4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
b'RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
4NRCA 4RVRA 2K4DA 4QF2A 4ZDTA 4YH4A 5LKZA 3O34A 4XI1A 4WHWA 5FERA 2H0DA 2K1JA 5I1QA 3UW9A 4FIPA 4B86C 3G0JA 1WESA 1WUMA 5G05B 5ENJA 2YEKA 3QZVA 2D9EA 4V3LC 3HCUA 1WUGA 1X0JA 4Y03A 1WEQA 2G4AA 1X4IA 3K2JA 5EISA 5C89A 2FSAA 2RSDA 2LGKA 2YURA 4LRGA 5I3LA 4NR9A 4LJNA 2I7KA 4TZ2A 2LQ6A 4LZRA 2L5EA 3ZVYA 5A5OA 2N9GA 4CUPA 2L85A 4QYDA 5D3SA 5AMEA 5HRVA 4CL9A 4UYDA 4QF3A 5L8TA 2L43A 5LCWB 3ZPVE 5KO4A 4O7EA 4AYCB 4BW3A 2E7NA 4O70A 4AUQB 2KWJA 3G0LA 4NR8A 3LJWA 1E6IA 4LZSA 5C4QA 1JM4B 3O33A 5DFDA 4C66A 2D82A 4ZUXU 3T7LA 5EWHA 5E0RA 4QEVA 2RNXA 5D3HA 5E73A 4YYMA 3U5LA 2Y1MA 3Q2EA 5CU8A 4UYEA 4A9JA 4CUSA 1WEVA 4LLBA 5CRMA 2RI7A 1N72A 3SHBA 3UV2A 5CPEA 2XEUA 4TTEA 3RCWA 5E3DA 4HXOA 1JM7A 2KWKA 2MA5A 5DW2A 5I29A 4B7YC 4TYLA 5HEMA 2XB1A 3U5NA 5L99A 3N9QA 5DYUA 5KH7A 4LR6A 5CS8A 4WZ3B 3DWYA 3MULA 4S3OB 4Z93A 5CUCA 4QNSA 2LXHC 3M62A 2YUCA 5D3NA 5FDZA 5FE0A 2VPEA 1U6GB 4UYFB 5EWCA 4UYGA 4QZSA 1WFKA 2I50A 4O7CA 2EGPA 2RO1A 2KYUA 2LDRA 4O75A 4UYHA 5ETDA 4Z1QA 3O36A 5KHMA 2MD7B 5ENGA 5DFBA 3P1CA 2E6RA 5A5RA 2KU3A 3JVMA 4YATA 1X4JA 4O78A 4HXNA 3IHPA 4BBQA 4QY4A 4YH3A 5F5ZA 5H9MA 5LJ1A 4W4UA 2DKWA 2YYNA 4YYDA 2KGGA 3N9PA 5C13A 4MR6A 4NQNA 1WEPA 3HCTA 3UV4A 4HXRA 4NRBA 4LC2A 5HLSA 2F42A 4UIYA 2MD8C 4IR6A 2AN6A 3ZPV1 5L97A 5EICA 5EPRA 2JMDA 4QYLA 4MSXA 5B79A 2RFJA 5A81A 2YQDA 4QUUA 4YY6A 1FBVA 2YT5A 3EB6A 3GL6A 2WP2A 4KV1A 4NUEA 3HMEA 2CSZA 5HRXA 2VJFA 2OUOA 2YELA 2CKLB 5EM3A 1WGMA 4BW1A 4R7EA 5II1A 5FFYA 5FG4A 4O7AA 2OO1A 5G04B 3D7CA 2G45A 4NR6A 4FJCA 2FUUA 4QR3A 4O64A 2VPDA 5LJ2A 2I8NA 5LUUA 4I7DA 5D25A 4ALHA 