4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords CREB-binding protein
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
2RNYA 3O34A 5F62A 5CFWA 5DYUA 3JVLA 5FE3A 2MT5A 2YYRA 4WHWA 4O7AA 5AD2A 5EA1A 2JMIA 4LKAA 4FLPA 5LJ0A 3QZVA 4A9NA 5CQAA 4YY6A 5HRVA 2G4AA 2E6RA 4YBSA 2KU3A 5D3PA 3LJWA 5F2PA 5HM0A 5F63A 2YQMA 4ZC9A 3SVGA 3ZVYA 5HRXA 2ZETC 5I29A 2KWOA 2MNYA 4CUQA 3K2JA 4B7YC 5D25A 1Z2QA 2QICA 4KCXA 4ALHA 5FH8A 4IOQA 2RNXA 4QB3A 4ALGA 5F1LA 2AN6A 4QC3A 3FKMX 2YDWA 2Y1MA 5FE2A 5FG6A 4ZQLA 3U5PA 4NQNA 5FE8A 4XY8A 2LXHC 4O75A 3S92A 1WEPA 4UYFA 2VPEA 2WP1A 2R0VA 5FE9A 4NQMA 3SOWA 4XUBA 2YT5A 5KH7A 5A5RA 4IR5A 4C66A 3ZPVE 2L75A 4QR4A 2KFTA 5IGKA 2MD7B 5FFYA 3QZTA 5F3AA 4A4BA 2ECTA 3Q2FA 4Z1SA 4FO9A 5K29A 2K4DA 5EWWA 2G45A 5F60A 4QZSA 1WEWA 4IR3A 4R2YA 4LR6A 5DFDA 1WEOA 4O64A 5D3LA 4NYWA 4NRAA 2G6QA 3FL2A 5EM3A 4A9OA 5HQ7A 5I86A 5TABA 5H1VA 2E3KA 5AITA 4QSRA 4QSSA 2MIQA 4OUFA 5TRBA 4MENA 5A5SA 4GNGA 5EWHA 5B77A 5F25A 4O7BA 1MM2A 5DINA 3N9LA 3LRQA 3TLPA 5ENIA 4QYLA 5CUEA 3QZSA 3SOUA 2VNFA 4CL9A 3DPLR 2G43A 5ENBA 3P1EA 1LDKC 5DKCA 4QSWA 5A82A 3MHHA 5B75A 5HRWA 2F6JA 4PKLA 5ENFA 5DYAA 2RI7A 4QSQA 5CQ4A 4WA6A 5IGNA 2Y43A 4LADB 4O77A 5J3XA 4A9JA 5D3RA 2I8NA 1MM3A 1E6IA 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 4LC2A 4YYJA 3RTRB 4A9HA 4YYMA 5KU3A 5F36A 4F3IA 5DY7A 4UYGA 3N9QA 1IYMA 1G25A 4B86C 2CT2A 4YYHA 4BW2A 5KTWA 3MB3A 2DX8A 2KWNA 5D24A 3LQIA 4NXJA 4BBQA 4O70A 2KTBB 4CLBA 1N72A 2D82A 2OSSA 1Z6UA 2JMDA 4A49A 4I7BA 2YQLA 4YATA 2VJEA 2DKWA 4QNSA 5FE1A 5IG6A 4UYDA 2DVRA 4QSPA 4YYGA 4UIZA 2LRIC 2VPBA 2MJVB 4ZDTA 5KH9A 5HJCA 2CSYA 2L80A 2H0DA 4QEUA 4TT2A 4OGIA 4X2IA 5FE5A 2R0SA 5EICA 2YHNA 5DFCA 3UVXA 5F61A 5I40A 1XWHA 5FE4A 4HXKA 4NR7A 5I7YA 2C2LA 5TDWA 4O7FA 4AP4A 5EWDA 4QUTA 3I2DA 4QY4A 2ECNA 1F68A 1WEEA 2XB1A 4PPEA 2UZGA 3HMHA 5C11A 5HFRA 2VJFB 4FK5A 5HQ5A 5TCMA 4QEVA 5HLSA 1WUGA 2EGPA 4BJXA 4QF3A 5LVRA 2YUCA 3VK6A 4PCEA 4W4UA 5EWVA 4YYNA 5KO4A 2M3HA 5CUDA 2VJEB 4BW3A 5BT4A 2VP7A 2GRCA 4XYAA 4QR3A 2E7OA 4GNEA 1F62A 4HBVA 4NS5A 2D9EA 3AQAA 4AKNA 3UW9A 3RPGC 3ZTGA 2Y1NA 5CRZA 3Q2EA 2D8SA 3UV2A 4ZW1A 3EB6A 4MVTA 3UVYA 4A9MA 4NR8A 5ENJA 1WEUA 4GB0A 3ZYQA 5CZGA 4LYWA 3LXJA 2FUIA 4S3OB 5B76A 5EWCA 5LVQA 4QSVA 4QBMA 5II1A 1WFKA 2FUUA 4YY4A 4YC9A 2LGVA 1VD4A 5FG5A 1X0JA 4MR4A 4QSUA 3MB4A 4FJCA 4NYXA 4OGJA 3PUQA 5L8TA 5CP5A 5FG4A 2RSDA 4UI9B 1VFYA 5A7CA 5I89A 5LJ1A 3GL6A 5A5NA 5EGUA 5JG6A 4HXPA 5EISA 3N9PA 5I7XA 4GNDA 5FFVA 1FP0A 1N87A 2RS9B 3MQMA 5IGMA 3C5KA 4AVXA 5A5QA 5LKTA 2K17A 3AADA 2YU4A 3GG3A 1WIMA 3T7LA 2CSZA 4YADA 5ENCA 3HCSA 5G0FA 4LDFA 4GNFA 5ETBA 5AIUA 5A5PA 5D3HA 2RFJA 4NN2A 1X4IA 5H1UA 5DLXA 5B79A 4IR6A 4L58A 4Z93A 5D7XA 2M6MA 1BORA 4N3WA 4J1PA 4O78A 4LYSA 1WEMA 5HEMA 5LUUA 4HXMA 4QSTA 4TS8A 4UIXA 3N9OA 5CUCA 4R7EA 3MXFA 4V3KC 2YYNA 5AMFA 4UIUA 4TYLA 2F42A 2YW5A 4MEOA 1WEQA 3RCWA 5F1HA 3O33A 5L99A 4A9EA 4IOOA 4E96A 4A4CA 1LDJB 4UP0A 5D3SA 4BW1A 5I83A 4WZ3B 4IR4A 3JVKA 5L8UA 4N4FA 2KGIA 2VPGA 4KV1A 2KWKA 4MR3A 4YH4A 5J0DA 4NUCA 5IBNA 5FDZA 4LYIA 4TZ2A 4N4IA 3O70A 2OXQC 5CTLA 2YHOA 5A83A 4CUPA 2LQ6A 4CCGX 2QJ0A 2L43A 5E9KA 5E3GA 5C8GA 3IU5A 2I50A 4LZSA 5CS8A 4LLBA 1K2FA 5D1MB 5CUAA 4TTEA 5CQ7A 4UIVA 5I1QA 4NR5A 5LJ2A 2LGGA 2YEKA 2ECGA 2MD8C 3GV4A 2H0DB 5CRMA 5HCLA 3LQJA 5CQ5A 5DYCA 5D3JA 3PURA 1HYIA 2C2VS 5E9MA 5EPRA 2ECJA 5D26A 4WIVA 5CQTA 5JWMA 1WILA 5I3LA 5FE7A 2OUOA 4C67A 1JSPB 3ZVZB 5FE0A 4O7EA 3O35A 4QR5A 3M62A 2L5EA 4NR4A 3ONIA 2YURA 4O74A 4I7DA 5C7NA 5EPBA 2RNWA 4CFLA 3MULA 4YYIA 1CHCA 2JMJA 4HBWA 5D1LB 1V87A 3NG2A 4GPJA 4YBMA 5B78A 4Y03A 4UP5A 1X4UA 5A81A 5L98A 5IGLA 4PY6A 5FE6A 3P1DA 3UVWA 5CUGA 2E7NA 5D3TA 4O72A 2QIZA 5FEYA 5F5ZA 1X4JA 2LN0A 2DVVA 3U5OA 5L97A 2KREA 5LKXA 5A5OA 5G4RA 4UITA 2DWWA 4PTBA 4P5OB 5A85A 2KWJA 5TDRA 2DVSA 3L1XA 4HBYA 5E9VA 5EK9A 1DVPA 2BAYA 5E7DA 5H85A 1E4UA 4HXSA 2KGGA 4FIPA 2NXBA 5EP7A 3SVHA 3IU6A 4QUUA 2DVQA 4O7CA 5EI4A 3N9NA 5EU1A 4QF2A 3M99A 4AYCA 2XEUA 3U5JA 5CQ8A 3SHBA 4HXLA 3U5MA 4UIWA 4MSXA 5G4SA 3G0LA 5ENHA 5FFWA 4NR9A 4HXNA 5DBMA 5DW1A 5LKUA 3ASLA 4XUAA 4BW4A 4CUUA 2KIZA 5D3NA 5CY9A 5E73A 1JM4B 4TU4A 4KV4A 5JI8A 5HENA 1VYXA 1JM7A 2HYED 4QSXA 3O7AA 5COIA 2EODA 4WZ2A 5KHMA 1WUMA 5I88A 2LXPC 4CUTA 2MA5A 3RPGB 4CFKA 3UV5A 3T6RA 4AUQB 4L7XA 4R8PK 5DKHA 2DATA 5HFQA 4YYDA 2IDAA 2R10A 2LDRA 3MHSA 4V3LC 3MUKA 1ZS5A 5E9LA 4PCIA 4TZ8A 1WGMA 3SOXA 2N9GA 5KTXA 5ENGA 5E74A 2YW8A 3DAIA 3KV6A 1WESA 5EQ1A 2KR4A 5EYAF 3I3JA 5CU8A 3HMFA 5DKDA 3M63A 4LJNA 5DX4A 5DLZA 4Q0NA 4NRCA 4UYEA 4XY9A 5FBXA 4A0CD 4C9ZA 1EQFA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 4MR6A 4A9LA 3P5OA 4QEWA 3UVDA 2KE1A 3SVFA 2ECWA 2L85A 5CQ6A 2LGLA 4YABA 2YEMA 2RO1A 4LZRA 4Z1QA 3HCTA 2L84A 2YSMA 5AD3A 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 4J0RA 5CUBA 4TQNA 3HMEA 2MA6A 3PHDA 4Z6IA 4WZ0A 5BT5A 4J3IA 4DONA 4NYVA 5BT3A 2CKLA 1Z60A 4N4HA 5E9YA 3C6WA 5D1KB 5H9MA 4PS5A 4MR5A 3P1FA 4QC1A 2FSAA 4J0SA 5II2A 2K16A 4TT4A 2F6NA 4YBTA 1WE9A 4A9IA 3ZPV1 4WHUA 2L0BA 3DWYA 4O76A 5DKAA 5G04B 2PUYA 3EB5A 5E9IA 5IIDA 4LK9A 2H60A 5TBNA 2R0YA 4A9FA 2KYUA 3KNVA 5DYXA 5ETDA 5C4QA 5HQ6A 3U5KA 4RVRA 2ECVA 3UV4A 4MEPA 5LKZA 3KV5A 5FB0A 5B8DA 5HELA 5ENEA 5H1TA 2I7KA 2VJFA 4NUDA 5D0CA 1U6GB 4YH3A 3JVMA 1WENA 4TU6A 3DQVR 3LQHA 4UIYA 2CKLB 3U5LA 2VPDA 2YELA 3V43A 3ZNIA 4HBXA 2YQDA 4MEQA 4LZ2A 5EVAA 4CA1A 4A9KA 4IORA 5CPEA 2YREA 3HTKC 4YK0A 2OO1A 4HXOA 5KTUA 3ZYUA 4AYCB 2MNZA 1T1HA 5KH3A 2LSPB 3D7CA 5E0RA 4N4GA 5C85A 2WP2A 5TB6A 4CUSA 1ZBDB 4BHWA 4HXRA 5E3DA 1JOCA 2K1JA 4X3GA 5G05B 2M85A 3N9MA 4NR6A 4LRGA 1HYJA 1JM7B 5FH6A 5EPSA 5I80A 2YSJA 5DW2A 5FB1A 4Q0OA 3S91A 3G0JA 4UYHA 5ACYA 2E6SA 4IC2A 4YAXA 2M1RA 5EV9A 4CURA 4I7CA 5C13A 2PNXA 5C89A 2JRJA 3P1CA 1RMDA 5DFBA 3JVJA 5L96A 3IHPA 5AMEA 4O71A 4TT6A 5C87A 4NUEA 1FBVA 4YYKA 2ECIA 4QYDA 5CGPA 3O37A 3NXBA 5FH7A 3O36A 4Z6HA 5CQ3A 4NRBA 4UYFB 2LGKA 4XI1A
