4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/protein binding
molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
4TS8A 5ENFA 2CT2A 3FL2A 4YAXA 2FUIA 3MHHA 4MR4A 4YYNA 5II1A 4HXMA 3HCUA 5E9MA 5IGKA 5EP7A 2L75A 1LDJB 2FUUA 4NYXA 4NYWA 4P5OB 2D8SA 4QSUA 2ECIA 4I7DA 2MJVB 2C2VS 4KV1A 2KTBB 1JM4B 4HBWA 1VD4A 5EWCA 5EGUA 5FH7A 5I3LA 4V3KC 2EODA 5FB0A 2ECVA 4NN2A 5L8TA 2D9EA 1WFKA 3IU6A 4MEPA 1LDKC 4ALGA 5E7DA 5LJ2A 5I86A 2LRIC 3M62A 3VK6A 5D3RA 5H1VA 5CUAA 2CSYA 4B86C 5D0CA 3IHPA 5HRVA 2JMDA 1F62A 1EQFA 5FG5A 1HYIA 1WUMA 5ETBA 5I88A 2CKLB 2LGVA 1VYXA 5F1HA 2DWWA 5CRZA 2MIQA 4W4UA 4LZSA 3U5OA 2DVRA 4QZSA 2RS9B 3SVFA 3LJWA 4HXRA 5ENHA 4OGIA 4FIPA 2F42A 2DVSA 5G0FA 5I89A 5FE8A 1WGMA 2YW8A 4MR3A 2KR4A 1HYJA 1X4IA 4ZW1A 1ZBDB 2KREA 5LUUA 4B7YC 5G4SA 4YYKA 1RMDA 2MD7B 2YHOA 2I7KA 5DX4A 3MXFA 5E3GA 2MUMA 2VPDA 3KV5A 4BW1A 3O34A 2ECNA 3O7AA 4QNSA 1WENA 2K16A 3ZNIA 4O7BA 1E6IA 4A4BA 5TABA 4NR6A 5KTWA 2LXPC 1X0JA 4QR4A 4MR5A 4BHWA 1WEQA 4UP0A 4UIWA 4MR6A 2E7NA 1WEVA 4IR6A 2KWNA 3JVMA 4IOQA 5EWHA 2H0DA 2JMJA 2OSSA 3N9NA 3N9MA 1JM7A 4LADB 3I3JA 5D7XA 1JOCA 4Z93A 5C85A 5FG4A 4LYSA 5E3DA 3FKMX 4YYDA 4O64A 2YUCA 5IGNA 2E6SA 2QICA 2XEUA 4IC3A 4NUCA 4J0RA 5EM3A 3P1FA 5L97A 1V87A 4XI1A 4CA1A 4AYCB 4Q0OA 5DFBA 4YK0A 3GL6A 4YYHA 5CQ4A 2EA6A 5F2PA 3I2DA 1T1HA 4TT4A 4HXSA 4GPJA 4WIVA 5E74A 4QSQA 2NXBA 5FB1A 4HXNA 2DVVA 2L5UA 3UV5A 5D25A 4UYGA 4QSVA 5EI4A 5F61A 2K17A 5A5SA 5C89A 4AKNA 4FK5A 5F60A 4LK9A 3Q2EA 5DYAA 5DINA 5D1LB 4N4GA 5F62A 5C13A 5AD2A 4X3GA 5J0DA 4YH4A 4YBMA 1DVPA 2VJEA 4I7BA 4NQMA 5L99A 2LDRA 5FE9A 2F6NA 5LVQA 4MENA 5A7CA 3RPGC 3UVDA 5A82A 3T6RA 5C4QA 3G0LA 4TT2A 5LKZA 3JVLA 4O7EA 3L1ZB 2Y1NA 5EQ1A 4HXKA 4QEWA 4Z1SA 1WEOA 2LXHC 4V3LC 5CQ3A 3LXJA 4A9IA 3UW9A 3QZVA 5DLZA 4CURA 3ZYUA 5FEYA 4YH3A 5DLXA 3U5PA 3LQHA 4UITA 4NRAA 1WE9A 2H0DB 2OO1A 4PCIA 2RNWA 3NG2A 5C87A 4NQNA 3N9PA 4LRGA 3TLPA 2NAAA 4S3OB 4UIVA 3S92A 5H9MA 3QZTA 4LKAA 3EB6A 3SVHA 4F3IA 4R8PK 4YATA 5D3TA 5CFWA 5EISA 4A9KA 5A81A 5HQ5A 3LQIA 5CUCA 5F63A 4CUTA 3KQIA 5ENIA 3PURA 4YC9A 5E9VA 5IBNA 4PPEA 2L0BA 3ZVYA 5H1TA 5A5OA 5DW2A 5ENGA 4UYHA 2EGPA 3UVXA 4NYVA 4C9ZA 4QSWA 4QSTA 5A5NA 3UV4A 2YW5A 5ENCA 2MNYA 2VJFA 4WZ3B 2QIZA 5D1KB 2R0VA 1ZS5A 3C5KA 2VJEB 5CS8A 4GNGA 2GRCA 4QSSA 4NR9A 5IGMA 2RSDA 4YBTA 4HXPA 4QUTA 1WILA 3SOXA 5CQ6A 5CGPA 5CUEA 2E3KA 5ETDA 4XUAA 4A9LA 2VPGA 4LDFA 5FE1A 4LYWA 5CQAA 5DKAA 2LGKA 4WHUA 4NUDA 4ZUXU 4X2IA 4YYGA 5IGLA 5K29A 1U6GB 3ZYQA 5EWVA 2XB1A 5II2A 4LJNA 5HQ7A 5CUGA 4TU6A 5HEMA 5CPEA 2YHNA 4Z6HA 4LLBA 3UV2A 2RFJA 4N4FA 4A9HA 5D3LA 4A9OA 5LKXA 4L7XA 2K1JA 5D26A 2LN0A 2RI7A 5EPRA 4XYAA 2BAYA 2HDPA 3RCWA 1N72A 4QEUA 4YYIA 2KIZA 2KWKA 5FE0A 3Q2FA 5CUBA 5L98A 5A5PA 1WEEA 5AITA 4TZ2A 4QSXA 5D3SA 5EA1A 4PCEA 5I40A 2YYRA 4A9MA 5FE2A 2ECWA 3N9QA 3HMEA 4LZ2A 4FO9A 2YDWA 3DAIA 1JSPB 4O70A 4CLBA 3JVKA 4DONA 4J0SA 5B75A 3G0JA 2MT5A 5EVAA 5B76A 4BBQA 2M6MA 5CZGA 2UZGA 1X4JA 4NS5A 4UIYA 4UIZA 5L8UA 5COIA 4BW4A 3SOUA 2G43A 1F68A 5FE6A 2R0YA 4L58A 4A49A 5G04B 5I7YA 3DQVR 1N87A 3V43A 2KGGA 3C6WA 5LJ0A 4O76A 5DKHA 3SHBA 2E7OA 5KH9A 4O7FA 4PTBA 2LGLA 3HMHA 5FE3A 5AMEA 4HXOA 4XY8A 5E9YA 5J3XA 5HCLA 4MVTA 4N4HA 5D24A 1XWHA 3O70A 5DBMA 3S91A 4LR6A 5HM0A 5F36A 2YQDA 3MULA 5EICA 5A5RA 3NXBA 1FBVA 5DY7A 5HJCA 4TQNA 4TKPB 3ASLA 3SOWA 5KTUA 4WZ0A 2G45A 2VNFA 2AN6A 4KCXA 3T7LA 2LQ6A 3L1XA 4YABA 5CU8A 2L43A 5CQ7A 2DVQA 3UVYA 4CFLA 3MB4A 5HENA 1WEUA 3L11A 2YYNA 4UIUA 4KV4A 3U5NA 5G05B 4O78A 2YQLA 4MEQA 4O7AA 3ZPV1 4A9EA 5CQTA 2KWJA 5DFDA 2YURA 5F3AA 4CFKA 2D82A 5AIUA 4IR4A 5FE5A 4QSPA 5D3PA 3HCTA 5ENBA 2RNXA 5FFWA 4A4CA 2YT5A 4OUFA 3HCSA 4A9JA 5EWDA 5I83A 4Q6FA 4HBVA 5I7XA 3M63A 5D1MB 2I8NA 3KV6A 2MA6A 4WA6A 2HYED 1MM2A 4TZ8A 5A85A 2KU3A 5EYAF 4YY4A 4QBMA 5B8DA 1JM7B 4UP5A 2K4DA 5FERA 1WEPA 2DKWA 4PKLA 5F5ZA 5FFYA 5JI8A 4NRCA 2YSJA 4N3WA 4TTEA 4QF2A 1CHCA 5TDRA 4O75A 2G6QA 4UYDA 2KFTA 1Z6UA 4XUBA 3EB5A 1BORA 5LKTA 5FE7A 4R7EA 4UYFA 3N9OA 5I1QA 5H85A 4N4IA 3U5KA 4LYIA 3P5OA 2M85A 4QC3A 1WIMA 4CUSA 2L84A 2Y1MA 2VPEA 4C67A 5HRWA 4NUEA 1WESA 5CRMA 2E6RA 4S3OC 5DFCA 5EPBA 4O74A 2RNYA 4YY6A 5DKDA 5I29A 5IIDA 3U5LA 2YU4A 5I80A 4BW2A 2DATA 5JWMA 4CCGX 4YYJA 4CUUA 4CUQA 4A0CD 3MUKA 3HTKC 4WZ2A 4AP4A 4E96A 2R0SA 4OGJA 4ZQLA 1MM3A 2MA5A 5C8GA 5E9KA 1Z60A 2YEMA 5B77A 2G4AA 4QYLA 2YEKA 4BJXA 5C11A 5CQ5A 5FDZA 4O77A 2RO1A 4ALHA 3DWYA 2OXQC 5LKUA 2KYUA 3JVJA 4IOOA 3M99A 4NRBA 4TT6A 4ZC9A 5TB6A 2IDAA 5CY9A 1K2FA 2VPBA 5E9IA 5HRXA 2YREA 4PY6A 1WEMA 4O7CA 5HQ6A 4PS5A 2WP2A 2DX8A 4QSRA 4UIXA 2PNXA 4AYCA 5TRBA 5H1UA 1E4UA 4IR5A 3P1EA 4C66A 1FP0A 5FG6A 4UI9B 4MEOA 4J1PA 4UYFB 2H60A 4O72A 2I50A 3KNVA 4TU4A 4Z6IA 5D3NA 5LJ1A 4AVXA 5CUDA 2PUYA 3ONIA 5B79A 5EPSA 5FH8A 5EWWA 3ZTGA 2F6JA 2VJFB 3N9LA 4ZDTA 3MB3A 4HXLA 4CL9A 5HFRA 2YQMA 4XY9A 3O33A 4QB3A 2KWOA 5BT3A 5AD3A 5DYUA 4Q0NA 5AMFA 4NXJA 4R2YA 5E0RA 4A9NA 4F52B 3AADA 5ACYA 5DKCA 4AUQB 5CP5A 2ZETC 4IC2A 3P1CA 4J3IA 5ENEA 5E73A 2OUOA 5B78A 5LCWB 5FBXA 5BT5A 1VFYA 5KHMA 1WEWA 2ECJA 2LV9A 3MHSA 3ZVZB 3U5JA 5KTXA 2L85A 5LVRA 4QYDA 5FE4A 3LQJA 4UYEA 5FH6A 4IR3A 4QR3A 4QUUA 3SVGA 4QR5A 5DW1A 5HLSA 2M3HA 4MSXA 2WP1A 4QY4A 2LSPB 5CQ8A 2M1RA 5BT4A 4NR7A 4A9FA 3DPLR 3HMFA 3GG3A 5L96A 4GNEA 3RPGB 1IYMA 3O37A 2ECTA 5KU3A 4YBSA 5C7NA 5IG6A 3D7CA 5HFQA 5TBNA 3P1DA 4LZRA 2ECGA 2YSMA 4FJCA 4GNDA 5E9LA 2R10A 5KH3A 5A83A 1G25A 4QF3A 4RVRA 5G4RA 3IU5A 4NR4A 5HELA 5EK9A 4GB0A 5F25A 3ZPVE 4Y03A 3RTRB 4BW3A 2KGIA 2KE1A 2LGGA 2FSAA 4NR8A 4CUPA 2VP7A 3O36A 4GNFA 3MQMA 3AQAA 2MNZA 3GV4A 5TDWA 5KO4A 5D3JA 5F1LA 4QEVA 3LRQA 4WHWA 4TYLA 2L5EA 3K2JA 4HBXA 4YADA 5TCMA 5A5QA 5EU1A 3QZSA 5ENJA 1WUGA 4IORA 5FFVA 4FLPA 2C2LA 5EV9A 2CSZA 4LC2A 2L80A 2Y43A 3PHDA 5D3HA 4QC1A 5CTLA 2CKLA 5KH7A 4Z1QA 5DYXA 3O35A 2MD8C 2QJ0A 5JG6A 2JMIA 1Z2QA 4O71A 3PUQA 4YYMA 2JRJA 4HBYA 1X4UA 5DYCA 4I7CA 4NR5A 3UVWA 2N9GA 3U5MA 2YELA