5EI4A 5FH6A 4C67A 2YHOA 4A9HA 5KTUA 5BT4A 5ETBA 4LKAA 5DKHA 3SVHA 1E4UA 2LSPB 4NR7A 2RNWA 2LGLA 2H60A 3MXFA 5AD3A 1MM2A 3JVJA 5FB1A 5F63A 4BW4A 5HFRA 1LDJB 3HMHA 5A83A 5I80A 4Q0OA 5F60A 4XY9A 3AADA 4Z6IA 4LDFA 5A5QA 3LRQA 4L7XA 3N9OA 2UZGA 5DYAA 5FG5A 2M85A 4O77A 4UIWA 4NYWA 5CRZA 1WIMA 4PS5A 1LDKC 4L58A 5LKXA 4MR3A 4Q6FA 4QSPA 5F3AA 2ECIA 4A4CA 5C11A 2BAYA 3PHDA 5C7NA 2QIZA 5JG6A 4YBMA 3SOWA 5FE1A 2YYRA 4PTBA 4A0CD 1X4UA 2L84A 2M1RA 3P5OA 5II2A 4YABA 4YBTA 5CTLA 4QR5A 2HYED 5I7YA 3RTRB 4YYKA 2VJEA 4MVTA 1WEOA 4MEOA 4X2IA 2IDAA 4UIVA 5A5NA 5H85A 4TT6A 2M3HA 5IGKA 4NXJA 3IU5A 4QSUA 4CCGX 3LXJA 1WE9A 2E6SA 5HQ5A 1WEUA 5C85A 1WILA 5D1LB 2YDWA 5H1TA 4YC9A 2MNZA 3MUKA 4PKLA 3ONIA 4HXKA 4TS8A 5TB6A 5J0DA 4LYSA 1EQFA 5KTXA 4HXPA 2MA6A 2MNYA 4I7BA 4MR5A 4NR4A 5HFQA 4YYIA 2H0DB 4NN2A 5DKCA 3UVDA 2KWNA 2MIQA 3DPLR 4PY6A 1F68A 5TRBA 2PNXA 5C87A 2MJVB 5AD2A 5HQ6A 2YQMA 3PUQA 2KFTA 5DY7A 3L1XA 3FL2A 5D7XA 4FO9A 1WEWA 5IBNA 4QC1A 5L8UA 5D3RA 1Z6UA 2DVRA 4YYGA 1VD4A 4AP4A 2G6QA 2YEMA 2LXPC 4AKNA 3MHSA 4PPEA 4TT4A 4LYIA 2GRCA 4UP5A 2NAAA 5ENCA 4HBVA 5ENFA 4QSRA 5EWWA 3DQVR 4LK9A 4O7BA 3RPGC 3HMFA 3NXBA 5CUGA 5EQ1A 5EWVA 3S91A 1V87A 2ECTA 5AMFA 4UIXA 2G43A 5KU3A 4GNFA 4LADB 5B78A 5A5PA 5E9MA 5EPBA 1N87A 3MHHA 2ECJA 3KV5A 5CUBA 2KR4A 4GNDA 5E9VA 5EP7A 2CKLA 1XWHA 4QEUA 5D3PA 2CT2A 3I3JA 4I7CA 3O35A 3QZTA 2QICA 1JM7B 5D24A 4XUAA 5L98A 1T1HA 2DVSA 4BW2A 2L80A 5D0CA 3C6WA 3HCSA 2R0SA 5I86A 5F2PA 2VPBA 2RNYA 3U5PA 2KE1A 2LN0A 2YU4A 5KH3A 2YSMA 2EODA 3MB4A 5I88A 2ECWA 2OSSA 4GB0A 5EPSA 2ECNA 4NYVA 4IR3A 2DVQA 5CQ3A 4YK0A 3JVKA 4BHWA 5FH8A 3JVLA 5BT3A 3ZTGA 5FEYA 3I2DA 4NRAA 3QZSA 4QC3A 3UVWA 4ZW1A 2MUMA 2JMIA 4CFLA 5IGNA 