chains in the Genus database with same CATH superfamily
2RNYA 3O34A 3LJUX 5F62A 5CFWA 5DYUA 3JVLA 5FE3A 2MT5A 2YYRA 3FEHA 4WHWA 4O7AA 5AD2A 5EA1A 2JMIA 4LKAA 4FLPA 5LJ0A 3QZVA 4A9NA 5CQAA 4YY6A 5HRVA 2G4AA 2E6RA 4YBSA 2KKXA 2KU3A 5D3PA 3LJWA 5F2PA 5HM0A 5F63A 2YQMA 4ZC9A 3SVGA 3ZVYA 5HRXA 2ZETC 1DCQA 5I29A 2KWOA 2MNYA 4CUQA 3K2JA 4B7YC 5D25A 1Z2QA 2QICA 4KCXA 4ALHA 5FH8A 4IOQA 2RNXA 4QB3A 4ALGA 5F1LA 2AN6A 4QC3A 3FKMX 2YDWA 2Y1MA 5FE2A 5FG6A 4ZQLA 3U5PA 4NQNA 5FE8A 4XY8A 2LXHC 4O75A 3S92A 1WEPA 4UYFA 4AKGA 2VPEA 2WP1A 2R0VA 5FE9A 3PLWA 4NQMA 3SOWA 4XUBA 2YT5A 5KH7A 5A5RA 4IR5A 4C66A 4QQ4A 3ZPVE 2L75A 4QR4A 2KFTA 2CRWA 5IGKA 2MD7B 5FFYA 4AKIA 3QZTA 5F3AA 4A4BA 2ECTA 3Q2FA 4Z1SA 4FO9A 5K29A 2K4DA 5EWWA 2L7PA 2G45A 5F60A 4QZSA 1WEWA 4IR3A 4R2YA 4LR6A 5DFDA 1WEOA 4O64A 2YVRA 5D3LA 4NYWA 4NRAA 2G6QA 3FL2A 5EM3A 4A9OA 5HQ7A 5I86A 5TABA 5H1VA 2E3KA 5AITA 4QSRA 4QSSA 2MIQA 4OUFA 3DDTA 5TRBA 4MENA 5A5SA 4GNGA 5EWHA 5B77A 5F25A 4O7BA 1MM2A 5DINA 3N9LA 3LRQA 3TLPA 5ENIA 4QYLA 5CUEA 3QZSA 3SOUA 2VNFA 4CL9A 3DPLR 2G43A 5ENBA 3P1EA 1LDKC 5DKCA 4QSWA 5A82A 2XOZA 3MHHA 5B75A 5HRWA 2F6JA 4PKLA 5ENFA 5DYAA 2RI7A 4QSQA 5CQ4A 4WA6A 5IGNA 2Y43A 2XOCA 4LADB 4O77A 5J3XA 4A9JA 5D3RA 2I8NA 1MM3A 1E6IA 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 4LC2A 5SVIA 4YYJA 3RTRB 4A9HA 4YYMA 5KU3A 5F36A 2MKEA 4F3IA 5DY7A 4UYGA 3N9QA 1IYMA 1G25A 4B86C 2CT2A 4YYHA 4BW2A 5KTWA 3MB3A 2DX8A 2KWNA 5D24A 3LQIA 2CSVA 4NXJA 4BBQA 4O70A 2KTBB 4CLBA 1N72A 2D82A 2OSSA 1Z6UA 2JMDA 4A49A 4I7BA 2YQLA 4YATA 2EXUA 2VJEA 2DKWA 4QNSA 5FE1A 5IG6A 3LDYA 4UYDA 2DVRA 4QSPA 4YYGA 4UIZA 2LRIC 2VPBA 2MJVB 4ZDTA 5KH9A 5HJCA 2CSYA 2L80A 2H0DA 4QEUA 4TT2A 4OGIA 4X2IA 5FE5A 2R0SA 5EICA 3LVQE 2YHNA 5DFCA 3UVXA 5F61A 5I40A 1XWHA 5FE4A 4HXKA 4NR7A 5SVIB 5I7YA 3DWDA 2C2LA 5TDWA 2EGMA 4O7FA 5SVXA 5EWDA 4QUTA 3I2DA 4QY4A 2ECNA 1F68A 1WEEA 2XB1A 4AP4A 4PPEA 2UZGA 3HMHA 5C11A 5HFRA 2VJFB 4FK5A 5HQ5A 5TCMA 4QEVA 5HLSA 1WUGA 2EGPA 4BJXA 4QF3A 5LVRA 2YUCA 3VK6A 4PCEA 4W4UA 5EWVA 4YYNA 5KO4A 2M3HA 5CUDA 2VJEB 4BW3A 5BT4A 2VP7A 4O62A 2GRCA 4XYAA 4QR3A 2E7OA 4GNEA 1F62A 4HBVA 4NS5A 2D9EA 3AQAA 4AKNA 3UW9A 3RPGC 3ZTGA 1ZKRA 5CRZA 3Q2EA 2Y1NA 2D8SA 3UV2A 4ZW1A 3EB6A 4MVTA 3UVYA 4A9MA 4NR8A 5ENJA 1WEUA 4GB0A 3ZYQA 5CZGA 4LYWA 3LXJA 2FUIA 4S3OB 5B76A 5EWCA 5LVQA 4QSVA 4QBMA 5II1A 1WFKA 2RR4A 2FUUA 4YY4A 4YC9A 2LGVA 1VD4A 5FG5A 1X0JA 4MR4A 4QSUA 3MB4A 4FJCA 4NYXA 4OGJA 2CRRA 3PUQA 5L8TA 5CP5A 5FG4A 2RSDA 4UI9B 1VFYA 5A7CA 5I89A 5LJ1A 3GL6A 5A5NA 5EGUA 2B0OE 4HXPA 5JG6A 5EISA 3N9PA 5I7XA 4GNDA 5FFVA 1FP0A 1N87A 2RS9B 3MQMA 5IGMA 3C5KA 4AVXA 5A5QA 5LKTA 2K17A 3AADA 2YU4A 3GG3A 1WIMA 3T7LA 2CSZA 4YADA 5ENCA 3HCSA 5G0FA 4LDFA 4GNFA 5ETBA 5AIUA 5A5PA 5D3HA 2RFJA 3H7HA 4NN2A 3T9KA 4Z0OA 1X4IA 5H1UA 5DLXA 5B79A 4IR6A 4L58A 4Z93A 5D7XA 2M6MA 1BORA 4N3WA 4J1PA 4O78A 4LYSA 1WEMA 5HEMA 5LUUA 4HXMA 4QSTA 4TS8A 4UIXA 3N9OA 5CUCA 4R7EA 3MXFA 4V3KC 2YYNA 5AMFA 2FFWA 4UIUA 4TYLA 2F42A 3O47A 2YW5A 4MEOA 1WEQA 3RCWA 5F1HA 3O33A 5L99A 4A9EA 4IOOA 4E96A 4A4CA 1LDJB 4UP0A 5D3SA 4BW1A 5I83A 4WZ3B 4IR4A 3JVKA 5L8UA 4N4FA 2KGIA 2VPGA 4KV1A 2KWKA 4MR3A 4YH4A 5J0DA 2D8UA 4NUCA 5IBNA 5FDZA 4LYIA 4TZ2A 4N4IA 3O70A 2OXQC 5CTLA 2YHOA 5A83A 4CUPA 2LQ6A 4CCGX 2DJAA 2QJ0A 2L43A 5E9KA 5E3GA 5C8GA 3IU5A 2I50A 4LZSA 5CS8A 4LLBA 1K2FA 5D1MB 5CUAA 4TTEA 5CQ7A 4UIVA 5I1QA 4NR5A 5LJ2A 2LGGA 2YEKA 2ECGA 2MD8C 3GV4A 2H0DB 5CRMA 5HCLA 3LQJA 5CQ5A 5DYCA 5D3JA 3PURA 1HYIA 2C2VS 5E9MA 5EPRA 2ECJA 5D26A 4WIVA 5CQTA 5JWMA 1WILA 5I3LA 5FE7A 2OUOA 4C67A 1JSPB 2M13A 3ZVZB 5FE0A 4O7EA 3O35A 4QR5A 3M62A 2L5EA 4NR4A 3ONIA 2XOYA 2YURA 4O74A 4I7DA 5C7NA 5EPBA 2RNWA 4CFLA 3MULA 4YYIA 1CHCA 2JMJA 3ERRA 4HBWA 5D1LB 4OGEA 1V87A 3NG2A 4GPJA 4YBMA 5B78A 4Y03A 4UP5A 1X4UA 5A81A 5L98A 5IGLA 4PY6A 5FE6A 3P1DA 3UVWA 5CUGA 2E7NA 5D3TA 5SVYA 4O72A 2CONA 2QIZA 5FEYA 5F5ZA 1X4JA 2LN0A 2DVVA 3U5OA 5L97A 2KREA 5LKXA 4Z0RA 5A5OA 5G4RA 4UITA 2DWWA 4PTBA 4P5OB 5A85A 2KWJA 5TDRA 2DVSA 3L1XA 4HBYA 3FM8C 5E9VA 3D1DA 5EK9A 1DVPA 2BAYA 5E7DA 5H85A 1E4UA 3JUEA 4HXSA 2KGGA 4FIPA 2NXBA 5EP7A 3SVHA 3IU6A 4QUUA 4AI6A 2DVQA 4O7CA 5EI4A 3N9NA 5EU1A 4QF2A 3M99A 4AYCA 2XEUA 3U5JA 5CQ8A 3SHBA 3VKGA 4HXLA 3U5MA 4UIWA 4MSXA 5G4SA 3G0LA 5ENHA 5FFWA 3KDEC 4NR9A 4HXNA 5DBMA 5DW1A 5LKUA 3ASLA 4XUAA 4BW4A 4CUUA 2KIZA 5D3NA 5CY9A 5E73A 1JM4B 4TU4A 4KV4A 5JI8A 5HENA 1VYXA 3M7KA 1JM7A 2HYED 4QSXA 3O7AA 5COIA 2EODA 4WZ2A 5KHMA 1WUMA 5I88A 2LXPC 4CUTA 2MA5A 3RPGB 4CFKA 3UV5A 3T6RA 4AUQB 4L7XA 4R8PK 5DKHA 2DATA 5HFQA 4YYDA 2IDAA 2P57A 2R10A 2LDRA 3MHSA 4V3LC 3MUKA 1ZS5A 5E9LA 4PCIA 2JM3A 4TZ8A 2E61A 1WGMA 3SOXA 2N9GA 5KTXA 5ENGA 5E74A 2YW8A 3DAIA 3KV6A 1WESA 5EQ1A 2OWAA 2KR4A 5EYAF 3I3JA 5CU8A 1MBMA 2FD4A 3HMFA 5DKDA 3M63A 4LJNA 5DX4A 5DLZA 4Q0NA 4NRCA 4UYEA 4XY9A 5FBXA 4A0CD 4C9ZA 1EQFA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 4MR6A 3FANA 4OGCA 2IQJA 4A9LA 3P5OA 4QEWA 3UVDA 2KE1A 3SVFA 2ECWA 2L85A 5CQ6A 2LGLA 4YABA 2YEMA 2RO1A 4LZRA 3SUBA 4Z1QA 3HCTA 2L84A 2YSMA 5AD3A 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 3FAOA 4J0RA 5CUBA 4TQNA 3HMEA 2MA6A 3PHDA 4Z6IA 4WZ0A 5BT5A 4J3IA 2LAUA 4DONA 4NYVA 5BT3A 2CKLA 1Z60A 4N4HA 5E9YA 3C6WA 5D1KB 5H9MA 4PS5A 5K3QA 4MR5A 3P1FA 4QC1A 2FSAA 4J0SA 5II2A 2K16A 4TT4A 2F6NA 4YBTA 1WE9A 4A9IA 3MDBC 