chains in the Genus database with same CATH superfamily
4TS8A 5ENFA 2CT2A 3FL2A 4YAXA 2FUIA 3MHHA 4MR4A 4YYNA 5II1A 4HXMA 3HCUA 5E9MA 5IGKA 5EP7A 2L75A 1LDJB 2FUUA 4NYXA 4NYWA 4P5OB 2D8SA 4QSUA 4AKHA 2ECIA 4I7DA 2MJVB 2C2VS 4OGEA 4KV1A 2KTBB 2D8UA 1JM4B 4HBWA 2CSVA 1VD4A 5EWCA 5EGUA 5FH7A 5I3LA 4V3KC 2EODA 5FB0A 2ECVA 3H7HA 4NN2A 5L8TA 2D9EA 1WFKA 3IU6A 4MEPA 1LDKC 4ALGA 5E7DA 5LJ2A 5I86A 4AI6A 2LRIC 3M62A 3VK6A 5D3RA 5H1VA 5CUAA 2CSYA 2RR4A 4B86C 5D0CA 3IHPA 5HRVA 2JMDA 1F62A 1EQFA 5FG5A 3O7AA 1HYIA 3DDTA 1WUMA 5ETBA 5I88A 2CKLB 2LGVA 1VYXA 5F1HA 2DWWA 5CRZA 2MIQA 4W4UA 4LZSA 3U5OA 2DVRA 4QZSA 2RS9B 3SVFA 3LJWA 4HXRA 5ENHA 4OGIA 4FIPA 2F42A 4F1PA 2DVSA 5G0FA 5I89A 5FE8A 1WGMA 2YW8A 4MR3A 2KR4A 1HYJA 1X4IA 4ZW1A 1ZBDB 2KREA 5LUUA 4B7YC 5G4SA 4YYKA 1RMDA 2XP0A 2MD7B 2YHOA 2I7KA 5DX4A 2CRWA 3E2DA 3MXFA 5E3GA 2MUMA 2VPDA 3KV5A 4BW1A 3O34A 2ECNA 3FJUB 4QNSA 1WENA 2K16A 2YVRA 3ZNIA 4O7BA 1E6IA 3LVRE 4A4BA 5TABA 4NR6A 3DWDA 5KTWA 2LXPC 1X0JA 4QR4A 4MR5A 4BHWA 1WEQA 4UP0A 4UIWA 4MR6A 2E7NA 1WEVA 4IR6A 2KWNA 3JVMA 4IOQA 5EWHA 2H0DA 2JMJA 2OSSA 3N9NA 3N9MA 1JM7A 4LADB 3I3JA 5D7XA 1JOCA 4Z93A 5C85A 5FG4A 4LYSA 5E3DA 3FKMX 4YYDA 4O64A 2YUCA 5IGNA 2E6SA 2XOYA 2QICA 2XEUA 4IC3A 4NUCA 4J0RA 5EM3A 3ERRA 3P1FA 5L97A 1V87A 4XI1A 4CA1A 4AYCB 4Q0OA 3VKHA 5DFBA 4YK0A 3GL6A 4YYHA 5CQ4A 2EA6A 5F2PA 3I2DA 3FM8C 3D1BA 1T1HA 4TT4A 4HXSA 4GPJA 4WIVA 5E74A 2JM3A 3SUBA 4QSQA 2NXBA 2L7PA 5FB1A 4HXNA 2DVVA 2L5UA 3UV5A 5D25A 4UYGA 4QSVA 2EJNA 5EI4A 5F61A 2K17A 3LJUX 5A5SA 5C89A 4AKNA 4FK5A 5F60A 4LK9A 3Q2EA 5DYAA 5DINA 5D1LB 4N4GA 5F62A 5C13A 5AD2A 4X3GA 5J0DA 4YH4A 4YBMA 1DVPA 2VJEA 4I7BA 4NQMA 5L99A 2LDRA 5FE9A 2F6NA 5LVQA 4MENA 5A7CA 3RPGC 3UVDA 5A82A 3T6RA 5C4QA 3G0LA 4TT2A 5LKZA 3JVLA 4O7EA 3L1ZB 1PUOA 3LVQE 2Y1NA 5EQ1A 4HXKA 4QEWA 4Z1SA 1WEOA 2LXHC 4V3LC 5CQ3A 3LXJA 4A9IA 3UW9A 3QZVA 2B0OE 5DLZA 4CURA 3ZYUA 5FEYA 4YH3A 5DLXA 3U5PA 3LQHA 2IQJA 4UITA 4NRAA 1WE9A 2H0DB 2OO1A 3JUEA 4PCIA 2RNWA 3NG2A 5C87A 4NQNA 2KKYA 4LRGA 3TLPA 2NAAA 3N9PA 4UIVA 4S3OB 3S92A 5H9MA 3QZTA 4LKAA 3EB6A 3SVHA 4F3IA 4R8PK 4YATA 5D3TA 5CFWA 5EISA 4A9KA 5A81A 5HQ5A 3LQIA 5CUCA 2EGMA 2P57A 5F63A 4CUTA 3KQIA 5ENIA 1ZKRA 4YC9A 3PURA 5E9VA 5IBNA 4PPEA 2L0BA 3ZVYA 5H1TA 5A5OA 5DW2A 5ENGA 4UYHA 2EGPA 3UVXA 4NYVA 4C9ZA 4QSWA 4QSTA 5A5NA 3UV4A 2YW5A 5ENCA 1DCQA 2MNYA 2VJFA 4WZ3B 2QIZA 5D1KB 2R0VA 1ZS5A 3C5KA 2VJEB 5CS8A 4GNGA 2GRCA 4QSSA 4NR9A 5IGMA 2RSDA 4YBTA 4HXPA 4QUTA 1WILA 3SOXA 5CQ6A 5CGPA 5CUEA 2E3KA 5ETDA 4XUAA 4A9LA 2VPGA 4LDFA 5FE1A 4LYWA 3KDEC 5CQAA 5DKAA 2LGKA 4WHUA 4NUDA 1MBMA 4ZUXU 4X2IA 4YYGA 5IGLA 5K29A 1U6GB 3ZYQA 5EWVA 2XB1A 5II2A 4LJNA 5HQ7A 5CUGA 4TU6A 5HEMA 5CPEA 2YHNA 4Z6HA 4LLBA 3UV2A 2RFJA 4N4FA 4A9HA 5D3LA 4A9OA 5LKXA 2MKEA 3PLWA 2K1JA 5D26A 2LN0A 4L7XA 2RI7A 5EPRA 4XYAA 2BAYA 2HDPA 3RCWA 1N72A 4QEUA 4YYIA 2KIZA 2KWKA 5FE0A 3Q2FA 5CUBA 5L98A 5A5PA 1WEEA 5AITA 4TZ2A 4QSXA 5D3SA 5EA1A 4PCEA 5I40A 2YYRA 4A9MA 5FE2A 2ECWA 3N9QA 4OGCA 3HMEA 4LZ2A 4FO9A 2YDWA 3DAIA 1JSPB 4O70A 4CLBA 3JVKA 4DONA 4J0SA 5B75A 3G0JA 2MT5A 5EVAA 5B76A 4BBQA 2M6MA 5CZGA 2UZGA 1X4JA 4NS5A 4UIYA 4UIZA 5L8UA 5COIA 4BW4A 3SOUA 2G43A 1F68A 5FE6A 2R0YA 4L58A 4A49A 5G04B 5I7YA 3DQVR 1N87A 3FAOA 3V43A 2KGGA 3C6WA 4H9DA 5LJ0A 4O76A 5DKHA 5K3QA 3SHBA 2E7OA 5KH9A 4O7FA 4PTBA 2LGLA 3HMHA 5FE3A 5AMEA 4HXOA 4XY8A 5E9YA 5J3XA 5HCLA 4MVTA 4N4HA 5D24A 1XWHA 3O70A 5DBMA 3S91A 4LR6A 5HM0A 5F36A 2YQDA 3MULA 5EICA 5A5RA 3NXBA 4AKIA 1FBVA 5DY7A 5HJCA 4TQNA 4TKPB 3ASLA 3SOWA 5KTUA 4WZ0A 2G45A 2KKXA 2VNFA 2AN6A 2DSMA 2FFWA 4KCXA 3T7LA 2LQ6A 3L1XA 4YABA 5CU8A 2L43A 5CQ7A 2DVQA 3UVYA 4CFLA 3MB4A 5HENA 1WEUA 3L11A 2YYNA 4UIUA 4KV4A 3U5NA 2LAUA 4O78A 2YQLA 5G05B 5SVIA 4MEQA 4O7AA 3ZPV1 4A9EA 5CQTA 2KWJA 5DFDA 2YURA 5F3AA 4CFKA 2E61A 2D82A 5AIUA 4IR4A 5FE5A 3O47A 4QSPA 5D3PA 3HCTA 5ENBA 2RNXA 5FFWA 4A4CA 2YT5A 4OUFA 3D1DA 4A9JA 3HCSA 5EWDA 5I83A 4Q6FA 4HBVA 5I7XA 3M63A 5D1MB 2I8NA 5SVYA 3KV6A 2MA6A 4WA6A 2HYED 1MM2A 4TZ8A 5A85A 2EXUA 2KU3A 5EYAF 4YY4A 4QBMA 5B8DA 1JM7B 4UP5A 2K4DA 5FERA 1WEPA 2DKWA 4PKLA 5F5ZA 5FFYA 5JI8A 4NRCA 2YSJA 4N3WA 4TTEA 4QF2A 1CHCA 5TDRA 4O75A 2G6QA 4UYDA 2KFTA 1Z6UA 4XUBA 3EB5A 1BORA 5LKTA 5FE7A 3FEHA 4R7EA 4UYFA 3N9OA 5I1QA 5H85A 4N4IA 3U5KA 4LYIA 3P5OA 2M85A 4QC3A 1WIMA 4CUSA 2L84A 2Y1MA 2VPEA 4C67A 5HRWA 4NUEA 1WESA 5CRMA 2E6RA 4S3OC 5DFCA 5EPBA 4O74A 2RNYA 4YY6A 5DKDA 5I29A 5IIDA 3U5LA 2YU4A 5I80A 5SVXA 4BW2A 2DATA 5JWMA 4CCGX 4YYJA 4CUUA 4CUQA 4A0CD 3MUKA 3HTKC 4WZ2A 4AP4A 2XOZA 4E96A 2FD4A 5SVIB 2R0SA 4OGJA 3VKGA 4ZQLA 2DJAA 1MM3A 2MA5A 5C8GA 5E9KA 1Z60A 2YEMA 5B77A 2G4AA 4QYLA 2YEKA 4BJXA 5C11A 5CQ5A 5FDZA 4O77A 2RO1A 4ALHA 3DWYA 4O62A 2OXQC 5LKUA 2KYUA 3JVJA 4IOOA 3M99A 4NRBA 4TT6A 4ZC9A 5TB6A 2IDAA 5CY9A 1K2FA 2VPBA 5E9IA 5HRXA 2YREA 4PY6A 1WEMA 4O7CA 5HQ6A 4PS5A 2WP2A 2DX8A 4QSRA 4UIXA 2PNXA 4AYCA 5TRBA 5H1UA 1E4UA 4IR5A 2JUNA 3P1EA 4C66A 1FP0A 5FG6A 4AKGA 4UI9B 4MEOA 4J1PA 4UYFB 2H60A 4O72A 2I50A 3KNVA 4TU4A 4Z6IA 5D3NA 5LJ1A 4AVXA 5CUDA 2PUYA 3ONIA 5B79A 5EPSA 5FH8A 5EWWA 3ZTGA 2F6JA 2VJFB 3N9LA 4ZDTA 2CRRA 3MB3A 4HXLA 4CL9A 5HFRA 2YQMA 4XY9A 3O33A 4QB3A 2KWOA 5BT3A 5AD3A 5DYUA 4Q0NA 5AMFA 4NXJA 4R2YA 5E0RA 4A9NA 4F52B 3AADA 5ACYA 5DKCA 4AUQB 5CP5A 2ZETC 4IC2A 3LDYA 3P1CA 4J3IA 5ENEA 5E73A 2OUOA 5B78A 