2L0BA 3PURA 4UIUA 3GV4A 5E74A 3V43A 5IGMA 3KV6A 1RMDA 4MEPA 5FE8A 5EV9A 5HELA 5C8GA 5FE3A 5HENA 2K16A 5EVAA 4FK5A 2E7OA 4ZQLA 3L1ZB 3M99A 4N4IA 5HCLA 3NG2A 3L11A 4X3GA 5CQ8A 5FE4A 3UV5A 4QUTA 4Z1SA 2KIZA 2R0YA 1ZS5A 5COIA 5I7XA 3UVXA 3U5JA 4Z6HA 4NUCA 3N9LA 4MR4A 1WENA 5IGLA 1HYIA 3C5KA 2RS9B 4OUFA 5IIDA 4YYNA 4HXSA 4IOOA 4XUBA 4DONA 2YQLA 3P1FA 4YYJA 4O76A 5FE7A 2M6MA 5E9IA 5DYCA 5D1KB 3KQIA 4CLBA 4LYWA 3SVFA 5E9KA 5F62A 5DINA 5IG6A 5F25A 4HBYA 5EGUA 5FB0A 4YAXA 2VJFB 4UI9B 5B76A 4R8PK 5EWDA 5FE5A 4AYCA 4MENA 4OGIA 3M63A 3SVGA 4OGJA 5F36A 1WEMA 4TKPB 5A5SA 4WIVA 4C9ZA 2E3KA 2QJ0A 4J0RA 5JWMA 5B77A 1JSPB 3P1DA 4KV4A 2LV9A 5TCMA 2VP7A 4NR5A 5HJCA 2HDPA 3LQIA 3MQMA 4J3IA 4V3KC 5DYXA 3LQJA 4LZ2A 4IR5A 4QB3A 3T6RA 3P1EA 4ZC9A 4UITA 4CUTA 4GNEA 4GPJA 3LQHA 2YW8A 5E7DA 3O70A 2DVVA 4F3IA 5TDWA 1WEEA 4MEQA 4HBWA 4A9MA 2K17A 4KCXA 3U5MA 2MT5A 4IC2A 5CQ6A 4UYFA 5BT5A 2DX8A 5F1LA 4YBSA 4A9LA 4GNGA 4J0SA 4A9KA 4N4GA 2JRJA 4S3OC 4IR4A 5EU1A 2YW5A 4WHUA 5F61A 1G25A 5L96A 5FH7A 2L75A 4A9OA 4NYXA 5TBNA 5DBMA 5ACYA 2ECVA 2NXBA 5D3TA 2KTBB 5ENBA 2VPGA 5KTWA 2VJEB 5JI8A 2YREA 5D1MB 4O71A 4O74A 5CGPA 3EB5A 3ASLA 4HXLA 4J1PA 1ZBDB 2R0VA 1VYXA 4A9FA 4TU6A 4XY8A 5TABA 5TDRA 5D26A 2LRIC 2DATA 3U5KA 1Z60A 5DX4A 2OXQC 1F62A 2LGGA 3ZVZB 4PCEA 4QEWA 4IOQA 5D3LA 4AVXA 5CUDA 5FE2A 1FP0A 5B8DA 4WZ0A 5AITA 2JMJA 4QSQA 5CP5A 5E9YA 5FFWA 1VFYA 4A4BA 5A85A 2Y43A 2VNFA 3UVYA 3O37A 5DKAA 4YY4A 5DKDA 5H1VA 5H1UA 4NQMA 5E3GA 4QSSA 5EK9A 4Q0NA 5CQTA 5CZGA 3N9MA 4CUUA 1IYMA 4XYAA 2KWOA 1HYJA 3FKMX 5EA1A 2F6NA 5G0FA 2LGVA 3GG3A 3DAIA 3S92A 4A9EA 3VK6A 2KGIA 5G4RA 2FUIA 5CQ4A 5E9LA 4UIZA 5FE6A 2KREA 2YHNA 5FFVA 4IORA 5HM0A 3MB3A 5CQAA 5I83A 