3ZPV1 4WHUA 2L0BA 3DWYA 2KKYA 4O76A 5DKAA 5G04B 2PUYA 2DSMA 3EB5A 5E9IA 5IIDA 4LK9A 2H60A 5TBNA 2R0YA 4A9FA 2KYUA 3KNVA 5DYXA 5ETDA 5C4QA 5HQ6A 3U5KA 4RVRA 2XP0A 2ECVA 3UV4A 4MEPA 5LKZA 3KV5A 5FB0A 5B8DA 5HELA 5ENEA 5H1TA 2I7KA 4H9DA 2VJFA 4NUDA 5D0CA 1U6GB 4YH3A 3JVMA 1WENA 3FJUB 4TU6A 3DQVR 3LQHA 4UIYA 2CKLB 3E2DA 3U5LA 2VPDA 2YELA 3V43A 3ZNIA 4HBXA 2YQDA 4MEQA 4LZ2A 5EVAA 4CA1A 4A9KA 4IORA 5CPEA 2YREA 3HTKC 4F1PA 4YK0A 2OO1A 4HXOA 5KTUA 3ZYUA 4AYCB 2MNZA 1T1HA 5KH3A 2LSPB 3D7CA 5E0RA 4N4GA 5C85A 2WP2A 5TB6A 4CUSA 1ZBDB 4BHWA 4HXRA 1PUOA 2EJNA 5E3DA 3D1BA 1JOCA 2K1JA 4X3GA 5G05B 2M85A 3N9MA 4NR6A 4LRGA 1HYJA 1JM7B 5FH6A 5EPSA 5I80A 2YSJA 5DW2A 5FB1A 4Q0OA 3S91A 3LVRE 3G0JA 4UYHA 5ACYA 2E6SA 4IC2A 4YAXA 2M1RA 5EV9A 4CURA 4I7CA 5C13A 2PNXA 5C89A 2JRJA 3P1CA 1RMDA 5DFBA 3JVJA 5L96A 3IHPA 5AMEA 4O71A 4TT6A 5C87A 4NUEA 1FBVA 4YYKA 4AKHA 4QYDA 2ECIA 3Q1DA 3VKHA 5CGPA 3O37A 3NXBA 2JUNA 5FH7A 3O36A 4Z6HA 5CQ3A 4NRBA 4UYFB 2LGKA 4XI1A
chains in the Genus database with same CATH topology
2RNYA 3O34A 5F62A 5CFWA 5DYUA 3JVLA 5FE3A 2MT5A 2YYRA 4WHWA 4O7AA 5AD2A 5EA1A 2JMIA 4LKAA 4FLPA 5LJ0A 3QZVA 4A9NA 5CQAA 4YY6A 5HRVA 2G4AA 2E6RA 4YBSA 2KU3A 5D3PA 3LJWA 5F2PA 5HM0A 5F63A 2YQMA 4ZC9A 3SVGA 3ZVYA 5HRXA 2ZETC 5I29A 2KWOA 2MNYA 4CUQA 3K2JA 4B7YC 5D25A 1Z2QA 2QICA 4KCXA 4ALHA 5FH8A 4IOQA 2RNXA 4QB3A 4ALGA 5F1LA 2AN6A 4QC3A 3FKMX 2YDWA 2Y1MA 5FE2A 5FG6A 4ZQLA 3U5PA 4NQNA 5FE8A 4XY8A 2LXHC 4O75A 3S92A 1WEPA 4UYFA 2VPEA 2WP1A 2R0VA 5FE9A 4NQMA 3SOWA 4XUBA 2YT5A 5KH7A 5A5RA 4IR5A 4C66A 3ZPVE 2L75A 4QR4A 2KFTA 5IGKA 2MD7B 5FFYA 3QZTA 5F3AA 4A4BA 2ECTA 3Q2FA 4Z1SA 4FO9A 5K29A 2K4DA 5EWWA 2G45A 5F60A 4QZSA 1WEWA 4IR3A 4R2YA 4LR6A 5DFDA 1WEOA 4O64A 5D3LA 4NYWA 4NRAA 2G6QA 3FL2A 5EM3A 4A9OA 5HQ7A 5I86A 5TABA 5H1VA 2E3KA 5AITA 4QSRA 4QSSA 2MIQA 4OUFA 5TRBA 4MENA 5A5SA 4GNGA 5EWHA 5B77A 5F25A 4O7BA 1MM2A 5DINA 3N9LA 3LRQA 3TLPA 5ENIA 4QYLA 5CUEA 3QZSA 3SOUA 2VNFA 4CL9A 3DPLR 2G43A 5ENBA 3P1EA 1LDKC 5DKCA 4QSWA 5A82A 3MHHA 5B75A 5HRWA 2F6JA 4PKLA 5ENFA 5DYAA 2RI7A 4QSQA 5CQ4A 4WA6A 5IGNA 2Y43A 4LADB 4O77A 5J3XA 4A9JA 5D3RA 2I8NA 1MM3A 1E6IA 1WEVA 4IC3A 5LCWB 3L11A 4F52B 4TKPB 4LC2A 4YYJA 3RTRB 4A9HA 4YYMA 5KU3A 5F36A 4F3IA 5DY7A 4UYGA 3N9QA 1IYMA 1G25A 4B86C 2CT2A 4YYHA 4BW2A 5KTWA 3MB3A 2DX8A 2KWNA 5D24A 3LQIA 4NXJA 4BBQA 4O70A 2KTBB 4CLBA 1N72A 2D82A 2OSSA 1Z6UA 2JMDA 4A49A 4I7BA 2YQLA 4YATA 2VJEA 2DKWA 4QNSA 5FE1A 5IG6A 4UYDA 2DVRA 4QSPA 4YYGA 4UIZA 2LRIC 2VPBA 2MJVB 4ZDTA 5KH9A 5HJCA 2CSYA 2L80A 2H0DA 4QEUA 4TT2A 4OGIA 4X2IA 5FE5A 2R0SA 5EICA 2YHNA 5DFCA 3UVXA 5F61A 5I40A 1XWHA 5FE4A 4HXKA 4NR7A 5I7YA 2C2LA 5TDWA 4O7FA 4AP4A 5EWDA 4QUTA 3I2DA 4QY4A 2ECNA 1F68A 1WEEA 2XB1A 4PPEA 2UZGA 3HMHA 5C11A 5HFRA 2VJFB 4FK5A 5HQ5A 5TCMA 4QEVA 5HLSA 1WUGA 2EGPA 4BJXA 4QF3A 5LVRA 2YUCA 3VK6A 4PCEA 4W4UA 5EWVA 4YYNA 5KO4A 2M3HA 5CUDA 2VJEB 4BW3A 5BT4A 2VP7A 2GRCA 4XYAA 4QR3A 2E7OA 4GNEA 1F62A 4HBVA 4NS5A 2D9EA 3AQAA 4AKNA 3UW9A 3RPGC 3ZTGA 2Y1NA 5CRZA 3Q2EA 2D8SA 3UV2A 4ZW1A 3EB6A 4MVTA 3UVYA 4A9MA 4NR8A 5ENJA 1WEUA 4GB0A 3ZYQA 5CZGA 4LYWA 3LXJA 2FUIA 4S3OB 5B76A 5EWCA 5LVQA 4QSVA 4QBMA 5II1A 1WFKA 2FUUA 4YY4A 4YC9A 2LGVA 1VD4A 5FG5A 1X0JA 4MR4A 4QSUA 3MB4A 4FJCA 4NYXA 4OGJA 3PUQA 5L8TA 5CP5A 5FG4A 2RSDA 4UI9B 1VFYA 5A7CA 5I89A 5LJ1A 3GL6A 5A5NA 5EGUA 5JG6A 4HXPA 5EISA 3N9PA 5I7XA 4GNDA 5FFVA 1FP0A 1N87A 2RS9B 3MQMA 5IGMA 3C5KA 4AVXA 5A5QA 5LKTA 2K17A 3AADA 2YU4A 3GG3A 1WIMA 3T7LA 2CSZA 4YADA 5ENCA 3HCSA 5G0FA 4LDFA 4GNFA 5ETBA 5AIUA 5A5PA 5D3HA 2RFJA 4NN2A 1X4IA 5H1UA 5DLXA 5B79A 4IR6A 4L58A 4Z93A 5D7XA 2M6MA 1BORA 4N3WA 4J1PA 4O78A 4LYSA 1WEMA 5HEMA 5LUUA 4HXMA 4QSTA 4TS8A 4UIXA 3N9OA 5CUCA 4R7EA 3MXFA 4V3KC 2YYNA 5AMFA 4UIUA 4TYLA 2F42A 2YW5A 4MEOA 1WEQA 3RCWA 5F1HA 3O33A 5L99A 4A9EA 4IOOA 4E96A 4A4CA 1LDJB 4UP0A 5D3SA 4BW1A 5I83A 4WZ3B 4IR4A 3JVKA 5L8UA 4N4FA 2KGIA 2VPGA 4KV1A 2KWKA 4MR3A 4YH4A 5J0DA 4NUCA 5IBNA 5FDZA 4LYIA 4TZ2A 4N4IA 3O70A 2OXQC 5CTLA 2YHOA 5A83A 4CUPA 2LQ6A 4CCGX 2QJ0A 2L43A 5E9KA 5E3GA 5C8GA 3IU5A 2I50A 4LZSA 5CS8A 4LLBA 1K2FA 5D1MB 5CUAA 4TTEA 5CQ7A 4UIVA 5I1QA 4NR5A 5LJ2A 2LGGA 2YEKA 2ECGA 2MD8C 3GV4A 2H0DB 5CRMA 5HCLA 3LQJA 5CQ5A 5DYCA 5D3JA 3PURA 1HYIA 2C2VS 5E9MA 5EPRA 2ECJA 5D26A 4WIVA 5CQTA 5JWMA 1WILA 5I3LA 5FE7A 2OUOA 4C67A 1JSPB 3ZVZB 5FE0A 4O7EA 3O35A 4QR5A 3M62A 2L5EA 4NR4A 3ONIA 2YURA 4O74A 4I7DA 5C7NA 5EPBA 2RNWA 4CFLA 3MULA 4YYIA 1CHCA 2JMJA 4HBWA 5D1LB 1V87A 3NG2A 4GPJA 4YBMA 5B78A 4Y03A 4UP5A 1X4UA 5A81A 5L98A 5IGLA 4PY6A 5FE6A 3P1DA 3UVWA 5CUGA 2E7NA 5D3TA 4O72A 2QIZA 5FEYA 5F5ZA 1X4JA 2LN0A 2DVVA 3U5OA 5L97A 2KREA 5LKXA 5A5OA 5G4RA 4UITA 2DWWA 4PTBA 4P5OB 5A85A 2KWJA 5TDRA 2DVSA 3L1XA 4HBYA 5E9VA 5EK9A 1DVPA 2BAYA 5E7DA 5H85A 1E4UA 4HXSA 2KGGA 4FIPA 2NXBA 5EP7A 3SVHA 3IU6A 4QUUA 2DVQA 4O7CA 5EI4A 3N9NA 5EU1A 4QF2A 3M99A 4AYCA 2XEUA 3U5JA 5CQ8A 3SHBA 4HXLA 3U5MA 4UIWA 4MSXA 5G4SA 3G0LA 5ENHA 5FFWA 4NR9A 4HXNA 5DBMA 5DW1A 5LKUA 3ASLA 4XUAA 4BW4A 4CUUA 2KIZA 5D3NA 5CY9A 5E73A 1JM4B 4TU4A 4KV4A 5JI8A 5HENA 1VYXA 1JM7A 2HYED 4QSXA 3O7AA 5COIA 2EODA 4WZ2A 5KHMA 1WUMA 5I88A 2LXPC 4CUTA 2MA5A 3RPGB 4CFKA 3UV5A 3T6RA 4AUQB 4L7XA 4R8PK 5DKHA 2DATA 5HFQA 4YYDA 2IDAA 2R10A 2LDRA 3MHSA 4V3LC 3MUKA 1ZS5A 5E9LA 4PCIA 4TZ8A 1WGMA 3SOXA 2N9GA 5KTXA 5ENGA 5E74A 2YW8A 3DAIA 3KV6A 1WESA 5EQ1A 2KR4A 5EYAF 3I3JA 5CU8A 3HMFA 5DKDA 3M63A 4LJNA 5DX4A 5DLZA 4Q0NA 4NRCA 4UYEA 4XY9A 5FBXA 4A0CD 4C9ZA 1EQFA 5FERA 2MUMA 2LV9A 3U5NA 2NAAA 3KQIA 4MR6A 4A9LA 3P5OA 4QEWA 3UVDA 2KE1A 3SVFA 2ECWA 2L85A 5CQ6A 2LGLA 4YABA 2YEMA 2RO1A 4LZRA 4Z1QA 3HCTA 2L84A 2YSMA 5AD3A 2HDPA 