5LCWB 5FBXA 5BT5A 1VFYA 5KHMA 1WEWA 2ECJA 2LV9A 3MHSA 3ZVZB 3U5JA 5KTXA 2L85A 5LVRA 4QYDA 5FE4A 3LQJA 4UYEA 5FH6A 4IR3A 4QR3A 4QUUA 3SVGA 2CONA 4QR5A 5DW1A 5HLSA 2M3HA 4MSXA 2WP1A 4Z0RA 4QY4A 3FANA 2LSPB 5CQ8A 2M1RA 5BT4A 4NR7A 4A9FA 2XOCA 3DPLR 3HMFA 3GG3A 5L96A 4GNEA 3RPGB 1IYMA 3O37A 2ECTA 5KU3A 4YBSA 5C7NA 5IG6A 3D7CA 3MDBC 5HFQA 5TBNA 3P1DA 4LZRA 2ECGA 2YSMA 4FJCA 4GNDA 5E9LA 2R10A 5KH3A 5A83A 2M13A 1G25A 4QF3A 4RVRA 5G4RA 3IU5A 4NR4A 5HELA 5EK9A 4GB0A 5F25A 3Q1DA 4Y03A 3RTRB 4BW3A 2KGIA 2KE1A 2LGGA 3ZPVE 2FSAA 4NR8A 4CUPA 2VP7A 3O36A 4GNFA 3MQMA 3AQAA 2MNZA 3GV4A 4QQ4A 5TDWA 5KO4A 5D3JA 5F1LA 4QEVA 3LRQA 4WHWA 4TYLA 2L5EA 3K2JA 4HBXA 4YADA 5TCMA 5A5QA 5EU1A 3QZSA 5ENJA 1WUGA 4IORA 5FFVA 4FLPA 2C2LA 5EV9A 2CSZA 4LC2A 2L80A 2Y43A 3PHDA 5D3HA 4QC1A 5CTLA 2CKLA 5KH7A 4Z1QA 5DYXA 3O35A 2MD8C 2QJ0A 5JG6A 3T9KA 2JMIA 1Z2QA 4O71A 3PUQA 4YYMA 2JRJA 4Z0OA 4HBYA 1X4UA 5DYCA 4I7CA 4NR5A 3M7KA 3UVWA 2N9GA 2OWAA 3U5MA 2YELA
chains in the Genus database with same CATH topology
4TS8A 5ENFA 2CT2A 3FL2A 4YAXA 2FUIA 3MHHA 4MR4A 4YYNA 5II1A 4HXMA 3HCUA 5E9MA 5IGKA 5EP7A 2L75A 1LDJB 2FUUA 4NYXA 4NYWA 4P5OB 2D8SA 4QSUA 2ECIA 4I7DA 2MJVB 2C2VS 4KV1A 2KTBB 1JM4B 4HBWA 1VD4A 5EWCA 5EGUA 5FH7A 5I3LA 4V3KC 2EODA 5FB0A 2ECVA 4NN2A 5L8TA 2D9EA 1WFKA 3IU6A 4MEPA 1LDKC 4ALGA 5E7DA 5LJ2A 5I86A 2LRIC 3M62A 3VK6A 5D3RA 5H1VA 5CUAA 2CSYA 4B86C 5D0CA 3IHPA 5HRVA 2JMDA 1F62A 1EQFA 5FG5A 1HYIA 1WUMA 5ETBA 5I88A 2CKLB 2LGVA 1VYXA 5F1HA 2DWWA 5CRZA 2MIQA 4W4UA 4LZSA 3U5OA 2DVRA 4QZSA 2RS9B 3SVFA 3LJWA 4HXRA 5ENHA 4OGIA 4FIPA 2F42A 2DVSA 5G0FA 5I89A 5FE8A 1WGMA 2YW8A 4MR3A 2KR4A 1HYJA 1X4IA 4ZW1A 1ZBDB 2KREA 5LUUA 4B7YC 5G4SA 4YYKA 1RMDA 2MD7B 2YHOA 2I7KA 5DX4A 3MXFA 5E3GA 2MUMA 2VPDA 3KV5A 4BW1A 3O34A 2ECNA 3O7AA 4QNSA 1WENA 2K16A 3ZNIA 4O7BA 1E6IA 4A4BA 5TABA 4NR6A 5KTWA 2LXPC 1X0JA 4QR4A 4MR5A 4BHWA 1WEQA 4UP0A 4UIWA 4MR6A 2E7NA 1WEVA 4IR6A 2KWNA 3JVMA 4IOQA 5EWHA 2H0DA 2JMJA 2OSSA 3N9NA 3N9MA 1JM7A 4LADB 3I3JA 5D7XA 1JOCA 4Z93A 5C85A 5FG4A 4LYSA 5E3DA 3FKMX 4YYDA 4O64A 2YUCA 5IGNA 2E6SA 2QICA 2XEUA 4IC3A 4NUCA 4J0RA 5EM3A 3P1FA 5L97A 1V87A 4XI1A 4CA1A 4AYCB 4Q0OA 5DFBA 4YK0A 3GL6A 4YYHA 5CQ4A 2EA6A 5F2PA 3I2DA 1T1HA 4TT4A 4HXSA 4GPJA 4WIVA 5E74A 4QSQA 2NXBA 5FB1A 4HXNA 2DVVA 2L5UA 3UV5A 5D25A 4UYGA 4QSVA 5EI4A 5F61A 2K17A 5A5SA 5C89A 4AKNA 4FK5A 5F60A 4LK9A 3Q2EA 5DYAA 5DINA 5D1LB 4N4GA 5F62A 5C13A 5AD2A 4X3GA 5J0DA 4YH4A 4YBMA 1DVPA 2VJEA 4I7BA 4NQMA 5L99A 2LDRA 5FE9A 2F6NA 5LVQA 4MENA 5A7CA 3RPGC 3UVDA 5A82A 3T6RA 5C4QA 3G0LA 4TT2A 5LKZA 3JVLA 4O7EA 3L1ZB 2Y1NA 5EQ1A 4HXKA 4QEWA 4Z1SA 1WEOA 2LXHC 4V3LC 5CQ3A 3LXJA 4A9IA 3UW9A 3QZVA 5DLZA 4CURA 3ZYUA 5FEYA 4YH3A 5DLXA 3U5PA 3LQHA 4UITA 4NRAA 1WE9A 2H0DB 2OO1A 4PCIA 2RNWA 3NG2A 5C87A 4NQNA 3N9PA 4LRGA 3TLPA 2NAAA 4S3OB 4UIVA 3S92A 5H9MA 3QZTA 4LKAA 3EB6A 3SVHA 4F3IA 4R8PK 4YATA 5D3TA 5CFWA 5EISA 4A9KA 5A81A 5HQ5A 3LQIA 5CUCA 5F63A 4CUTA 3KQIA 5ENIA 3PURA 4YC9A 5E9VA 5IBNA 4PPEA 2L0BA 3ZVYA 5H1TA 5A5OA 5DW2A 5ENGA 4UYHA 2EGPA 3UVXA 4NYVA 4C9ZA 4QSWA 4QSTA 5A5NA 3UV4A 2YW5A 5ENCA 2MNYA 2VJFA 4WZ3B 2QIZA 5D1KB 2R0VA 1ZS5A 3C5KA 2VJEB 5CS8A 4GNGA 2GRCA 4QSSA 4NR9A 5IGMA 2RSDA 4YBTA 4HXPA 4QUTA 1WILA 3SOXA 5CQ6A 5CGPA 5CUEA 2E3KA 5ETDA 4XUAA 4A9LA 2VPGA 4LDFA 5FE1A 4LYWA 5CQAA 5DKAA 2LGKA 4WHUA 4NUDA 4ZUXU 4X2IA 4YYGA 5IGLA 5K29A 1U6GB 3ZYQA 5EWVA 2XB1A 5II2A 4LJNA 5HQ7A 5CUGA 4TU6A 5HEMA 5CPEA 2YHNA 4Z6HA 4LLBA 3UV2A 2RFJA 4N4FA 4A9HA 5D3LA 4A9OA 5LKXA 4L7XA 2K1JA 5D26A 2LN0A 2RI7A 5EPRA 4XYAA 2BAYA 2HDPA 3RCWA 1N72A 4QEUA 4YYIA 2KIZA 2KWKA 5FE0A 3Q2FA 5CUBA 5L98A 5A5PA 1WEEA 5AITA 4TZ2A 4QSXA 5D3SA 5EA1A 4PCEA 5I40A 2YYRA 4A9MA 5FE2A 2ECWA 3N9QA 3HMEA 4LZ2A 4FO9A 2YDWA 3DAIA 1JSPB 4O70A 4CLBA 3JVKA 4DONA 4J0SA 5B75A 3G0JA 2MT5A 5EVAA 5B76A 4BBQA 2M6MA 5CZGA 2UZGA 1X4JA 4NS5A 4UIYA 4UIZA 5L8UA 5COIA 4BW4A 3SOUA 2G43A 1F68A 5FE6A 2R0YA 4L58A 4A49A 5G04B 5I7YA 3DQVR 1N87A 3V43A 2KGGA 3C6WA 5LJ0A 4O76A 5DKHA 3SHBA 2E7OA 5KH9A 4O7FA 4PTBA 2LGLA 3HMHA 5FE3A 5AMEA 4HXOA 4XY8A 5E9YA 5J3XA 5HCLA 4MVTA 4N4HA 5D24A 1XWHA 3O70A 5DBMA 3S91A 4LR6A 5HM0A 5F36A 2YQDA 3MULA 5EICA 5A5RA 3NXBA 1FBVA 5DY7A 5HJCA 4TQNA 4TKPB 3ASLA 3SOWA 5KTUA 4WZ0A 2G45A 2VNFA 2AN6A 4KCXA 3T7LA 2LQ6A 3L1XA 4YABA 5CU8A 2L43A 5CQ7A 2DVQA 3UVYA 4CFLA 3MB4A 5HENA 1WEUA 3L11A 2YYNA 4UIUA 4KV4A 3U5NA 5G05B 4O78A 2YQLA 4MEQA 4O7AA 3ZPV1 4A9EA 5CQTA 2KWJA 5DFDA 2YURA 5F3AA 4CFKA 2D82A 5AIUA 4IR4A 5FE5A 4QSPA 5D3PA 3HCTA 5ENBA 2RNXA 5FFWA 4A4CA 2YT5A 4OUFA 3HCSA 4A9JA 5EWDA 5I83A 4Q6FA 4HBVA 5I7XA 3M63A 5D1MB 2I8NA 3KV6A 2MA6A 4WA6A 2HYED 1MM2A 4TZ8A 5A85A 2KU3A 5EYAF 4YY4A 4QBMA 5B8DA 1JM7B 4UP5A 2K4DA 5FERA 1WEPA 2DKWA 4PKLA 5F5ZA 5FFYA 5JI8A 4NRCA 2YSJA 4N3WA 4TTEA 4QF2A 1CHCA 5TDRA 4O75A 2G6QA 4UYDA 2KFTA 1Z6UA 4XUBA 3EB5A 1BORA 5LKTA 5FE7A 4R7EA 4UYFA 3N9OA 5I1QA 5H85A 4N4IA 3U5KA 4LYIA 3P5OA 2M85A 4QC3A 1WIMA 4CUSA 2L84A 2Y1MA 2VPEA 4C67A 5HRWA 4NUEA 1WESA 5CRMA 2E6RA 4S3OC 5DFCA 5EPBA 4O74A 2RNYA 4YY6A 5DKDA 5I29A 5IIDA 3U5LA 2YU4A 5I80A 4BW2A 2DATA 5JWMA 4CCGX 4YYJA 4CUUA 4CUQA 4A0CD 3MUKA 3HTKC 4WZ2A 4AP4A 4E96A 2R0SA 4OGJA 4ZQLA 1MM3A 2MA5A 5C8GA 5E9KA 1Z60A 2YEMA 5B77A 2G4AA 4QYLA 2YEKA 4BJXA 5C11A 5CQ5A 5FDZA 4O77A 2RO1A 4ALHA 3DWYA 2OXQC 5LKUA 2KYUA 3JVJA 4IOOA 3M99A 4NRBA 4TT6A 4ZC9A 5TB6A 2IDAA 5CY9A 1K2FA 2VPBA 5E9IA 5HRXA 2YREA 4PY6A 1WEMA 4O7CA 5HQ6A 4PS5A 2WP2A 2DX8A 4QSRA 4UIXA 2PNXA 4AYCA 5TRBA 5H1UA 1E4UA 4IR5A 3P1EA 4C66A 1FP0A 5FG6A 4UI9B 4MEOA 4J1PA 4UYFB 2H60A 4O72A 2I50A 3KNVA 4TU4A 4Z6IA 5D3NA 5LJ1A 4AVXA 