3RPGB 2ECGA 4QSVA 3N9NA 5DW1A 4F52B 5ENHA 3IU6A 5ENIA 4N4HA 5LVQA 2PUYA 4ALGA 1MM3A 3Q2FA 5FE9A 5AIUA 2DWWA 2CSYA 5DFCA 5KH9A 5HQ7A 2C2VS 3ZNIA 4NUDA 4TU4A 5F1HA 5LKTA 2EA6A 4R2YA 4CA1A 4WA6A 5LJ0A 5CQ7A 4O72A 4N4FA 4TT2A 4QSTA 5CUEA 4E96A 4N3WA 5K29A 4A9IA 4TZ8A 5DLZA 4YYHA 4QBMA 3TLPA 3ZYUA 5FG6A 5I89A 3SOUA 4IC3A 5LVRA 2Y1NA 2L5UA 2F6JA 4PCIA 4A49A 5LKUA 5I40A 1Z2QA 3KNVA 5CY9A 1BORA 1CHCA 1DVPA 4P5OB 1JOCA 5CFWA 2ZETC 4QSWA 3O7AA 3ZYQA 5D3JA 4BJXA 5B75A 3AQAA 4FLPA 5CQ5A 3HTKC 2YSJA 3U5OA 4HXMA 2D8SA 4CFKA 2C2LA 4CUQA 5DLXA 5EYAF 5HRWA 4YADA 5A82A 5FBXA 4A9NA 4CURA 2R10A 4TQNA 5G4SA 5CUAA 4QR4A 5A7CA 4HBXA 5J3XA 4QSXA 5ENEA 2WP1A 4O7FA 4UP0A 4WZ2A 1K2FA 3SOXA 4NS5A
chains in the Genus database with same CATH superfamily
4NRCA 4RVRA 2K4DA 4QF2A 4ZDTA 4YH4A 5LKZA 3O34A 4XI1A 4WHWA 5FERA 2H0DA 2K1JA 5I1QA 3UW9A 4FIPA 4B86C 3G0JA 1WESA 1WUMA 5G05B 5ENJA 2YEKA 3QZVA 2D9EA 4V3LC 3HCUA 1WUGA 1X0JA 4Y03A 5SVYA 1WEQA 2G4AA 1X4IA 3K2JA 2KKYA 5EISA 5C89A 2FSAA 2RSDA 2LGKA 2YURA 4LRGA 5I3LA 4NR9A 4LJNA 2I7KA 4TZ2A 2LQ6A 4LZRA 2L5EA 3ZVYA 5A5OA 2N9GA 4CUPA 2L85A 4QYDA 5D3SA 5AMEA 5HRVA 4CL9A 4UYDA 4QF3A 5L8TA 2L43A 5LCWB 3ZPVE 5KO4A 4O7EA 4AYCB 4BW3A 2E7NA 4O70A 4AUQB 2KWJA 3G0LA 4NR8A 3LJWA 1E6IA 4LZSA 5C4QA 1JM4B 3O33A 5DFDA 4C66A 2D82A 4AKIA 4ZUXU 3T7LA 3KDEC 5EWHA 5E0RA 4QEVA 2RNXA 5D3HA 5E73A 4YYMA 3U5LA 2Y1MA 3Q2EA 5CU8A 4UYEA 4A9JA 4CUSA 1WEVA 4LLBA 5CRMA 2RI7A 1N72A 3SHBA 3UV2A 3FEHA 5CPEA 2XEUA 4TTEA 3RCWA 5E3DA 4HXOA 3LJUX 1JM7A 2KWKA 2XP0A 2MA5A 5DW2A 5I29A 4B7YC 4TYLA 5HEMA 2XB1A 3U5NA 5L99A 3N9QA 5DYUA 5KH7A 4LR6A 5CS8A 4WZ3B 3DWYA 3MULA 4S3OB 4Z93A 5CUCA 4QNSA 2LXHC 3M62A 2YUCA 3D1DA 5D3NA 5FDZA 