2L5UA 2EA6A 3L1ZB 3HCUA 4S3OC 4ZUXU 4Q6FA 4J0RA 5CUBA 4TQNA 3HMEA 2MA6A 3PHDA 4Z6IA 4WZ0A 5BT5A 4J3IA 4DONA 4NYVA 5BT3A 2CKLA 1Z60A 4N4HA 5E9YA 3C6WA 5D1KB 5H9MA 4PS5A 4MR5A 3P1FA 4QC1A 2FSAA 4J0SA 5II2A 2K16A 4TT4A 2F6NA 4YBTA 1WE9A 4A9IA 3ZPV1 4WHUA 2L0BA 3DWYA 4O76A 5DKAA 5G04B 2PUYA 3EB5A 5E9IA 5IIDA 4LK9A 2H60A 5TBNA 2R0YA 4A9FA 2KYUA 3KNVA 5DYXA 5ETDA 5C4QA 5HQ6A 3U5KA 4RVRA 2ECVA 3UV4A 4MEPA 5LKZA 3KV5A 5FB0A 5B8DA 5HELA 5ENEA 5H1TA 2I7KA 2VJFA 4NUDA 5D0CA 1U6GB 4YH3A 3JVMA 1WENA 4TU6A 3DQVR 3LQHA 4UIYA 2CKLB 3U5LA 2VPDA 2YELA 3V43A 3ZNIA 4HBXA 2YQDA 4MEQA 4LZ2A 5EVAA 4CA1A 4A9KA 4IORA 5CPEA 2YREA 3HTKC 4YK0A 2OO1A 4HXOA 5KTUA 3ZYUA 4AYCB 2MNZA 1T1HA 5KH3A 2LSPB 3D7CA 5E0RA 4N4GA 5C85A 2WP2A 5TB6A 4CUSA 1ZBDB 4BHWA 4HXRA 5E3DA 1JOCA 2K1JA 4X3GA 5G05B 2M85A 3N9MA 4NR6A 4LRGA 1HYJA 1JM7B 5FH6A 5EPSA 5I80A 2YSJA 5DW2A 5FB1A 4Q0OA 3S91A 3G0JA 4UYHA 5ACYA 2E6SA 4IC2A 4YAXA 2M1RA 5EV9A 4CURA 4I7CA 5C13A 2PNXA 5C89A 2JRJA 3P1CA 1RMDA 5DFBA 3JVJA 5L96A 3IHPA 5AMEA 4O71A 4TT6A 5C87A 4NUEA 1FBVA 4YYKA 2ECIA 4QYDA 5CGPA 3O37A 3NXBA 5FH7A 3O36A 4Z6HA 5CQ3A 4NRBA 4UYFB 2LGKA 4XI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNY A;  3O34 A;  5F62 A;  5CFW A;  5DYU A;  3JVL A;  5FE3 A;  2MT5 A;  2YYR A;  4WHW A;  4O7A A;  5AD2 A;  5EA1 A;  2JMI A;  4LKA A;  4FLP A;  5LJ0 A;  3QZV A;  4A9N A;  5CQA A;  4YY6 A;  5HRV A;  2G4A A;  2E6R A;  4YBS A;  2KU3 A;  5D3P A;  3LJW A;  5F2P A;  5HM0 A;  5F63 A;  2YQM A;  4ZC9 A;  3SVG A;  3ZVY A;  5HRX A;  2ZET C;  5I29 A;  2KWO A;  2MNY A;  4CUQ A;  3K2J A;  4B7Y C;  5D25 A;  1Z2Q A;  2QIC A;  4KCX A;  4ALH A;  5FH8 A;  4IOQ A;  2RNX A;  4QB3 A;  4ALG A;  5F1L A;  2AN6 A;  4QC3 A;  3FKM X;  2YDW A;  2Y1M A;  5FE2 A;  5FG6 A;  4ZQL A;  3U5P A;  4NQN A;  5FE8 A;  4XY8 A;  2LXH C;  4O75 A;  3S92 A;  1WEP A;  4UYF A;  2VPE A;  2WP1 A;  2R0V A;  5FE9 A;  4NQM A;  3SOW A;  4XUB A;  2YT5 A;  5KH7 A;  5A5R A;  4IR5 A;  4C66 A;  3ZPV E;  2L75 A;  4QR4 A;  2KFT A;  5IGK A;  2MD7 B;  5FFY A;  3QZT A;  5F3A A;  4A4B A;  2ECT A;  3Q2F A;  4Z1S A;  4FO9 A;  5K29 A;  2K4D A;  5EWW A;  2G45 A;  5F60 A;  4QZS A;  1WEW A;  4IR3 A;  4R2Y A;  4LR6 A;  5DFD A;  1WEO A;  4O64 A;  5D3L A;  4NYW A;  4NRA A;  2G6Q A;  3FL2 A;  5EM3 A;  4A9O A;  5HQ7 A;  5I86 A;  5TAB A;  5H1V A;  2E3K A;  5AIT A;  4QSR A;  4QSS A;  2MIQ A;  4OUF A;  5TRB A;  4MEN A;  5A5S A;  4GNG A;  5EWH A;  5B77 A;  5F25 A;  4O7B A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3TLP A;  5ENI A;  4QYL A;  5CUE A;  3QZS A;  3SOU A;  2VNF A;  4CL9 A;  3DPL R;  2G43 A;  5ENB A;  3P1E A;  1LDK C;  5DKC A;  4QSW A;  5A82 A;  3MHH A;  5B75 A;  5HRW A;  2F6J A;  4PKL A;  5ENF A;  5DYA A;  2RI7 A;  4QSQ A;  5CQ4 A;  4WA6 A;  5IGN A;  2Y43 A;  4LAD B;  4O77 A;  5J3X A;  4A9J A;  5D3R A;  2I8N A;  1MM3 A;  1E6I A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  4LC2 A;  4YYJ A;  3RTR B;  4A9H A;  4YYM A;  5KU3 A;  5F36 A;  4F3I A;  5DY7 A;  4UYG A;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  4YYH A;  4BW2 A;  5KTW A;  3MB3 A;  2DX8 A;  2KWN A;  5D24 A;  3LQI A;  4NXJ A;  4BBQ A;  4O70 A;  2KTB B;  4CLB A;  1N72 A;  2D82 A;  2OSS A;  1Z6U A;  2JMD A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2VJE A;  2DKW A;  4QNS A;  5FE1 A;  5IG6 A;  4UYD A;  2DVR A;  4QSP A;  4YYG A;  4UIZ A;  2LRI C;  2VPB A;  2MJV B;  4ZDT A;  5KH9 A;  5HJC A;  2CSY A;  2L80 A;  2H0D A;  4QEU A;  4TT2 A;  4OGI A;  4X2I A;  5FE5 A;  2R0S A;  5EIC A;  2YHN A;  5DFC A;  3UVX A;  5F61 A;  5I40 A;  1XWH A;  5FE4 A;  4HXK A;  4NR7 A;  5I7Y A;  2C2L A;  5TDW A;  4O7F A;  4AP4 A;  5EWD A;  4QUT A;  3I2D A;  4QY4 A;  2ECN A;  1F68 A;  1WEE A;  2XB1 A;  4PPE A;  2UZG A;  3HMH A;  5C11 A;  5HFR A;  2VJF B;  4FK5 A;  5HQ5 A;  5TCM A;  4QEV A;  5HLS A;  1WUG A;  2EGP A;  4BJX A;  4QF3 A;  5LVR A;  2YUC A;  3VK6 A;  4PCE A;  4W4U A;  5EWV A;  4YYN A;  5KO4 A;  2M3H A;  5CUD A;  2VJE B;  4BW3 A;  5BT4 A;  2VP7 A;  2GRC A;  4XYA A;  4QR3 A;  2E7O A;  4GNE A;  1F62 A;  4HBV A;  4NS5 A;  2D9E A;  3AQA A;  4AKN A;  3UW9 A;  3RPG C;  3ZTG A;  2Y1N A;  5CRZ A;  3Q2E A;  2D8S A;  3UV2 A;  4ZW1 A;  3EB6 A;  4MVT A;  3UVY A;  4A9M A;  4NR8 A;  5ENJ A;  1WEU A;  4GB0 A;  3ZYQ A;  5CZG A;  4LYW A;  3LXJ A;  2FUI A;  4S3O B;  5B76 A;  5EWC A;  5LVQ A;  4QSV A;  4QBM A;  5II1 A;  1WFK A;  2FUU A;  4YY4 A;  4YC9 A;  2LGV A;  1VD4 A;  5FG5 A;  1X0J A;  4MR4 A;  4QSU A;  3MB4 A;  4FJC A;  4NYX A;  4OGJ A;  3PUQ A;  5L8T A;  5CP5 A;  5FG4 A;  2RSD A;  4UI9 B;  1VFY A;  5A7C A;  5I89 A;  5LJ1 A;  3GL6 A;  5A5N A;  5EGU A;  5JG6 A;  4HXP A;  5EIS A;  3N9P A;  5I7X A;  4GND A;  5FFV A;  1FP0 A;  1N87 A;  2RS9 B;  3MQM A;  5IGM A;  3C5K A;  4AVX A;  5A5Q A;  5LKT A;  2K17 A;  3AAD A;  2YU4 A;  3GG3 A;  1WIM A;  3T7L A;  2CSZ A;  4YAD A;  5ENC A;  3HCS A;  5G0F A;  4LDF A;  4GNF A;  5ETB A;  5AIU A;  5A5P A;  5D3H A;  2RFJ A;  4NN2 A;  1X4I A;  5H1U A;  5DLX A;  5B79 A;  4IR6 A;  4L58 A;  4Z93 A;  5D7X A;  2M6M A;  1BOR A;  4N3W A;  4J1P A;  4O78 A;  4LYS A;  1WEM A;  5HEM A;  5LUU A;  4HXM A;  4QST A;  4TS8 A;  4UIX A;  3N9O A;  5CUC A;  4R7E A;  3MXF A;  4V3K C;  2YYN A;  5AMF A;  4UIU A;  4TYL A;  2F42 A;  2YW5 A;  4MEO A;  1WEQ A;  3RCW A;  5F1H A;  3O33 A;  5L99 A;  4A9E A;  4IOO A;  4E96 A;  4A4C A;  1LDJ B;  4UP0 A;  5D3S A;  4BW1 A;  5I83 A;  4WZ3 B;  4IR4 A;  3JVK A;  5L8U A;  4N4F A;  2KGI A;  2VPG A;  4KV1 A;  2KWK A;  4MR3 A;  4YH4 A;  5J0D A;  4NUC A;  5IBN A;  5FDZ A;  4LYI A;  4TZ2 A;  4N4I A;  