5CUDA 2PUYA 3ONIA 5B79A 5EPSA 5FH8A 5EWWA 3ZTGA 2F6JA 2VJFB 3N9LA 4ZDTA 3MB3A 4HXLA 4CL9A 5HFRA 2YQMA 4XY9A 3O33A 4QB3A 2KWOA 5BT3A 5AD3A 5DYUA 4Q0NA 5AMFA 4NXJA 4R2YA 5E0RA 4A9NA 4F52B 3AADA 5ACYA 5DKCA 4AUQB 5CP5A 2ZETC 4IC2A 3P1CA 4J3IA 5ENEA 5E73A 2OUOA 5B78A 5LCWB 5FBXA 5BT5A 1VFYA 5KHMA 1WEWA 2ECJA 2LV9A 3MHSA 3ZVZB 3U5JA 5KTXA 2L85A 5LVRA 4QYDA 5FE4A 3LQJA 4UYEA 5FH6A 4IR3A 4QR3A 4QUUA 3SVGA 4QR5A 5DW1A 5HLSA 2M3HA 4MSXA 2WP1A 4QY4A 2LSPB 5CQ8A 2M1RA 5BT4A 4NR7A 4A9FA 3DPLR 3HMFA 3GG3A 5L96A 4GNEA 3RPGB 1IYMA 3O37A 2ECTA 5KU3A 4YBSA 5C7NA 5IG6A 3D7CA 5HFQA 5TBNA 3P1DA 4LZRA 2ECGA 2YSMA 4FJCA 4GNDA 5E9LA 2R10A 5KH3A 5A83A 1G25A 4QF3A 4RVRA 5G4RA 3IU5A 4NR4A 5HELA 5EK9A 4GB0A 5F25A 3ZPVE 4Y03A 3RTRB 4BW3A 2KGIA 2KE1A 2LGGA 2FSAA 4NR8A 4CUPA 2VP7A 3O36A 4GNFA 3MQMA 3AQAA 2MNZA 3GV4A 5TDWA 5KO4A 5D3JA 5F1LA 4QEVA 3LRQA 4WHWA 4TYLA 2L5EA 3K2JA 4HBXA 4YADA 5TCMA 5A5QA 5EU1A 3QZSA 5ENJA 1WUGA 4IORA 5FFVA 4FLPA 2C2LA 5EV9A 2CSZA 4LC2A 2L80A 2Y43A 3PHDA 5D3HA 4QC1A 5CTLA 2CKLA 5KH7A 4Z1QA 5DYXA 3O35A 2MD8C 2QJ0A 5JG6A 2JMIA 1Z2QA 4O71A 3PUQA 4YYMA 2JRJA 4HBYA 1X4UA 5DYCA 4I7CA 4NR5A 3UVWA 2N9GA 3U5MA 2YELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TS8 A;  5ENF A;  2CT2 A;  3FL2 A;  4YAX A;  2FUI A;  3MHH A;  4MR4 A;  4YYN A;  5II1 A;  4HXM A;  3HCU A;  5E9M A;  5IGK A;  5EP7 A;  2L75 A;  1LDJ B;  2FUU A;  4NYX A;  4NYW A;  4P5O B;  2D8S A;  4QSU A;  2ECI A;  4I7D A;  2MJV B;  2C2V S;  4KV1 A;  2KTB B;  1JM4 B;  4HBW A;  1VD4 A;  5EWC A;  5EGU A;  5FH7 A;  5I3L A;  4V3K C;  2EOD A;  5FB0 A;  2ECV A;  4NN2 A;  5L8T A;  2D9E A;  1WFK A;  3IU6 A;  4MEP A;  1LDK C;  4ALG A;  5E7D A;  5LJ2 A;  5I86 A;  2LRI C;  3M62 A;  3VK6 A;  5D3R A;  5H1V A;  5CUA A;  2CSY A;  4B86 C;  5D0C A;  3IHP A;  5HRV A;  2JMD A;  1F62 A;  1EQF A;  5FG5 A;  1HYI A;  1WUM A;  5ETB A;  5I88 A;  2CKL B;  2LGV A;  1VYX A;  5F1H A;  2DWW A;  5CRZ A;  2MIQ A;  4W4U A;  4LZS A;  3U5O A;  2DVR A;  4QZS A;  2RS9 B;  3SVF A;  3LJW A;  4HXR A;  5ENH A;  4OGI A;  4FIP A;  2F42 A;  2DVS A;  5G0F A;  5I89 A;  5FE8 A;  1WGM A;  2YW8 A;  4MR3 A;  2KR4 A;  1HYJ A;  1X4I A;  4ZW1 A;  1ZBD B;  2KRE A;  5LUU A;  4B7Y C;  5G4S A;  4YYK A;  1RMD A;  2MD7 B;  2YHO A;  2I7K A;  5DX4 A;  3MXF A;  5E3G A;  2MUM A;  2VPD A;  3KV5 A;  4BW1 A;  3O34 A;  2ECN A;  3O7A A;  4QNS A;  1WEN A;  2K16 A;  3ZNI A;  4O7B A;  1E6I A;  4A4B A;  5TAB A;  4NR6 A;  5KTW A;  2LXP C;  1X0J A;  4QR4 A;  4MR5 A;  4BHW A;  1WEQ A;  4UP0 A;  4UIW A;  4MR6 A;  2E7N A;  1WEV A;  4IR6 A;  2KWN A;  3JVM A;  4IOQ A;  5EWH A;  2H0D A;  2JMJ A;  2OSS A;  3N9N A;  3N9M A;  1JM7 A;  4LAD B;  3I3J A;  5D7X A;  1JOC A;  4Z93 A;  5C85 A;  5FG4 A;  4LYS A;  5E3D A;  3FKM X;  4YYD A;  4O64 A;  2YUC A;  5IGN A;  2E6S A;  2QIC A;  2XEU A;  4IC3 A;  4NUC A;  4J0R A;  5EM3 A;  3P1F A;  5L97 A;  1V87 A;  4XI1 A;  4CA1 A;  4AYC B;  4Q0O A;  5DFB A;  4YK0 A;  3GL6 A;  4YYH A;  5CQ4 A;  2EA6 A;  5F2P A;  3I2D A;  1T1H A;  4TT4 A;  4HXS A;  4GPJ A;  4WIV A;  5E74 A;  4QSQ A;  2NXB A;  5FB1 A;  4HXN A;  2DVV A;  2L5U A;  3UV5 A;  5D25 A;  4UYG A;  4QSV A;  5EI4 A;  5F61 A;  2K17 A;  5A5S A;  5C89 A;  4AKN A;  4FK5 A;  5F60 A;  4LK9 A;  3Q2E A;  5DYA A;  5DIN A;  5D1L B;  4N4G A;  5F62 A;  5C13 A;  5AD2 A;  4X3G A;  5J0D A;  4YH4 A;  4YBM A;  1DVP A;  2VJE A;  4I7B A;  4NQM A;  5L99 A;  2LDR A;  5FE9 A;  2F6N A;  5LVQ A;  4MEN A;  5A7C A;  3RPG C;  3UVD A;  5A82 A;  3T6R A;  5C4Q A;  3G0L A;  4TT2 A;  5LKZ A;  3JVL A;  4O7E A;  3L1Z B;  2Y1N A;  5EQ1 A;  4HXK A;  4QEW A;  4Z1S A;  1WEO A;  2LXH C;  4V3L C;  5CQ3 A;  3LXJ A;  4A9I A;  3UW9 A;  3QZV A;  5DLZ A;  4CUR A;  3ZYU A;  5FEY A;  4YH3 A;  5DLX A;  3U5P A;  3LQH A;  4UIT A;  4NRA A;  1WE9 A;  2H0D B;  2OO1 A;  4PCI A;  2RNW A;  3NG2 A;  5C87 A;  4NQN A;  3N9P A;  4LRG A;  3TLP A;  2NAA A;  4S3O B;  4UIV A;  3S92 A;  5H9M A;  3QZT A;  4LKA A;  3EB6 A;  3SVH A;  4F3I A;  4R8P K;  4YAT A;  5D3T A;  5CFW A;  5EIS A;  4A9K A;  5A81 A;  5HQ5 A;  3LQI A;  5CUC A;  5F63 A;  4CUT A;  3KQI A;  5ENI A;  3PUR A;  4YC9 A;  5E9V A;  5IBN A;  4PPE A;  2L0B A;  3ZVY A;  5H1T A;  5A5O A;  5DW2 A;  5ENG A;  4UYH A;  2EGP A;  3UVX A;  4NYV A;  4C9Z A;  4QSW A;  4QST A;  5A5N A;  3UV4 A;  2YW5 A;  5ENC A;  2MNY A;  2VJF A;  4WZ3 B;  2QIZ A;  5D1K B;  2R0V A;  1ZS5 A;  3C5K A;  2VJE B;  5CS8 A;  4GNG A;  2GRC A;  4QSS A;  4NR9 A;  5IGM A;  2RSD A;  4YBT A;  4HXP A;  4QUT A;  1WIL A;  3SOX A;  5CQ6 A;  5CGP A;  5CUE A;  2E3K A;  5ETD A;  4XUA A;  4A9L A;  2VPG A;  4LDF A;  5FE1 A;  4LYW A;  5CQA A;  5DKA A;  2LGK A;  4WHU A;  4NUD A;  4ZUX U;  4X2I A;  4YYG A;  5IGL A;  5K29 A;  1U6G B;  3ZYQ A;  5EWV A;  2XB1 A;  5II2 A;  4LJN A;  5HQ7 A;  5CUG A;  4TU6 A;  5HEM A;  5CPE A;  2YHN A;  4Z6H A;  4LLB A;  3UV2 A;  2RFJ A;  4N4F A;  4A9H A;  5D3L A;  4A9O A;  5LKX A;  4L7X A;  2K1J A;  5D26 A;  2LN0 A;  2RI7 A;  5EPR A;  4XYA A;  2BAY A;  2HDP A;  3RCW A;  1N72 A;  4QEU A;  4YYI A;  2KIZ A;  2KWK A;  5FE0 A;  3Q2F A;  5CUB A;  5L98 A;  5A5P A;  1WEE A;  5AIT A;  4TZ2 A;  4QSX A;  5D3S A;  5EA1 A;  4PCE A;  5I40 A;  2YYR A;  4A9M A;  5FE2 A;  2ECW A;  3N9Q A;  3HME A;  4LZ2 A;  4FO9 A;  2YDW A;  3DAI A;  1JSP B;  4O70 A;  4CLB A;  3JVK A;  4DON A;  4J0S A;  5B75 A;  3G0J A;  2MT5 A;  5EVA A;  5B76 A;  4BBQ A;  2M6M A;  5CZG A;  2UZG A;  1X4J A;  4NS5 A;  4UIY A;  4UIZ A;  5L8U A;  5COI A;  4BW4 A;  3SOU A;  2G43 A;  1F68 A;  5FE6 A;  2R0Y A;  4L58 A;  4A49 A;  5G04 B;  5I7Y