVQ A;  5JWM A;  3PUR A;  4WZ2 A;  2GRC A;  3RPG B;  3FL2 A;  2VJE A;  4MR5 A;  4A9L A;  4A9F A;  2DX8 A;  2RI7 A;  4YC9 A;  2Y43 A;  1N87 A;  2M1R A;  3RTR B;  5HJC A;  3ZTG A;  5EWV A;  4CUS A;  5EPS A;  2DVS A;  5LJ2 A;  1WEQ A;  5B77 A;  3T6R A;  4KV1 A;  4PCE A;  3PHD A;  4QUT A;  4YAB A;  4O74 A;  2RO1 A;  3P1E A;  2CSY A;  1X4U A;  4I7D A;  5E7D A;  5K29 A;  4LC2 A;  4UYF A;  1E4U A;  4YYK A;  3KQI A;  5IG6 A;  5G04 B;  5FEY A;  3S91 A;  5B79 A;  5EWD A;  2YSM A;  2YHO A;  4BW3 A;  2LGV A;  4HXK A;  4TZ2 A;  2G6Q A;  4A9N A;  5HM0 A;  4A4B A;  4QR5 A;  4UYD A;  5EQ1 A;  4C66 A;  2M85 A;  2L80 A;  4UP5 A;  2RSD A;  4NYV A;  4TU4 A;  2R10 A;  2LV9 A;  2H0D B;  5AD3 A;  1E6I A;  2MJV B;  4ZW1 A;  5BT4 A;  4YAD A;  5C85 A;  3V43 A;  5E9I A;  2KRE A;  5E9Y A;  4Z1Q A;  3Q2E A;  4GNG A;  4QR4 A;  2JMJ A;  3HTK C;  2M3H A;  3QZT A;  5KH9 A;  3DWY A;  4XUB A;  5DYC A;  2EOD A;  3KNV A;  2MD8 C;  4X2I A;  3KV6 A;  1RMD A;  5F1L A;  5ACY A;  4MSX A;  1G25 A;  3KV5 A;  5II2 A;  4TQN A;  5J0D A;  4Q0N A;  5II1 A;  2H0D A;  4X3G A;  2C2V S;  5A5N A;  1JSP B;  2E3K A;  3I2D A;  3U5M A;  2RNY A;  4CFK A;  4AKN A;  1WEV A;  2QJ0 A;  5C7N A;  4O75 A;  2XEU A;  5B78 A;  3L1Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...