3O70 A;  2OXQ C;  5CTL A;  2YHO A;  5A83 A;  4CUP A;  2LQ6 A;  4CCG X;  2QJ0 A;  2L43 A;  5E9K A;  5E3G A;  5C8G A;  3IU5 A;  2I50 A;  4LZS A;  5CS8 A;  4LLB A;  1K2F A;  5D1M B;  5CUA A;  4TTE A;  5CQ7 A;  4UIV A;  5I1Q A;  4NR5 A;  5LJ2 A;  2LGG A;  2YEK A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  5CRM A;  5HCL A;  3LQJ A;  5CQ5 A;  5DYC A;  5D3J A;  3PUR A;  1HYI A;  2C2V S;  5E9M A;  5EPR A;  2ECJ A;  5D26 A;  4WIV A;  5CQT A;  5JWM A;  1WIL A;  5I3L A;  5FE7 A;  2OUO A;  4C67 A;  1JSP B;  3ZVZ B;  5FE0 A;  4O7E A;  3O35 A;  4QR5 A;  3M62 A;  2L5E A;  4NR4 A;  3ONI A;  2YUR A;  4O74 A;  4I7D A;  5C7N A;  5EPB A;  2RNW A;  4CFL A;  3MUL A;  4YYI A;  1CHC A;  2JMJ A;  4HBW A;  5D1L B;  1V87 A;  3NG2 A;  4GPJ A;  4YBM A;  5B78 A;  4Y03 A;  4UP5 A;  1X4U A;  5A81 A;  5L98 A;  5IGL A;  4PY6 A;  5FE6 A;  3P1D A;  3UVW A;  5CUG A;  2E7N A;  5D3T A;  4O72 A;  2QIZ A;  5FEY A;  5F5Z A;  1X4J A;  2LN0 A;  2DVV A;  3U5O A;  5L97 A;  2KRE A;  5LKX A;  5A5O A;  5G4R A;  4UIT A;  2DWW A;  4PTB A;  4P5O B;  5A85 A;  2KWJ A;  5TDR A;  2DVS A;  3L1X A;  4HBY A;  5E9V A;  5EK9 A;  1DVP A;  2BAY A;  5E7D A;  5H85 A;  1E4U A;  4HXS A;  2KGG A;  4FIP A;  2NXB A;  5EP7 A;  3SVH A;  3IU6 A;  4QUU A;  2DVQ A;  4O7C A;  5EI4 A;  3N9N A;  5EU1 A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3U5J A;  5CQ8 A;  3SHB A;  4HXL A;  3U5M A;  4UIW A;  4MSX A;  5G4S A;  3G0L A;  5ENH A;  5FFW A;  4NR9 A;  4HXN A;  5DBM A;  5DW1 A;  5LKU A;  3ASL A;  4XUA A;  4BW4 A;  4CUU A;  2KIZ A;  5D3N A;  5CY9 A;  5E73 A;  1JM4 B;  4TU4 A;  4KV4 A;  5JI8 A;  5HEN A;  1VYX A;  1JM7 A;  2HYE D;  4QSX A;  3O7A A;  5COI A;  2EOD A;  4WZ2 A;  5KHM A;  1WUM A;  5I88 A;  2LXP C;  4CUT A;  2MA5 A;  3RPG B;  4CFK A;  3UV5 A;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  5DKH A;  2DAT A;  5HFQ A;  4YYD A;  2IDA A;  2R10 A;  2LDR A;  3MHS A;  4V3L C;  3MUK A;  1ZS5 A;  5E9L A;  4PCI A;  4TZ8 A;  1WGM A;  3SOX A;  2N9G A;  5KTX A;  5ENG A;  5E74 A;  2YW8 A;  3DAI A;  3KV6 A;  1WES A;  5EQ1 A;  2KR4 A;  5EYA F;  3I3J A;  5CU8 A;  3HMF A;  5DKD A;  3M63 A;  4LJN A;  5DX4 A;  5DLZ A;  4Q0N A;  4NRC A;  4UYE A;  4XY9 A;  5FBX A;  4A0C D;  4C9Z A;  1EQF A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  4MR6 A;  4A9L A;  3P5O A;  4QEW A;  3UVD A;  2KE1 A;  3SVF A;  2ECW A;  2L85 A;  5CQ6 A;  2LGL A;  4YAB A;  2YEM A;  2RO1 A;  4LZR A;  4Z1Q A;  3HCT A;  2L84 A;  2YSM A;  5AD3 A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  4J0R A;  5CUB A;  4TQN A;  3HME A;  2MA6 A;  3PHD A;  4Z6I A;  4WZ0 A;  5BT5 A;  4J3I A;  4DON A;  4NYV A;  5BT3 A;  2CKL A;  1Z60 A;  4N4H A;  5E9Y A;  3C6W A;  5D1K B;  5H9M A;  4PS5 A;  4MR5 A;  3P1F A;  4QC1 A;  2FSA A;  4J0S A;  5II2 A;  2K16 A;  4TT4 A;  2F6N A;  4YBT A;  1WE9 A;  4A9I A;  3ZPV 1;  4WHU A;  2L0B A;  3DWY A;  4O76 A;  5DKA A;  5G04 B;  2PUY A;  3EB5 A;  5E9I A;  5IID A;  4LK9 A;  2H60 A;  5TBN A;  2R0Y A;  4A9F A;  2KYU A;  3KNV A;  5DYX A;  5ETD A;  5C4Q A;  5HQ6 A;  3U5K A;  4RVR A;  2ECV A;  3UV4 A;  4MEP A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5HEL A;  5ENE A;  5H1T A;  2I7K A;  2VJF A;  4NUD A;  5D0C A;  1U6G B;  4YH3 A;  3JVM A;  1WEN A;  4TU6 A;  3DQV R;  3LQH A;  4UIY A;  2CKL B;  3U5L A;  2VPD A;  2YEL A;  3V43 A;  3ZNI A;  4HBX A;  2YQD A;  4MEQ A;  4LZ2 A;  5EVA A;  4CA1 A;  4A9K A;  4IOR A;  5CPE A;  2YRE A;  3HTK C;  4YK0 A;  2OO1 A;  4HXO A;  5KTU A;  3ZYU A;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  2LSP B;  3D7C A;  5E0R A;  4N4G A;  5C85 A;  2WP2 A;  5TB6 A;  4CUS A;  1ZBD B;  4BHW A;  4HXR A;  5E3D A;  1JOC A;  2K1J A;  4X3G A;  5G05 B;  2M85 A;  3N9M A;  4NR6 A;  4LRG A;  1HYJ A;  1JM7 B;  5FH6 A;  5EPS A;  5I80 A;  2YSJ A;  5DW2 A;  5FB1 A;  4Q0O A;  3S91 A;  3G0J A;  4UYH A;  5ACY A;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  5EV9 A;  4CUR A;  4I7C A;  5C13 A;  2PNX A;  5C89 A;  2JRJ A;  3P1C A;  1RMD A;  5DFB A;  3JVJ A;  5L96 A;  3IHP A;  5AME A;  4O71 A;  4TT6 A;  5C87 A;  4NUE A;  1FBV A;  4YYK A;  2ECI A;  4QYD A;  5CGP A;  3O37 A;  3NXB A;  5FH7 A;  3O36 A;  4Z6H A;  5CQ3 A;  4NRB A;  4UYF B;  2LGK A;  4XI1 A; 
#chains in the Genus database with same CATH topology
 2RNY A;  3O34 A;  3LJU X;  5F62 A;  5CFW A;  5DYU A;  3JVL A;  5FE3 A;  2MT5 A;  2YYR A;  3FEH A;  4WHW A;  4O7A A;  5AD2 A;  5EA1 A;  2JMI A;  4LKA A;  4FLP A;  5LJ0 A;  3QZV A;  4A9N A;  5CQA A;  4YY6 A;  5HRV A;  2G4A A;  2E6R A;  4YBS A;  2KKX A;  2KU3 A;  5D3P A;  3LJW A;  5F2P A;  5HM0 A;  5F63 A;  2YQM A;  4ZC9 A;  3SVG A;  3ZVY A;  5HRX A;  2ZET C;  1DCQ A;  5I29 A;  2KWO A;  2MNY A;  4CUQ A;  3K2J A;  4B7Y C;  5D25 A;  1Z2Q A;  2QIC A;  4KCX A;  4ALH A;  5FH8 A;  4IOQ A;  2RNX A;  4QB3 A;  4ALG A;  5F1L A;  2AN6 A;  4QC3 A;  3FKM X;  2YDW A;  2Y1M A;  5FE2 A;  5FG6 A;  4ZQL A;  3U5P A;  4NQN A;  5FE8 A;  4XY8 A;  2LXH C;  4O75 A;  3S92 A;  1WEP A;  4UYF A;  4AKG A;  2VPE A;  2WP1 A;  2R0V A;  5FE9 A;  3PLW A;  4NQM A;  3SOW A;  4XUB A;  2YT5 A;  5KH7 A;  5A5R A;  4IR5 A;  4C66 A;  4QQ4 A;  3ZPV E;  2L75 A;  4QR4 A;  2KFT A;  2CRW A;  5IGK A;  2MD7 B;  5FFY A;  4AKI A;  3QZT A;  5F3A A;  4A4B A;  2ECT A;  3Q2F A;  4Z1S A;  4FO9 A;  5K29 A;  2K4D A;  5EWW A;  2L7P A;  2G45 A;  5F60 A;  4QZS A;  1WEW A;  4IR3 A;  4R2Y A;  4LR6 A;  5DFD A;  1WEO A;  4O64 A;  2YVR A;  5D3L A;  4NYW A;  4NRA A;  2G6Q A;  3FL2 A;  5EM3 A;  4A9O A;  5HQ7 A;  5I86 A;  5TAB A;  5H1V A;  2E3K A;  5AIT A;  4QSR A;  4QSS