A;  3DQV R;  1N87 A;  3V43 A;  2KGG A;  3C6W A;  5LJ0 A;  4O76 A;  5DKH A;  3SHB A;  2E7O A;  5KH9 A;  4O7F A;  4PTB A;  2LGL A;  3HMH A;  5FE3 A;  5AME A;  4HXO A;  4XY8 A;  5E9Y A;  5J3X A;  5HCL A;  4MVT A;  4N4H A;  5D24 A;  1XWH A;  3O70 A;  5DBM A;  3S91 A;  4LR6 A;  5HM0 A;  5F36 A;  2YQD A;  3MUL A;  5EIC A;  5A5R A;  3NXB A;  1FBV A;  5DY7 A;  5HJC A;  4TQN A;  4TKP B;  3ASL A;  3SOW A;  5KTU A;  4WZ0 A;  2G45 A;  2VNF A;  2AN6 A;  4KCX A;  3T7L A;  2LQ6 A;  3L1X A;  4YAB A;  5CU8 A;  2L43 A;  5CQ7 A;  2DVQ A;  3UVY A;  4CFL A;  3MB4 A;  5HEN A;  1WEU A;  3L11 A;  2YYN A;  4UIU A;  4KV4 A;  3U5N A;  5G05 B;  4O78 A;  2YQL A;  4MEQ A;  4O7A A;  3ZPV 1;  4A9E A;  5CQT A;  2KWJ A;  5DFD A;  2YUR A;  5F3A A;  4CFK A;  2D82 A;  5AIU A;  4IR4 A;  5FE5 A;  4QSP A;  5D3P A;  3HCT A;  5ENB A;  2RNX A;  5FFW A;  4A4C A;  2YT5 A;  4OUF A;  3HCS A;  4A9J A;  5EWD A;  5I83 A;  4Q6F A;  4HBV A;  5I7X A;  3M63 A;  5D1M B;  2I8N A;  3KV6 A;  2MA6 A;  4WA6 A;  2HYE D;  1MM2 A;  4TZ8 A;  5A85 A;  2KU3 A;  5EYA F;  4YY4 A;  4QBM A;  5B8D A;  1JM7 B;  4UP5 A;  2K4D A;  5FER A;  1WEP A;  2DKW A;  4PKL A;  5F5Z A;  5FFY A;  5JI8 A;  4NRC A;  2YSJ A;  4N3W A;  4TTE A;  4QF2 A;  1CHC A;  5TDR A;  4O75 A;  2G6Q A;  4UYD A;  2KFT A;  1Z6U A;  4XUB A;  3EB5 A;  1BOR A;  5LKT A;  5FE7 A;  4R7E A;  4UYF A;  3N9O A;  5I1Q A;  5H85 A;  4N4I A;  3U5K A;  4LYI A;  3P5O A;  2M85 A;  4QC3 A;  1WIM A;  4CUS A;  2L84 A;  2Y1M A;  2VPE A;  4C67 A;  5HRW A;  4NUE A;  1WES A;  5CRM A;  2E6R A;  4S3O C;  5DFC A;  5EPB A;  4O74 A;  2RNY A;  4YY6 A;  5DKD A;  5I29 A;  5IID A;  3U5L A;  2YU4 A;  5I80 A;  4BW2 A;  2DAT A;  5JWM A;  4CCG X;  4YYJ A;  4CUU A;  4CUQ A;  4A0C D;  3MUK A;  3HTK C;  4WZ2 A;  4AP4 A;  4E96 A;  2R0S A;  4OGJ A;  4ZQL A;  1MM3 A;  2MA5 A;  5C8G A;  5E9K A;  1Z60 A;  2YEM A;  5B77 A;  2G4A A;  4QYL A;  2YEK A;  4BJX A;  5C11 A;  5CQ5 A;  5FDZ A;  4O77 A;  2RO1 A;  4ALH A;  3DWY A;  2OXQ C;  5LKU A;  2KYU A;  3JVJ A;  4IOO A;  3M99 A;  4NRB A;  4TT6 A;  4ZC9 A;  5TB6 A;  2IDA A;  5CY9 A;  1K2F A;  2VPB A;  5E9I A;  5HRX A;  2YRE A;  4PY6 A;  1WEM A;  4O7C A;  5HQ6 A;  4PS5 A;  2WP2 A;  2DX8 A;  4QSR A;  4UIX A;  2PNX A;  4AYC A;  5TRB A;  5H1U A;  1E4U A;  4IR5 A;  3P1E A;  4C66 A;  1FP0 A;  5FG6 A;  4UI9 B;  4MEO A;  4J1P A;  4UYF B;  2H60 A;  4O72 A;  2I50 A;  3KNV A;  4TU4 A;  4Z6I A;  5D3N A;  5LJ1 A;  4AVX A;  5CUD A;  2PUY A;  3ONI A;  5B79 A;  5EPS A;  5FH8 A;  5EWW A;  3ZTG A;  2F6J A;  2VJF B;  3N9L A;  4ZDT A;  3MB3 A;  4HXL A;  4CL9 A;  5HFR A;  2YQM A;  4XY9 A;  3O33 A;  4QB3 A;  2KWO A;  5BT3 A;  5AD3 A;  5DYU A;  4Q0N A;  5AMF A;  4NXJ A;  4R2Y A;  5E0R A;  4A9N A;  4F52 B;  3AAD A;  5ACY A;  5DKC A;  4AUQ B;  5CP5 A;  2ZET C;  4IC2 A;  3P1C A;  4J3I A;  5ENE A;  5E73 A;  2OUO A;  5B78 A;  5LCW B;  5FBX A;  5BT5 A;  1VFY A;  5KHM A;  1WEW A;  2ECJ A;  2LV9 A;  3MHS A;  3ZVZ B;  3U5J A;  5KTX A;  2L85 A;  5LVR A;  4QYD A;  5FE4 A;  3LQJ A;  4UYE A;  5FH6 A;  4IR3 A;  4QR3 A;  4QUU A;  3SVG A;  4QR5 A;  5DW1 A;  5HLS A;  2M3H A;  4MSX A;  2WP1 A;  4QY4 A;  2LSP B;  5CQ8 A;  2M1R A;  5BT4 A;  4NR7 A;  4A9F A;  3DPL R;  3HMF A;  3GG3 A;  5L96 A;  4GNE A;  3RPG B;  1IYM A;  3O37 A;  2ECT A;  5KU3 A;  4YBS A;  5C7N A;  5IG6 A;  3D7C A;  5HFQ A;  5TBN A;  3P1D A;  4LZR A;  2ECG A;  2YSM A;  4FJC A;  4GND A;  5E9L A;  2R10 A;  5KH3 A;  5A83 A;  1G25 A;  4QF3 A;  4RVR A;  5G4R A;  3IU5 A;  4NR4 A;  5HEL A;  5EK9 A;  4GB0 A;  5F25 A;  3ZPV E;  4Y03 A;  3RTR B;  4BW3 A;  2KGI A;  2KE1 A;  2LGG A;  2FSA A;  4NR8 A;  4CUP A;  2VP7 A;  3O36 A;  4GNF A;  3MQM A;  3AQA A;  2MNZ A;  3GV4 A;  5TDW A;  5KO4 A;  5D3J A;  5F1L A;  4QEV A;  3LRQ A;  4WHW A;  4TYL A;  2L5E A;  3K2J A;  4HBX A;  4YAD A;  5TCM A;  5A5Q A;  5EU1 A;  3QZS A;  5ENJ A;  1WUG A;  4IOR A;  5FFV A;  4FLP A;  2C2L A;  5EV9 A;  2CSZ A;  4LC2 A;  2L80 A;  2Y43 A;  3PHD A;  5D3H A;  4QC1 A;  5CTL A;  2CKL A;  5KH7 A;  4Z1Q A;  5DYX A;  3O35 A;  2MD8 C;  2QJ0 A;  5JG6 A;  2JMI A;  1Z2Q A;  4O71 A;  3PUQ A;  4YYM A;  2JRJ A;  4HBY A;  1X4U A;  5DYC A;  4I7C A;  4NR5 A;  3UVW A;  2N9G A;  3U5M A;  2YEL A; 
#chains in the Genus database with same CATH topology
 4TS8 A;  5ENF A;  2CT2 A;  3FL2 A;  4YAX A;  2FUI A;  3MHH A;  4MR4 A;  4YYN A;  5II1 A;  4HXM A;  3HCU A;  5E9M A;  5IGK A;  5EP7 A;  2L75 A;  1LDJ B;  2FUU A;  4NYX A;  4NYW A;  4P5O B;  2D8S A;  4QSU A;  4AKH A;  2ECI A;  4I7D A;  2MJV B;  2C2V S;  4OGE A;  4KV1 A;  2KTB B;  2D8U A;  1JM4 B;  4HBW A;  2CSV A;  1VD4 A;  5EWC A;  5EGU A;  5FH7 A;  5I3L A;  4V3K C;  2EOD A;  5FB0 A;  2ECV A;  3H7H A;  4NN2 A;  5L8T A;  2D9E A;  1WFK A;  3IU6 A;  4MEP A;  1LDK C;  4ALG A;  5E7D A;  5LJ2 A;  5I86 A;  4AI6 A;  2LRI C;  3M62 A;  3VK6 A;  5D3R A;  5H1V A;  5CUA A;  2CSY A;  2RR4 A;  4B86 C;  5D0C A;  3IHP A;  5HRV A;  2JMD A;  1F62 A;  1EQF A;  5FG5 A;  3O7A A;  1HYI A;  3DDT A;  1WUM A;  5ETB A;  5I88 A;  2CKL B;  2LGV A;  1VYX A;  5F1H A;  2DWW A;  5CRZ A;  2MIQ A;  4W4U A;  4LZS A;  3U5O A;  2DVR A;  4QZS A;  2RS9 B;  3SVF A;  3LJW A;  4HXR A;  5ENH A;  4OGI A;  4FIP A;  2F42 A;  4F1P A;  2DVS A;  5G0F A;  5I89 A;  5FE8 A;  1WGM A;  2YW8 A;  4MR3 A;  2KR4 A;  1HYJ A;  1X4I A;  4ZW1 A;  1ZBD B;  2KRE A;  5LUU A;  4B7Y C;  5G4S A;  4YYK A;  1RMD A;  2XP0 A;  2MD7 B;  2YHO A;  2I7K A;  5DX4 A;  2CRW A;  3E2D A;  3MXF A;  5E3G A;  2MUM A;  2VPD A;  3KV5 A;  4BW1 A;  3O34 A;  2ECN A;  3FJU B;  4QNS A;  1WEN A;  