A;  2MIQ A;  4OUF A;  3DDT A;  5TRB A;  4MEN A;  5A5S A;  4GNG A;  5EWH A;  5B77 A;  5F25 A;  4O7B A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3TLP A;  5ENI A;  4QYL A;  5CUE A;  3QZS A;  3SOU A;  2VNF A;  4CL9 A;  3DPL R;  2G43 A;  5ENB A;  3P1E A;  1LDK C;  5DKC A;  4QSW A;  5A82 A;  2XOZ A;  3MHH A;  5B75 A;  5HRW A;  2F6J A;  4PKL A;  5ENF A;  5DYA A;  2RI7 A;  4QSQ A;  5CQ4 A;  4WA6 A;  5IGN A;  2Y43 A;  2XOC A;  4LAD B;  4O77 A;  5J3X A;  4A9J A;  5D3R A;  2I8N A;  1MM3 A;  1E6I A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  4LC2 A;  5SVI A;  4YYJ A;  3RTR B;  4A9H A;  4YYM A;  5KU3 A;  5F36 A;  2MKE A;  4F3I A;  5DY7 A;  4UYG A;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  4YYH A;  4BW2 A;  5KTW A;  3MB3 A;  2DX8 A;  2KWN A;  5D24 A;  3LQI A;  2CSV A;  4NXJ A;  4BBQ A;  4O70 A;  2KTB B;  4CLB A;  1N72 A;  2D82 A;  2OSS A;  1Z6U A;  2JMD A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2EXU A;  2VJE A;  2DKW A;  4QNS A;  5FE1 A;  5IG6 A;  3LDY A;  4UYD A;  2DVR A;  4QSP A;  4YYG A;  4UIZ A;  2LRI C;  2VPB A;  2MJV B;  4ZDT A;  5KH9 A;  5HJC A;  2CSY A;  2L80 A;  2H0D A;  4QEU A;  4TT2 A;  4OGI A;  4X2I A;  5FE5 A;  2R0S A;  5EIC A;  3LVQ E;  2YHN A;  5DFC A;  3UVX A;  5F61 A;  5I40 A;  1XWH A;  5FE4 A;  4HXK A;  4NR7 A;  5SVI B;  5I7Y A;  3DWD A;  2C2L A;  5TDW A;  2EGM A;  4O7F A;  5SVX A;  5EWD A;  4QUT A;  3I2D A;  4QY4 A;  2ECN A;  1F68 A;  1WEE A;  2XB1 A;  4AP4 A;  4PPE A;  2UZG A;  3HMH A;  5C11 A;  5HFR A;  2VJF B;  4FK5 A;  5HQ5 A;  5TCM A;  4QEV A;  5HLS A;  1WUG A;  2EGP A;  4BJX A;  4QF3 A;  5LVR A;  2YUC A;  3VK6 A;  4PCE A;  4W4U A;  5EWV A;  4YYN A;  5KO4 A;  2M3H A;  5CUD A;  2VJE B;  4BW3 A;  5BT4 A;  2VP7 A;  4O62 A;  2GRC A;  4XYA A;  4QR3 A;  2E7O A;  4GNE A;  1F62 A;  4HBV A;  4NS5 A;  2D9E A;  3AQA A;  4AKN A;  3UW9 A;  3RPG C;  3ZTG A;  1ZKR A;  5CRZ A;  3Q2E A;  2Y1N A;  2D8S A;  3UV2 A;  4ZW1 A;  3EB6 A;  4MVT A;  3UVY A;  4A9M A;  4NR8 A;  5ENJ A;  1WEU A;  4GB0 A;  3ZYQ A;  5CZG A;  4LYW A;  3LXJ A;  2FUI A;  4S3O B;  5B76 A;  5EWC A;  5LVQ A;  4QSV A;  4QBM A;  5II1 A;  1WFK A;  2RR4 A;  2FUU A;  4YY4 A;  4YC9 A;  2LGV A;  1VD4 A;  5FG5 A;  1X0J A;  4MR4 A;  4QSU A;  3MB4 A;  4FJC A;  4NYX A;  4OGJ A;  2CRR A;  3PUQ A;  5L8T A;  5CP5 A;  5FG4 A;  2RSD A;  4UI9 B;  1VFY A;  5A7C A;  5I89 A;  5LJ1 A;  3GL6 A;  5A5N A;  5EGU A;  2B0O E;  4HXP A;  5JG6 A;  5EIS A;  3N9P A;  5I7X A;  4GND A;  5FFV A;  1FP0 A;  1N87 A;  2RS9 B;  3MQM A;  5IGM A;  3C5K A;  4AVX A;  5A5Q A;  5LKT A;  2K17 A;  3AAD A;  2YU4 A;  3GG3 A;  1WIM A;  3T7L A;  2CSZ A;  4YAD A;  5ENC A;  3HCS A;  5G0F A;  4LDF A;  4GNF A;  5ETB A;  5AIU A;  5A5P A;  5D3H A;  2RFJ A;  3H7H A;  4NN2 A;  3T9K A;  4Z0O A;  1X4I A;  5H1U A;  5DLX A;  5B79 A;  4IR6 A;  4L58 A;  4Z93 A;  5D7X A;  2M6M A;  1BOR A;  4N3W A;  4J1P A;  4O78 A;  4LYS A;  1WEM A;  5HEM A;  5LUU A;  4HXM A;  4QST A;  4TS8 A;  4UIX A;  3N9O A;  5CUC A;  4R7E A;  3MXF A;  4V3K C;  2YYN A;  5AMF A;  2FFW A;  4UIU A;  4TYL A;  2F42 A;  3O47 A;  2YW5 A;  4MEO A;  1WEQ A;  3RCW A;  5F1H A;  3O33 A;  5L99 A;  4A9E A;  4IOO A;  4E96 A;  4A4C A;  1LDJ B;  4UP0 A;  5D3S A;  4BW1 A;  5I83 A;  4WZ3 B;  4IR4 A;  3JVK A;  5L8U A;  4N4F A;  2KGI A;  2VPG A;  4KV1 A;  2KWK A;  4MR3 A;  4YH4 A;  5J0D A;  2D8U A;  4NUC A;  5IBN A;  5FDZ A;  4LYI A;  4TZ2 A;  4N4I A;  3O70 A;  2OXQ C;  5CTL A;  2YHO A;  5A83 A;  4CUP A;  2LQ6 A;  4CCG X;  2DJA A;  2QJ0 A;  2L43 A;  5E9K A;  5E3G A;  5C8G A;  3IU5 A;  2I50 A;  4LZS A;  5CS8 A;  4LLB A;  1K2F A;  5D1M B;  5CUA A;  4TTE A;  5CQ7 A;  4UIV A;  5I1Q A;  4NR5 A;  5LJ2 A;  2LGG A;  2YEK A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  5CRM A;  5HCL A;  3LQJ A;  5CQ5 A;  5DYC A;  5D3J A;  3PUR A;  1HYI A;  2C2V S;  5E9M A;  5EPR A;  2ECJ A;  5D26 A;  4WIV A;  5CQT A;  5JWM A;  1WIL A;  5I3L A;  5FE7 A;  2OUO A;  4C67 A;  1JSP B;  2M13 A;  3ZVZ B;  5FE0 A;  4O7E A;  3O35 A;  4QR5 A;  3M62 A;  2L5E A;  4NR4 A;  3ONI A;  2XOY A;  2YUR A;  4O74 A;  4I7D A;  5C7N A;  5EPB A;  2RNW A;  4CFL A;  3MUL A;  4YYI A;  1CHC A;  2JMJ A;  3ERR A;  4HBW A;  5D1L B;  4OGE A;  1V87 A;  3NG2 A;  4GPJ A;  4YBM A;  5B78 A;  4Y03 A;  4UP5 A;  1X4U A;  5A81 A;  5L98 A;  5IGL A;  4PY6 A;  5FE6 A;  3P1D A;  3UVW A;  5CUG A;  2E7N A;  5D3T A;  5SVY A;  4O72 A;  2CON A;  2QIZ A;  5FEY A;  5F5Z A;  1X4J A;  2LN0 A;  2DVV A;  3U5O A;  5L97 A;  2KRE A;  5LKX A;  4Z0R A;  5A5O A;  5G4R A;  4UIT A;  2DWW A;  4PTB A;  4P5O B;  5A85 A;  2KWJ A;  5TDR A;  2DVS A;  3L1X A;  4HBY A;  3FM8 C;  5E9V A;  3D1D A;  5EK9 A;  1DVP A;  2BAY A;  5E7D A;  5H85 A;  1E4U A;  3JUE A;  4HXS A;  2KGG A;  4FIP A;  2NXB A;  5EP7 A;  3SVH A;  3IU6 A;  4QUU A;  4AI6 A;  2DVQ A;  4O7C A;  5EI4 A;  3N9N A;  5EU1 A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3U5J A;  5CQ8 A;  3SHB A;  3VKG A;  4HXL A;  3U5M A;  4UIW A;  4MSX A;  5G4S A;  3G0L A;  5ENH A;  5FFW A;  3KDE C;  4NR9 A;  4HXN A;  5DBM A;  5DW1 A;  5LKU A;  3ASL A;  4XUA A;  4BW4 A;  4CUU A;  2KIZ A;  5D3N A;  5CY9 A;  5E73 A;  1JM4 B;  4TU4 A;  4KV4 A;  5JI8 A;  5HEN A;  1VYX A;  3M7K A;  1JM7 A;  2HYE D;  4QSX A;  3O7A A;  5COI A;  2EOD A;  4WZ2 A;  5KHM A;  1WUM A;  5I88 A;  2LXP C;  4CUT A;  2MA5 A;  3RPG B;  4CFK A;  3UV5 A;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  5DKH A;  2DAT A;  5HFQ A;  4YYD A;  2IDA A;  2P57 A;  2R10 A;  2LDR A;  3MHS A;  4V3L C;  3MUK A;  1ZS5 A;  5E9L A;  4PCI A;  2JM3 A;  4TZ8 A;  2E61 A;  1WGM A;  3SOX A;  2N9G A;  5KTX A;  5ENG A;  5E74 A;  2YW8 A;  3DAI A;  3KV6 A;  1WES A;  5EQ1 A;  2OWA A;  2KR4 A;  5EYA F;  3I3J A;  5CU8 A;  1MBM A;  2FD4 A;  3HMF A;  5DKD A;  3M63 A;  4LJN A;  5DX4 A;  5DLZ A;  4Q0N A;  4NRC A;  4UYE A;  4XY9 A;  5FBX A;  4A0C D;  4C9Z A;  1EQF A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  4MR6 A;  3FAN A;  4OGC A;  2IQJ A;  4A9L A;  3P5O A;  4QEW A;  3UVD A;  2KE1 A;  3SVF A;  2ECW A;  2L85 A;  5CQ6 A;  2LGL A;  4YAB A;  2YEM A;  2RO1 A;  4LZR A;  3SUB A;  4Z1Q A;  3HCT A;  2L84 A;  2YSM A;  5AD3 A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  3FAO A;  4J0R A;  5CUB A;  4TQN A;  3HME A;  2MA6 A;  3PHD A;  4Z6I A;  4WZ0 A;  5BT5 A;  4J3I A;  2LAU A;  4DON A;  4NYV A;  5BT3 A;  2CKL A;  1Z60 A;  4N4H A;  5E9Y A;  3C6W A;  5D1K B;  5H9M A;  4PS5 A;  5K3Q A;  4MR5 A;  3P1F A;  4QC1 A;  2FSA A;  4J0S A;  5II2 A;  2K16 A;  4TT4 A;  2F6N A;  4YBT A;  1WE9 A;  4A9I A;  3MDB C;  3ZPV 1;  4WHU A;  2L0B A;  3DWY A;  2KKY A;  4O76 A;  5DKA A;  5G04 B;  2PUY A;  2DSM A;  3EB5 A;  5E9I A;  5IID A;  4LK9 A;  2H60 A;  5TBN A;  2R0Y A;  4A9F A;  2KYU A;  3KNV A;  5DYX A;  5ETD A;  5C4Q A;  5HQ6 A;  3U5K A;  4RVR A;  2XP0 A;  2ECV A;  3UV4 A;  4MEP A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5HEL A;  5ENE A;  5H1T A;  2I7K A;  4H9D A;  2VJF A;  4NUD A;  5D0C A;  1U6G B;  4YH3 A;  3JVM A;  1WEN A;  3FJU B;  4TU6 A;  3DQV R;  3LQH A;  4UIY A;  2CKL B;  3E2D A;  3U5L A;  2VPD A;  2YEL A;  3V43 A;  3ZNI A;  4HBX A;  2YQD A;  4MEQ A;  4LZ2 A;  5EVA A;  4CA1 A;  4A9K A;  4IOR A;  5CPE A;  2YRE A;  3HTK C;  4F1P A;  4YK0 A;  2OO1 A;  4HXO A;  5KTU A;  3ZYU A;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  2LSP B;  3D7C A;  5E0R A;  4N4G A;  5C85 A;  2WP2 A;  5TB6 A;  4CUS A;  1ZBD B;  4BHW A;  4HXR A;  1PUO A;  2EJN A;  5E3D A;  3D1B A;  1JOC A;  2K1J A;  4X3G A;  5G05 B;  2M85 A;  3N9M A;  4NR6 A;  4LRG A;  1HYJ A;  1JM7 B;  5FH6 A;  5EPS A;  5I80 A;  2YSJ A;  5DW2 A;  5FB1 A;  4Q0O A;  3S91 A;  3LVR E;  3G0J A;  4UYH A;  5ACY A;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  5EV9 A;  4CUR A;  4I7C A;  5C13 A;  2PNX A;  5C89 A;  2JRJ A;  3P1C A;  1RMD A;  5DFB A;  3JVJ A;  5L96 A;  3IHP A;  5AME A;  4O71 A;  4TT6 A;  5C87 A;  4NUE A;  1FBV A;  4YYK A;  4AKH A;  4QYD A;  2ECI A;  3Q1D A;  3VKH A;  5CGP A;  3O37 A;  3NXB A;  2JUN A;  5FH7 A;  3O36 A;  4Z6H A;  5CQ3 A;  4NRB A;  4UYF B;  2LGK A;  4XI1 A; 
#chains in the Genus database with same CATH homology
 2RNY A;  3O34 A;  5F62 A;  5CFW A;  5DYU A;  3JVL A;  5FE3 A;  2MT5 A;  2YYR A;  4WHW A;  4O7A A;  5AD2 A;  5EA1 A;  2JMI A;  4LKA A;  4FLP A;  5LJ0 A;  3QZV A;  4A9N A;  5CQA A;  4YY6 A;  5HRV A;  2G4A A;  2E6R A;  4YBS A;  2KU3 A;  5D3P A;  3LJW A;  5F2P A;  5HM0 A;  5F63 A;  2YQM A;  4ZC9 A;  3SVG A;  3ZVY A;  5HRX A;  2ZET C;  5I29 A;  2KWO A;  2MNY A;  4CUQ A;  3K2J A;  4B7Y C;  5D25 A;  1Z2Q A;  2QIC A;  4KCX A;  4ALH A;  5FH8 A;  4IOQ A;  2RNX A;  4QB3 A;  4ALG A;  5F1L A;  2AN6 A;  4QC3 A;  3FKM X;  2YDW A;  2Y1M A;  5FE2 A;  5FG6 A;  4ZQL A;  3U5P A;  4NQN A;  5FE8 A;  4XY8 A;  2LXH C;  4O75 A;  3S92 A;  1WEP A;  4UYF A;  2VPE A;  2WP1 A;  2R0V A;  5FE9 A;  4NQM A;  3SOW A;  4XUB A;  2YT5 A;  5KH7 A;  5A5R A;  4IR5 A;  4C66 A;  3ZPV E;  2L75 A;  4QR4 A;  2KFT A;  5IGK A;  2MD7 B;  5FFY A;  3QZT A;  5F3A A;  4A4B A;  2ECT A;  3Q2F A;  4Z1S A;  4FO9 A;  5K29 A;  2K4D A;  5EWW A;  2G45 A;  5F60 A;  4QZS A;  1WEW A;  4IR3 A;  4R2Y A;  4LR6 A;  5DFD A;  1WEO A;  4O64 A;  5D3L A;  4NYW A;  4NRA A;  2G6Q A;  3FL2 A;  5EM3 A;  4A9O A;  5HQ7 A;  5I86 A;  5TAB A;  5H1V A;  2E3K A;  5AIT A;  4QSR A;  4QSS A;  2MIQ A;  4OUF A;  5TRB A;  4MEN A;  5A5S A;  4GNG A;  5EWH A;  5B77 A;  5F25 A;  4O7B A;  1MM2 A;  5DIN A;  3N9L A;  3LRQ A;  3TLP A;  5ENI A;  4QYL A;  5CUE A;  3QZS A;  3SOU A;  2VNF A;  4CL9 A;  3DPL R;  2G43 A;  5ENB A;  3P1E A;  1LDK C;  5DKC A;  4QSW A;  5A82 A;  3MHH A;  5B75 A;  5HRW A;  2F6J A;  4PKL A;  5ENF A;  5DYA A;  2RI7 A;  4QSQ A;  5CQ4 A;  4WA6 A;  5IGN A;  2Y43 A;  4LAD B;  4O77 A;  5J3X A;  4A9J A;  5D3R A;  2I8N A;  1MM3 A;  1E6I A;  1WEV A;  4IC3 A;  5LCW B;  3L11 A;  4F52 B;  4TKP B;  4LC2 A;  4YYJ A;  3RTR B;  4A9H A;  4YYM A;  5KU3 A;  5F36 A;  4F3I A;  5DY7 A;  4UYG A;  3N9Q A;  1IYM A;  1G25 A;  4B86 C;  2CT2 A;  4YYH A;  4BW2 A;  5KTW A;  3MB3 A;  2DX8 A;  2KWN A;  5D24 A;  3LQI A;  4NXJ A;  4BBQ A;  4O70 A;  2KTB B;  4CLB A;  1N72 A;  2D82 A;  2OSS A;  1Z6U A;  2JMD A;  4A49 A;  4I7B A;  2YQL A;  4YAT A;  2VJE A;  2DKW A;  4QNS A;  5FE1 A;  5IG6 A;  4UYD A;  2DVR A;  4QSP A;  4YYG A;  4UIZ A;  2LRI C;  2VPB A;  2MJV B;  4ZDT A;  5KH9 A;  5HJC A;  2CSY A;  2L80 A;  2H0D A;  4QEU A;  4TT2 A;  4OGI A;  4X2I A;  5FE5 A;  2R0S A;  5EIC A;  2YHN A;  5DFC A;  3UVX A;  5F61 A;  5I40 A;  1XWH A;  5FE4 A;  4HXK A;  4NR7 A;  5I7Y A;  2C2L A;  5TDW A;  4O7F A;  4AP4 A;  5EWD A;  4QUT A;  3I2D A;  4QY4 A;  2ECN A;  1F68 A;  1WEE A;  2XB1 A;  4PPE A;  2UZG A;  3HMH A;  5C11 A;  5HFR A;  2VJF B;  4FK5 A;  5HQ5 A;  5TCM A;  4QEV A;  5HLS A;  1WUG A;  2EGP A;  4BJX A;  4QF3 A;  5LVR A;  2YUC A;  3VK6 A;  4PCE A;  4W4U A;  5EWV A;  4YYN A;  5KO4 A;  2M3H A;  5CUD A;  2VJE B;  4BW3 A;  5BT4 A;  2VP7 A;  2GRC A;  4XYA A;  4QR3 A;  2E7O A;  4GNE A;  1F62 A;  4HBV A;  4NS5 A;  2D9E A;  3AQA A;  4AKN A;  3UW9 A;  3RPG C;  3ZTG A;  2Y1N A;  5CRZ A;  3Q2E A;  2D8S A;  3UV2 A;  4ZW1 A;  3EB6 A;  4MVT A;  3UVY A;  