2K16 A;  2YVR A;  3ZNI A;  4O7B A;  1E6I A;  3LVR E;  4A4B A;  5TAB A;  4NR6 A;  3DWD A;  5KTW A;  2LXP C;  1X0J A;  4QR4 A;  4MR5 A;  4BHW A;  1WEQ A;  4UP0 A;  4UIW A;  4MR6 A;  2E7N A;  1WEV A;  4IR6 A;  2KWN A;  3JVM A;  4IOQ A;  5EWH A;  2H0D A;  2JMJ A;  2OSS A;  3N9N A;  3N9M A;  1JM7 A;  4LAD B;  3I3J A;  5D7X A;  1JOC A;  4Z93 A;  5C85 A;  5FG4 A;  4LYS A;  5E3D A;  3FKM X;  4YYD A;  4O64 A;  2YUC A;  5IGN A;  2E6S A;  2XOY A;  2QIC A;  2XEU A;  4IC3 A;  4NUC A;  4J0R A;  5EM3 A;  3ERR A;  3P1F A;  5L97 A;  1V87 A;  4XI1 A;  4CA1 A;  4AYC B;  4Q0O A;  3VKH A;  5DFB A;  4YK0 A;  3GL6 A;  4YYH A;  5CQ4 A;  2EA6 A;  5F2P A;  3I2D A;  3FM8 C;  3D1B A;  1T1H A;  4TT4 A;  4HXS A;  4GPJ A;  4WIV A;  5E74 A;  2JM3 A;  3SUB A;  4QSQ A;  2NXB A;  2L7P A;  5FB1 A;  4HXN A;  2DVV A;  2L5U A;  3UV5 A;  5D25 A;  4UYG A;  4QSV A;  2EJN A;  5EI4 A;  5F61 A;  2K17 A;  3LJU X;  5A5S A;  5C89 A;  4AKN A;  4FK5 A;  5F60 A;  4LK9 A;  3Q2E A;  5DYA A;  5DIN A;  5D1L B;  4N4G A;  5F62 A;  5C13 A;  5AD2 A;  4X3G A;  5J0D A;  4YH4 A;  4YBM A;  1DVP A;  2VJE A;  4I7B A;  4NQM A;  5L99 A;  2LDR A;  5FE9 A;  2F6N A;  5LVQ A;  4MEN A;  5A7C A;  3RPG C;  3UVD A;  5A82 A;  3T6R A;  5C4Q A;  3G0L A;  4TT2 A;  5LKZ A;  3JVL A;  4O7E A;  3L1Z B;  1PUO A;  3LVQ E;  2Y1N A;  5EQ1 A;  4HXK A;  4QEW A;  4Z1S A;  1WEO A;  2LXH C;  4V3L C;  5CQ3 A;  3LXJ A;  4A9I A;  3UW9 A;  3QZV A;  2B0O E;  5DLZ A;  4CUR A;  3ZYU A;  5FEY A;  4YH3 A;  5DLX A;  3U5P A;  3LQH A;  2IQJ A;  4UIT A;  4NRA A;  1WE9 A;  2H0D B;  2OO1 A;  3JUE A;  4PCI A;  2RNW A;  3NG2 A;  5C87 A;  4NQN A;  2KKY A;  4LRG A;  3TLP A;  2NAA A;  3N9P A;  4UIV A;  4S3O B;  3S92 A;  5H9M A;  3QZT A;  4LKA A;  3EB6 A;  3SVH A;  4F3I A;  4R8P K;  4YAT A;  5D3T A;  5CFW A;  5EIS A;  4A9K A;  5A81 A;  5HQ5 A;  3LQI A;  5CUC A;  2EGM A;  2P57 A;  5F63 A;  4CUT A;  3KQI A;  5ENI A;  1ZKR A;  4YC9 A;  3PUR A;  5E9V A;  5IBN A;  4PPE A;  2L0B A;  3ZVY A;  5H1T A;  5A5O A;  5DW2 A;  5ENG A;  4UYH A;  2EGP A;  3UVX A;  4NYV A;  4C9Z A;  4QSW A;  4QST A;  5A5N A;  3UV4 A;  2YW5 A;  5ENC A;  1DCQ A;  2MNY A;  2VJF A;  4WZ3 B;  2QIZ A;  5D1K B;  2R0V A;  1ZS5 A;  3C5K A;  2VJE B;  5CS8 A;  4GNG A;  2GRC A;  4QSS A;  4NR9 A;  5IGM A;  2RSD A;  4YBT A;  4HXP A;  4QUT A;  1WIL A;  3SOX A;  5CQ6 A;  5CGP A;  5CUE A;  2E3K A;  5ETD A;  4XUA A;  4A9L A;  2VPG A;  4LDF A;  5FE1 A;  4LYW A;  3KDE C;  5CQA A;  5DKA A;  2LGK A;  4WHU A;  4NUD A;  1MBM A;  4ZUX U;  4X2I A;  4YYG A;  5IGL A;  5K29 A;  1U6G B;  3ZYQ A;  5EWV A;  2XB1 A;  5II2 A;  4LJN A;  5HQ7 A;  5CUG A;  4TU6 A;  5HEM A;  5CPE A;  2YHN A;  4Z6H A;  4LLB A;  3UV2 A;  2RFJ A;  4N4F A;  4A9H A;  5D3L A;  4A9O A;  5LKX A;  2MKE A;  3PLW A;  2K1J A;  5D26 A;  2LN0 A;  4L7X A;  2RI7 A;  5EPR A;  4XYA A;  2BAY A;  2HDP A;  3RCW A;  1N72 A;  4QEU A;  4YYI A;  2KIZ A;  2KWK A;  5FE0 A;  3Q2F A;  5CUB A;  5L98 A;  5A5P A;  1WEE A;  5AIT A;  4TZ2 A;  4QSX A;  5D3S A;  5EA1 A;  4PCE A;  5I40 A;  2YYR A;  4A9M A;  5FE2 A;  2ECW A;  3N9Q A;  4OGC A;  3HME A;  4LZ2 A;  4FO9 A;  2YDW A;  3DAI A;  1JSP B;  4O70 A;  4CLB A;  3JVK A;  4DON A;  4J0S A;  5B75 A;  3G0J A;  2MT5 A;  5EVA A;  5B76 A;  4BBQ A;  2M6M A;  5CZG A;  2UZG A;  1X4J A;  4NS5 A;  4UIY A;  4UIZ A;  5L8U A;  5COI A;  4BW4 A;  3SOU A;  2G43 A;  1F68 A;  5FE6 A;  2R0Y A;  4L58 A;  4A49 A;  5G04 B;  5I7Y A;  3DQV R;  1N87 A;  3FAO A;  3V43 A;  2KGG A;  3C6W A;  4H9D A;  5LJ0 A;  4O76 A;  5DKH A;  5K3Q A;  3SHB A;  2E7O A;  5KH9 A;  4O7F A;  4PTB A;  2LGL A;  3HMH A;  5FE3 A;  5AME A;  4HXO A;  4XY8 A;  5E9Y A;  5J3X A;  5HCL A;  4MVT A;  4N4H A;  5D24 A;  1XWH A;  3O70 A;  5DBM A;  3S91 A;  4LR6 A;  5HM0 A;  5F36 A;  2YQD A;  3MUL A;  5EIC A;  5A5R A;  3NXB A;  4AKI A;  1FBV A;  5DY7 A;  5HJC A;  4TQN A;  4TKP B;  3ASL A;  3SOW A;  5KTU A;  4WZ0 A;  2G45 A;  2KKX A;  2VNF A;  2AN6 A;  2DSM A;  2FFW A;  4KCX A;  3T7L A;  2LQ6 A;  3L1X A;  4YAB A;  5CU8 A;  2L43 A;  5CQ7 A;  2DVQ A;  3UVY A;  4CFL A;  3MB4 A;  5HEN A;  1WEU A;  3L11 A;  2YYN A;  4UIU A;  4KV4 A;  3U5N A;  2LAU A;  4O78 A;  2YQL A;  5G05 B;  5SVI A;  4MEQ A;  4O7A A;  3ZPV 1;  4A9E A;  5CQT A;  2KWJ A;  5DFD A;  2YUR A;  5F3A A;  4CFK A;  2E61 A;  2D82 A;  5AIU A;  4IR4 A;  5FE5 A;  3O47 A;  4QSP A;  5D3P A;  3HCT A;  5ENB A;  2RNX A;  5FFW A;  4A4C A;  2YT5 A;  4OUF A;  3D1D A;  4A9J A;  3HCS A;  5EWD A;  5I83 A;  4Q6F A;  4HBV A;  5I7X A;  3M63 A;  5D1M B;  2I8N A;  5SVY A;  3KV6 A;  2MA6 A;  4WA6 A;  2HYE D;  1MM2 A;  4TZ8 A;  5A85 A;  2EXU A;  2KU3 A;  5EYA F;  4YY4 A;  4QBM A;  5B8D A;  1JM7 B;  4UP5 A;  2K4D A;  5FER A;  1WEP A;  2DKW A;  4PKL A;  5F5Z A;  5FFY A;  5JI8 A;  4NRC A;  2YSJ A;  4N3W A;  4TTE A;  4QF2 A;  1CHC A;  5TDR A;  4O75 A;  2G6Q A;  4UYD A;  2KFT A;  1Z6U A;  4XUB A;  3EB5 A;  1BOR A;  5LKT A;  5FE7 A;  3FEH A;  4R7E A;  4UYF A;  3N9O A;  5I1Q A;  5H85 A;  4N4I A;  3U5K A;  4LYI A;  3P5O A;  2M85 A;  4QC3 A;  1WIM A;  4CUS A;  2L84 A;  2Y1M A;  2VPE A;  4C67 A;  5HRW A;  4NUE A;  1WES A;  5CRM A;  2E6R A;  4S3O C;  5DFC A;  5EPB A;  4O74 A;  2RNY A;  4YY6 A;  5DKD A;  5I29 A;  5IID A;  3U5L A;  2YU4 A;  5I80 A;  5SVX A;  4BW2 A;  2DAT A;  5JWM A;  4CCG X;  4YYJ A;  4CUU A;  4CUQ A;  4A0C D;  3MUK A;  3HTK C;  4WZ2 A;  4AP4 A;  2XOZ A;  4E96 A;  2FD4 A;  5SVI B;  2R0S A;  4OGJ A;  3VKG A;  4ZQL A;  2DJA A;  1MM3 A;  2MA5 A;  5C8G A;  5E9K A;  1Z60 A;  2YEM A;  5B77 A;  2G4A A;  4QYL A;  2YEK A;  4BJX