4A9M A;  4NR8 A;  5ENJ A;  1WEU A;  4GB0 A;  3ZYQ A;  5CZG A;  4LYW A;  3LXJ A;  2FUI A;  4S3O B;  5B76 A;  5EWC A;  5LVQ A;  4QSV A;  4QBM A;  5II1 A;  1WFK A;  2FUU A;  4YY4 A;  4YC9 A;  2LGV A;  1VD4 A;  5FG5 A;  1X0J A;  4MR4 A;  4QSU A;  3MB4 A;  4FJC A;  4NYX A;  4OGJ A;  3PUQ A;  5L8T A;  5CP5 A;  5FG4 A;  2RSD A;  4UI9 B;  1VFY A;  5A7C A;  5I89 A;  5LJ1 A;  3GL6 A;  5A5N A;  5EGU A;  5JG6 A;  4HXP A;  5EIS A;  3N9P A;  5I7X A;  4GND A;  5FFV A;  1FP0 A;  1N87 A;  2RS9 B;  3MQM A;  5IGM A;  3C5K A;  4AVX A;  5A5Q A;  5LKT A;  2K17 A;  3AAD A;  2YU4 A;  3GG3 A;  1WIM A;  3T7L A;  2CSZ A;  4YAD A;  5ENC A;  3HCS A;  5G0F A;  4LDF A;  4GNF A;  5ETB A;  5AIU A;  5A5P A;  5D3H A;  2RFJ A;  4NN2 A;  1X4I A;  5H1U A;  5DLX A;  5B79 A;  4IR6 A;  4L58 A;  4Z93 A;  5D7X A;  2M6M A;  1BOR A;  4N3W A;  4J1P A;  4O78 A;  4LYS A;  1WEM A;  5HEM A;  5LUU A;  4HXM A;  4QST A;  4TS8 A;  4UIX A;  3N9O A;  5CUC A;  4R7E A;  3MXF A;  4V3K C;  2YYN A;  5AMF A;  4UIU A;  4TYL A;  2F42 A;  2YW5 A;  4MEO A;  1WEQ A;  3RCW A;  5F1H A;  3O33 A;  5L99 A;  4A9E A;  4IOO A;  4E96 A;  4A4C A;  1LDJ B;  4UP0 A;  5D3S A;  4BW1 A;  5I83 A;  4WZ3 B;  4IR4 A;  3JVK A;  5L8U A;  4N4F A;  2KGI A;  2VPG A;  4KV1 A;  2KWK A;  4MR3 A;  4YH4 A;  5J0D A;  4NUC A;  5IBN A;  5FDZ A;  4LYI A;  4TZ2 A;  4N4I A;  3O70 A;  2OXQ C;  5CTL A;  2YHO A;  5A83 A;  4CUP A;  2LQ6 A;  4CCG X;  2QJ0 A;  2L43 A;  5E9K A;  5E3G A;  5C8G A;  3IU5 A;  2I50 A;  4LZS A;  5CS8 A;  4LLB A;  1K2F A;  5D1M B;  5CUA A;  4TTE A;  5CQ7 A;  4UIV A;  5I1Q A;  4NR5 A;  5LJ2 A;  2LGG A;  2YEK A;  2ECG A;  2MD8 C;  3GV4 A;  2H0D B;  5CRM A;  5HCL A;  3LQJ A;  5CQ5 A;  5DYC A;  5D3J A;  3PUR A;  1HYI A;  2C2V S;  5E9M A;  5EPR A;  2ECJ A;  5D26 A;  4WIV A;  5CQT A;  5JWM A;  1WIL A;  5I3L A;  5FE7 A;  2OUO A;  4C67 A;  1JSP B;  3ZVZ B;  5FE0 A;  4O7E A;  3O35 A;  4QR5 A;  3M62 A;  2L5E A;  4NR4 A;  3ONI A;  2YUR A;  4O74 A;  4I7D A;  5C7N A;  5EPB A;  2RNW A;  4CFL A;  3MUL A;  4YYI A;  1CHC A;  2JMJ A;  4HBW A;  5D1L B;  1V87 A;  3NG2 A;  4GPJ A;  4YBM A;  5B78 A;  4Y03 A;  4UP5 A;  1X4U A;  5A81 A;  5L98 A;  5IGL A;  4PY6 A;  5FE6 A;  3P1D A;  3UVW A;  5CUG A;  2E7N A;  5D3T A;  4O72 A;  2QIZ A;  5FEY A;  5F5Z A;  1X4J A;  2LN0 A;  2DVV A;  3U5O A;  5L97 A;  2KRE A;  5LKX A;  5A5O A;  5G4R A;  4UIT A;  2DWW A;  4PTB A;  4P5O B;  5A85 A;  2KWJ A;  5TDR A;  2DVS A;  3L1X A;  4HBY A;  5E9V A;  5EK9 A;  1DVP A;  2BAY A;  5E7D A;  5H85 A;  1E4U A;  4HXS A;  2KGG A;  4FIP A;  2NXB A;  5EP7 A;  3SVH A;  3IU6 A;  4QUU A;  2DVQ A;  4O7C A;  5EI4 A;  3N9N A;  5EU1 A;  4QF2 A;  3M99 A;  4AYC A;  2XEU A;  3U5J A;  5CQ8 A;  3SHB A;  4HXL A;  3U5M A;  4UIW A;  4MSX A;  5G4S A;  3G0L A;  5ENH A;  5FFW A;  4NR9 A;  4HXN A;  5DBM A;  5DW1 A;  5LKU A;  3ASL A;  4XUA A;  4BW4 A;  4CUU A;  2KIZ A;  5D3N A;  5CY9 A;  5E73 A;  1JM4 B;  4TU4 A;  4KV4 A;  5JI8 A;  5HEN A;  1VYX A;  1JM7 A;  2HYE D;  4QSX A;  3O7A A;  5COI A;  2EOD A;  4WZ2 A;  5KHM A;  1WUM A;  5I88 A;  2LXP C;  4CUT A;  2MA5 A;  3RPG B;  4CFK A;  3UV5 A;  3T6R A;  4AUQ B;  4L7X A;  4R8P K;  5DKH A;  2DAT A;  5HFQ A;  4YYD A;  2IDA A;  2R10 A;  2LDR A;  3MHS A;  4V3L C;  3MUK A;  1ZS5 A;  5E9L A;  4PCI A;  4TZ8 A;  1WGM A;  3SOX A;  2N9G A;  5KTX A;  5ENG A;  5E74 A;  2YW8 A;  3DAI A;  3KV6 A;  1WES A;  5EQ1 A;  2KR4 A;  5EYA F;  3I3J A;  5CU8 A;  3HMF A;  5DKD A;  3M63 A;  4LJN A;  5DX4 A;  5DLZ A;  4Q0N A;  4NRC A;  4UYE A;  4XY9 A;  5FBX A;  4A0C D;  4C9Z A;  1EQF A;  5FER A;  2MUM A;  2LV9 A;  3U5N A;  2NAA A;  3KQI A;  4MR6 A;  4A9L A;  3P5O A;  4QEW A;  3UVD A;  2KE1 A;  3SVF A;  2ECW A;  2L85 A;  5CQ6 A;  2LGL A;  4YAB A;  2YEM A;  2RO1 A;  4LZR A;  4Z1Q A;  3HCT A;  2L84 A;  2YSM A;  5AD3 A;  2HDP A;  2L5U A;  2EA6 A;  3L1Z B;  3HCU A;  4S3O C;  4ZUX U;  4Q6F A;  4J0R A;  5CUB A;  4TQN A;  3HME A;  2MA6 A;  3PHD A;  4Z6I A;  4WZ0 A;  5BT5 A;  4J3I A;  4DON A;  4NYV A;  5BT3 A;  2CKL A;  1Z60 A;  4N4H A;  5E9Y A;  3C6W A;  5D1K B;  5H9M A;  4PS5 A;  4MR5 A;  3P1F A;  4QC1 A;  2FSA A;  4J0S A;  5II2 A;  2K16 A;  4TT4 A;  2F6N A;  4YBT A;  1WE9 A;  4A9I A;  3ZPV 1;  4WHU A;  2L0B A;  3DWY A;  4O76 A;  5DKA A;  5G04 B;  2PUY A;  3EB5 A;  5E9I A;  5IID A;  4LK9 A;  2H60 A;  5TBN A;  2R0Y A;  4A9F A;  2KYU A;  3KNV A;  5DYX A;  5ETD A;  5C4Q A;  5HQ6 A;  3U5K A;  4RVR A;  2ECV A;  3UV4 A;  4MEP A;  5LKZ A;  3KV5 A;  5FB0 A;  5B8D A;  5HEL A;  5ENE A;  5H1T A;  2I7K A;  2VJF A;  4NUD A;  5D0C A;  1U6G B;  4YH3 A;  3JVM A;  1WEN A;  4TU6 A;  3DQV R;  3LQH A;  4UIY A;  2CKL B;  3U5L A;  2VPD A;  2YEL A;  3V43 A;  3ZNI A;  4HBX A;  2YQD A;  4MEQ A;  4LZ2 A;  5EVA A;  4CA1 A;  4A9K A;  4IOR A;  5CPE A;  2YRE A;  3HTK C;  4YK0 A;  2OO1 A;  4HXO A;  5KTU A;  3ZYU A;  4AYC B;  2MNZ A;  1T1H A;  5KH3 A;  2LSP B;  3D7C A;  5E0R A;  4N4G A;  5C85 A;  2WP2 A;  5TB6 A;  4CUS A;  1ZBD B;  4BHW A;  4HXR A;  5E3D A;  1JOC A;  2K1J A;  4X3G A;  5G05 B;  2M85 A;  3N9M A;  4NR6 A;  4LRG A;  1HYJ A;  1JM7 B;  5FH6 A;  5EPS A;  5I80 A;  2YSJ A;  5DW2 A;  5FB1 A;  4Q0O A;  3S91 A;  3G0J A;  4UYH A;  5ACY A;  2E6S A;  4IC2 A;  4YAX A;  2M1R A;  5EV9 A;  4CUR A;  4I7C A;  5C13 A;  2PNX A;  5C89 A;  2JRJ A;  3P1C A;  1RMD A;  5DFB A;  3JVJ A;  5L96 A;  3IHP A;  5AME A;  4O71 A;  4TT6 A;  5C87 A;  4NUE A;  1FBV A;  4YYK A;  2ECI A;  4QYD A;  5CGP A;  3O37 A;  3NXB A;  5FH7 A;  3O36 A;  4Z6H A;  5CQ3 A;  4NRB A;  4UYF B;  2LGK A;  4XI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...