A;  5C11 A;  5CQ5 A;  5FDZ A;  4O77 A;  2RO1 A;  4ALH A;  3DWY A;  4O62 A;  2OXQ C;  5LKU A;  2KYU A;  3JVJ A;  4IOO A;  3M99 A;  4NRB A;  4TT6 A;  4ZC9 A;  5TB6 A;  2IDA A;  5CY9 A;  1K2F A;  2VPB A;  5E9I A;  5HRX A;  2YRE A;  4PY6 A;  1WEM A;  4O7C A;  5HQ6 A;  4PS5 A;  2WP2 A;  2DX8 A;  4QSR A;  4UIX A;  2PNX A;  4AYC A;  5TRB A;  5H1U A;  1E4U A;  4IR5 A;  2JUN A;  3P1E A;  4C66 A;  1FP0 A;  5FG6 A;  4AKG A;  4UI9 B;  4MEO A;  4J1P A;  4UYF B;  2H60 A;  4O72 A;  2I50 A;  3KNV A;  4TU4 A;  4Z6I A;  5D3N A;  5LJ1 A;  4AVX A;  5CUD A;  2PUY A;  3ONI A;  5B79 A;  5EPS A;  5FH8 A;  5EWW A;  3ZTG A;  2F6J A;  2VJF B;  3N9L A;  4ZDT A;  2CRR A;  3MB3 A;  4HXL A;  4CL9 A;  5HFR A;  2YQM A;  4XY9 A;  3O33 A;  4QB3 A;  2KWO A;  5BT3 A;  5AD3 A;  5DYU A;  4Q0N A;  5AMF A;  4NXJ A;  4R2Y A;  5E0R A;  4A9N A;  4F52 B;  3AAD A;  5ACY A;  5DKC A;  4AUQ B;  5CP5 A;  2ZET C;  4IC2 A;  3LDY A;  3P1C A;  4J3I A;  5ENE A;  5E73 A;  2OUO A;  5B78 A;  5LCW B;  5FBX A;  5BT5 A;  1VFY A;  5KHM A;  1WEW A;  2ECJ A;  2LV9 A;  3MHS A;  3ZVZ B;  3U5J A;  5KTX A;  2L85 A;  5LVR A;  4QYD A;  5FE4 A;  3LQJ A;  4UYE A;  5FH6 A;  4IR3 A;  4QR3 A;  4QUU A;  3SVG A;  2CON A;  4QR5 A;  5DW1 A;  5HLS A;  2M3H A;  4MSX A;  2WP1 A;  4Z0R A;  4QY4 A;  3FAN A;  2LSP B;  5CQ8 A;  2M1R A;  5BT4 A;  4NR7 A;  4A9F A;  2XOC A;  3DPL R;  3HMF A;  3GG3 A;  5L96 A;  4GNE A;  3RPG B;  1IYM A;  3O37 A;  2ECT A;  5KU3 A;  4YBS A;  5C7N A;  5IG6 A;  3D7C A;  3MDB C;  5HFQ A;  5TBN A;  3P1D A;  4LZR A;  2ECG A;  2YSM A;  4FJC A;  4GND A;  5E9L A;  2R10 A;  5KH3 A;  5A83 A;  2M13 A;  1G25 A;  4QF3 A;  4RVR A;  5G4R A;  3IU5 A;  4NR4 A;  5HEL A;  5EK9 A;  4GB0 A;  5F25 A;  3Q1D A;  4Y03 A;  3RTR B;  4BW3 A;  2KGI A;  2KE1 A;  2LGG A;  3ZPV E;  2FSA A;  4NR8 A;  4CUP A;  2VP7 A;  3O36 A;  4GNF A;  3MQM A;  3AQA A;  2MNZ A;  3GV4 A;  4QQ4 A;  5TDW A;  5KO4 A;  5D3J A;  5F1L A;  4QEV A;  3LRQ A;  4WHW A;  4TYL A;  2L5E A;  3K2J A;  4HBX A;  4YAD A;  5TCM A;  5A5Q A;  5EU1 A;  3QZS A;  5ENJ A;  1WUG A;  4IOR A;  5FFV A;  4FLP A;  2C2L A;  5EV9 A;  2CSZ A;  4LC2 A;  2L80 A;  2Y43 A;  3PHD A;  5D3H A;  4QC1 A;  5CTL A;  2CKL A;  5KH7 A;  4Z1Q A;  5DYX A;  3O35 A;  2MD8 C;  2QJ0 A;  5JG6 A;  3T9K A;  2JMI A;  1Z2Q A;  4O71 A;  3PUQ A;  4YYM A;  2JRJ A;  4Z0O A;  4HBY A;  1X4U A;  5DYC A;  4I7C A;  4NR5 A;  3M7K A;  3UVW A;  2N9G A;  2OWA A;  3U5M A;  2YEL A; 
#chains in the Genus database with same CATH homology
 4TS8 A;  5ENF A;  2CT2 A;  3FL2 A;  4YAX A;  2FUI A;  3MHH A;  4MR4 A;  4YYN A;  5II1 A;  4HXM A;  3HCU A;  5E9M A;  5IGK A;  5EP7 A;  2L75 A;  1LDJ B;  2FUU A;  4NYX A;  4NYW A;  4P5O B;  2D8S A;  4QSU A;  2ECI A;  4I7D A;  2MJV B;  2C2V S;  4KV1 A;  2KTB B;  1JM4 B;  4HBW A;  1VD4 A;  5EWC A;  5EGU A;  5FH7 A;  5I3L A;  4V3K C;  2EOD A;  5FB0 A;  2ECV A;  4NN2 A;  5L8T A;  2D9E A;  1WFK A;  3IU6 A;  4MEP A;  1LDK C;  4ALG A;  5E7D A;  5LJ2 A;  5I86 A;  2LRI C;  3M62 A;  3VK6 A;  5D3R A;  5H1V A;  5CUA A;  2CSY A;  4B86 C;  5D0C A;  3IHP A;  5HRV A;  2JMD A;  1F62 A;  1EQF A;  5FG5 A;  1HYI A;  1WUM A;  5ETB A;  5I88 A;  2CKL B;  2LGV A;  1VYX A;  5F1H A;  2DWW A;  5CRZ A;  2MIQ A;  4W4U A;  4LZS A;  3U5O A;  2DVR A;  4QZS A;  2RS9 B;  3SVF A;  3LJW A;  4HXR A;  5ENH A;  4OGI A;  4FIP A;  2F42 A;  2DVS A;  5G0F A;  5I89 A;  5FE8 A;  1WGM A;  2YW8 A;  4MR3 A;  2KR4 A;  1HYJ A;  1X4I A;  4ZW1 A;  1ZBD B;  2KRE A;  5LUU A;  4B7Y C;  5G4S A;  4YYK A;  1RMD A;  2MD7 B;  2YHO A;  2I7K A;  5DX4 A;  3MXF A;  5E3G A;  2MUM A;  2VPD A;  3KV5 A;  4BW1 A;  3O34 A;  2ECN A;  3O7A A;  4QNS A;  1WEN A;  2K16 A;  3ZNI A;  4O7B A;  1E6I A;  4A4B A;  5TAB A;  4NR6 A;  5KTW A;  2LXP C;  1X0J A;  4QR4 A;  4MR5 A;  4BHW A;  1WEQ A;  4UP0 A;  4UIW A;  4MR6 A;  2E7N A;  1WEV A;  4IR6 A;  2KWN A;  3JVM A;  4IOQ A;  5EWH A;  2H0D A;  2JMJ A;  2OSS A;  3N9N A;  3N9M A;  1JM7 A;  4LAD B;  3I3J A;  5D7X A;  1JOC A;  4Z93 A;  5C85 A;  5FG4 A;  4LYS A;  5E3D A;  3FKM X;  4YYD A;  4O64 A;  2YUC A;  5IGN A;  2E6S A;  2QIC A;  2XEU A;  4IC3 A;  4NUC A;  4J0R A;  5EM3 A;  3P1F A;  5L97 A;  1V87 A;  4XI1 A;  4CA1 A;  4AYC B;  4Q0O A;  5DFB A;  4YK0 A;  3GL6 A;  4YYH A;  5CQ4 A;  2EA6 A;  5F2P A;  3I2D A;  1T1H A;  4TT4 A;  4HXS A;  4GPJ A;  4WIV A;  5E74 A;  4QSQ A;  2NXB A;  5FB1 A;  4HXN A;  2DVV A;  2L5U A;  3UV5 A;  5D25 A;  4UYG A;  4QSV A;  5EI4 A;  5F61 A;  2K17 A;  5A5S A;  5C89 A;  4AKN A;  4FK5 A;  5F60 A;  4LK9 A;  3Q2E A;  5DYA A;  5DIN A;  5D1L B;  4N4G A;  5F62 A;  5C13 A;  5AD2 A;  4X3G A;  5J0D A;  4YH4 A;  4YBM A;  1DVP A;  2VJE A;  4I7B A;  4NQM A;  5L99 A;  2LDR A;  5FE9 A;  2F6N A;  5LVQ A;  4MEN A;  5A7C A;  3RPG C;  3UVD A;  5A82 A;  3T6R A;  5C4Q A;  3G0L A;  4TT2 A;  5LKZ A;  3JVL A;  4O7E A;  3L1Z B;  2Y1N A;  5EQ1 A;  4HXK A;  4QEW A;  4Z1S A;  1WEO A;  2LXH C;  4V3L C;  5CQ3 A;  3LXJ A;  4A9I A;  3UW9 A;  3QZV A;  5DLZ A;  4CUR A;  3ZYU A;  5FEY A;  4YH3 A;  5DLX A;  3U5P A;  3LQH A;  4UIT A;  4NRA A;  1WE9 A;  2H0D B;  2OO1 A;  4PCI A;  2RNW A;  3NG2 A;  5C87 A;  4NQN A;  3N9P A;  4LRG A;  3TLP A;  2NAA A;  4S3O B;  4UIV A;  3S92 A;  5H9M A;  3QZT A;  4LKA A;  3EB6 A;  3SVH A;  4F3I A;  4R8P K;  4YAT A;  5D3T A;  5CFW A;  5EIS A;  4A9K A;  5A81 A;  5HQ5 A;  3LQI A;  5CUC A;  5F63 A;  4CUT A;  3KQI A;  5ENI A;  3PUR A;  4YC9 A;  5E9V A;  5IBN A;  4PPE A;  2L0B A;  3ZVY A;  5H1T A;  5A5O A;  5DW2 A;  5ENG A;  4UYH A;  2EGP A;  3UVX A;  4NYV A;  4C9Z A;  4QSW A;  4QST A;  5A5N A;  3UV4 A;  2YW5 A;  5ENC A;  2MNY A;  2VJF A;  4WZ3 B;  2QIZ A;  5D1K B;  2R0V A;  1ZS5 A;  3C5K A;  2VJE B;  5CS8 A;  4GNG A;  2GRC A;  4QSS A;  4NR9 A;  5IGM A;  2RSD A;  4YBT A;  4HXP A;  4QUT A;  1WIL A;  3SOX A;  5CQ6 A;  5CGP A;  5CUE A;  2E3K A;  5ETD A;  4XUA A;  4A9L A;  2VPG A;  4LDF A;  5FE1 A;  4LYW A;  5CQA A;  5DKA A;  2LGK A;  4WHU A;  4NUD A;  4ZUX U;  4X2I A;  4YYG A;  5IGL A;  5K29 A;  1U6G B;  3ZYQ A;  5EWV A;  2XB1 A;  5II2 A;  4LJN A;  5HQ7 A;  5CUG A;  4TU6 A;  5HEM A;  5CPE A;  2YHN A;  4Z6H A;  4LLB A;  3UV2 A;  2RFJ A;  4N4F A;  4A9H A;  5D3L A;  4A9O A;  5LKX A;  4L7X A;  2K1J A;  5D26 A;  2LN0 A;  2RI7 A;  5EPR A;  4XYA A;  2BAY A;  2HDP A;  3RCW A;  1N72 A;  4QEU A;  4YYI A;  2KIZ A;  2KWK A;  5FE0 A;  3Q2F A;  5CUB A;  5L98 A;  5A5P A;  1WEE A;  5AIT A;  4TZ2 A;  4QSX A;  5D3S A;  5EA1 A;  4PCE A;  5I40 A;  2YYR A;  4A9M A;  5FE2 A;  2ECW A;  3N9Q A;  3HME A;  4LZ2 A;  4FO9 A;  2YDW A;  3DAI A;  1JSP B;  4O70 A;  4CLB A;  3JVK A;  4DON A;  4J0S A;  5B75 A;  3G0J A;  2MT5 A;  5EVA A;  5B76 A;  4BBQ A;  2M6M A;  5CZG A;  2UZG A;  1X4J A;  4NS5 A;  4UIY A;  4UIZ A;  5L8U A;  5COI A;  4BW4 A;  3SOU A;  2G43 A;  1F68 A;  5FE6 A;  2R0Y A;  4L58 A;  4A49 A;  5G04 B;  5I7Y A;  3DQV R;  1N87 A;  3V43 A;  2KGG A;  3C6W A;  5LJ0 A;  4O76 A;  5DKH A;  3SHB A;  2E7O A;  5KH9 A;  4O7F A;  4PTB A;  2LGL A;  3HMH A;  5FE3 A;  5AME A;  4HXO A;  4XY8 A;  5E9Y A;  5J3X A;  5HCL A;  4MVT A;  4N4H A;  5D24 A;  1XWH A;  3O70 A;  5DBM A;  3S91 A;  4LR6 A;  5HM0 A;  5F36 A;  2YQD A;  3MUL A;  5EIC A;  5A5R A;  3NXB A;  1FBV A;  5DY7 A;  5HJC A;  4TQN A;  4TKP B;  3ASL A;  3SOW A;  5KTU A;  4WZ0 A;  2G45 A;  2VNF A;  2AN6 A;  4KCX A;  3T7L A;  2LQ6 A;  3L1X A;  4YAB A;  5CU8 A;  2L43 A;  5CQ7 A;  2DVQ A;  3UVY A;  4CFL A;  3MB4 A;  5HEN A;  1WEU A;  3L11 A;  2YYN A;  4UIU A;  4KV4 A;  3U5N A;  5G05 B;  4O78 A;  2YQL A;  4MEQ A;  4O7A A;  3ZPV 1;  4A9E A;  5CQT A;  2KWJ A;  5DFD A;  2YUR A;  5F3A A;  4CFK A;  2D82 A;  5AIU A;  4IR4 A;  5FE5 A;  4QSP A;  5D3P A;  3HCT A;  5ENB A;  2RNX A;  5FFW A;  4A4C A;  2YT5 A;  4OUF A;  3HCS A;  4A9J A;  5EWD A;  5I83 A;  4Q6F A;  4HBV A;  5I7X A;  3M63 A;  5D1M B;  2I8N A;  3KV6 A;  2MA6 A;  4WA6 A;  2HYE D;  1MM2 A;  4TZ8 A;  5A85 A;  2KU3 A;  5EYA F;  4YY4 A;  4QBM A;  5B8D A;  1JM7 B;  4UP5 A;  2K4D A;  5FER A;  1WEP A;  2DKW A;  4PKL A;  5F5Z A;  5FFY A;  5JI8 A;  4NRC A;  2YSJ A;  4N3W A;  4TTE A;  4QF2 A;  1CHC A;  5TDR A;  4O75 A;  2G6Q A;  4UYD A;  2KFT A;  1Z6U A;  4XUB A;  3EB5 A;  1BOR A;  5LKT A;  5FE7 A;  4R7E A;  4UYF A;  3N9O A;  5I1Q A;  5H85 A;  4N4I A;  3U5K A;  4LYI A;  3P5O A;  2M85 A;  4QC3 A;  1WIM A;  4CUS A;  2L84 A;  2Y1M A;  2VPE A;  4C67 A;  5HRW A;  4NUE A;  1WES A;  5CRM A;  2E6R A;  4S3O C;  5DFC A;  5EPB A;  4O74 A;  2RNY A;  4YY6 A;  5DKD A;  5I29 A;  5IID A;  3U5L A;  2YU4 A;  5I80 A;  4BW2 A;  2DAT A;  5JWM A;  4CCG X;  4YYJ A;  4CUU A;  4CUQ A;  4A0C D;  3MUK A;  3HTK C;  4WZ2 A;  4AP4 A;  4E96 A;  2R0S A;  4OGJ A;  4ZQL A;  1MM3 A;  2MA5 A;  5C8G A;  5E9K A;  1Z60 A;  2YEM A;  5B77 A;  2G4A A;  4QYL A;  2YEK A;  4BJX A;  5C11 A;  5CQ5 A;  5FDZ A;  4O77 A;  2RO1 A;  4ALH A;  3DWY A;  2OXQ C;  5LKU A;  2KYU A;  3JVJ A;  4IOO A;  3M99 A;  4NRB A;  4TT6 A;  4ZC9 A;  5TB6 A;  2IDA A;  5CY9 A;  1K2F A;  2VPB A;  5E9I A;  5HRX A;  2YRE A;  4PY6 A;  1WEM A;  4O7C A;  5HQ6 A;  4PS5 A;  2WP2 A;  2DX8 A;  4QSR A;  4UIX A;  2PNX A;  4AYC A;  5TRB A;  5H1U A;  1E4U A;  4IR5 A;  3P1E A;  4C66 A;  1FP0 A;  5FG6 A;  4UI9 B;  4MEO A;  4J1P A;  4UYF B;  2H60 A;  4O72 A;  2I50 A;  3KNV A;  4TU4 A;  4Z6I A;  5D3N A;  5LJ1 A;  4AVX A;  5CUD A;  2PUY A;  3ONI A;  5B79 A;  5EPS A;  5FH8 A;  5EWW A;  3ZTG A;  2F6J A;  2VJF B;  3N9L A;  4ZDT A;  3MB3 A;  4HXL A;  4CL9 A;  5HFR A;  2YQM A;  4XY9 A;  3O33 A;  4QB3 A;  2KWO A;  5BT3 A;  5AD3 A;  5DYU A;  4Q0N A;  5AMF A;  4NXJ A;  4R2Y A;  5E0R A;  4A9N A;  4F52 B;  3AAD A;  5ACY A;  5DKC A;  4AUQ B;  5CP5 A;  2ZET C;  4IC2 A;  3P1C A;  4J3I A;  5ENE A;  5E73 A;  2OUO A;  5B78 A;  5LCW B;  5FBX A;  5BT5 A;  1VFY A;  5KHM A;  1WEW A;  2ECJ A;  2LV9 A;  3MHS A;  3ZVZ B;  3U5J A;  5KTX A;  2L85 A;  5LVR A;  4QYD A;  5FE4 A;  3LQJ A;  4UYE A;  5FH6 A;  4IR3 A;  4QR3 A;  4QUU A;  3SVG A;  4QR5 A;  5DW1 A;  5HLS A;  2M3H A;  4MSX A;  2WP1 A;  4QY4 A;  2LSP B;  5CQ8 A;  2M1R A;  5BT4 A;  4NR7 A;  4A9F A;  3DPL R;  3HMF A;  3GG3 A;  5L96 A;  4GNE A;  3RPG B;  1IYM A;  3O37 A;  2ECT A;  5KU3 A;  4YBS A;  5C7N A;  5IG6 A;  3D7C A;  5HFQ A;  5TBN A;  3P1D A;  4LZR A;  2ECG A;  2YSM A;  4FJC A;  4GND A;  5E9L A;  2R10 A;  5KH3 A;  5A83 A;  1G25 A;  4QF3 A;  4RVR A;  5G4R A;  3IU5 A;  4NR4 A;  5HEL A;  5EK9 A;  4GB0 A;  5F25 A;  3ZPV E;  4Y03 A;  3RTR B;  4BW3 A;  2KGI A;  2KE1 A;  2LGG A;  2FSA A;  4NR8 A;  4CUP A;  2VP7 A;  3O36 A;  4GNF A;  3MQM A;  3AQA A;  2MNZ A;  3GV4 A;  5TDW A;  5KO4 A;  5D3J A;  5F1L A;  4QEV A;  3LRQ A;  4WHW A;  4TYL A;  2L5E A;  3K2J A;  4HBX A;  4YAD A;  5TCM A;  5A5Q A;  5EU1 A;  3QZS A;  5ENJ A;  1WUG A;  4IOR A;  5FFV A;  4FLP A;  2C2L A;  5EV9 A;  2CSZ A;  4LC2 A;  2L80 A;  2Y43 A;  3PHD A;  5D3H A;  4QC1 A;  5CTL A;  2CKL A;  5KH7 A;  4Z1Q A;  5DYX A;  3O35 A;  2MD8 C;  2QJ0 A;  5JG6 A;  2JMI A;  1Z2Q A;  4O71 A;  3PUQ A;  4YYM A;  2JRJ A;  4HBY A;  1X4U A;  5DYC A;  4I7C A;  4NR5 A;  3UVW A;  2N9G A;  3U5M A;  2YEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...