5FE0A 2VPEA 1U6GB 4UYFB 5EWCA 4UYGA 4QZSA 3FANA 1WFKA 2I50A 4Z0OA 4O7CA 2EGPA 2RO1A 4O62A 2KYUA 2LDRA 4O75A 4UYHA 5ETDA 4Z1QA 3O36A 5KHMA 2MD7B 5SVXA 3H7HA 5ENGA 5DFBA 3P1CA 3FM8C 4AKGA 5A5RA 2E6RA 3JVMA 2KU3A 4YATA 1X4JA 4O78A 4HXNA 3IHPA 4BBQA 4QY4A 4YH3A 5F5ZA 5H9MA 5LJ1A 4W4UA 5SVIA 2DKWA 2YYNA 4YYDA 2KGGA 3N9PA 5C13A 4MR6A 4NQNA 1WEPA 3HCTA 3UV4A 4HXRA 4NRBA 4LC2A 5HLSA 2F42A 4UIYA 2MD8C 4IR6A 2AN6A 3ZPV1 5L97A 5EICA 5EPRA 2JMDA 4QYLA 4MSXA 5B79A 2RFJA 5A81A 2YQDA 4QUUA 4YY6A 1FBVA 2D8UA 2YT5A 3EB6A 2CRWA 3GL6A 2WP2A 4KV1A 4NUEA 3HMEA 2CSZA 5HRXA 3Q1DA 2VJFA 2OUOA 2YELA 2CKLB 5EM3A 1WGMA 4BW1A 4R7EA 5II1A 5FFYA 5FG4A 4O7AA 2OO1A 3O47A 2IQJA 5G04B 3D7CA 2DJAA 4NR6A 2G45A 2FUUA 4FJCA 4H9DA 4QR3A 4O64A 2VPDA 5LJ2A 2I8NA 5LUUA 4I7DA 5K3QA 5D25A 4ALHA 5EI4A 5FH6A 4C67A 2YHOA 4A9HA 5KTUA 5BT4A 5ETBA 3FAOA 4LKAA 5DKHA 3SVHA 1E4UA 2LSPB 4NR7A 2RNWA 2LGLA 2H60A 3MXFA 5AD3A 1MM2A 3JVJA 5FB1A 5F63A 4BW4A 2XOYA 5HFRA 2MKEA 1LDJB 3HMHA 5A83A 5I80A 4Q0OA 5F60A 2EGMA 4XY9A 3AADA 4Z6IA 4LDFA 5A5QA 3LRQA 4L7XA 3N9OA 2UZGA 5DYAA 5FG5A 2M85A 4O77A 4UIWA 4NYWA 5CRZA 1WIMA 4PS5A 1LDKC 4L58A 1MBMA 5LKXA 2EJNA 4MR3A 4Q6FA 1PUOA 4QSPA 5F3AA 2ECIA 4A4CA 5C11A 2BAYA 3PHDA 5C7NA 2QIZA 5JG6A 4YBMA 3SOWA 5FE1A 2YYRA 4PTBA 4A0CD 1X4UA 2L84A 2M1RA 3P5OA 5II2A 4YABA 4YBTA 2B0OE 5CTLA 4QR5A 2HYED 5I7YA 3RTRB 4YYKA 2VJEA 4MVTA 1WEOA 4MEOA 2L7PA 4X2IA 2IDAA 4UIVA 5A5NA 5H85A 4TT6A 2M3HA 5IGKA 4NXJA 3IU5A 4QSUA 4CCGX 3LXJA 1WE9A 2JUNA 2E6SA 5HQ5A 1WEUA 5C85A 1WILA 5D1LB 2YDWA 5H1TA 4YC9A 2MNZA 3MUKA 1DCQA 4PKLA 3ONIA 4HXKA 4TS8A 5TB6A 5J0DA 4LYSA 1EQFA 5KTXA 4HXPA 2MA6A 2MNYA 4I7BA 4MR5A 4NR4A 5HFQA 4YYIA 2H0DB 4NN2A 5DKCA 3UVDA 2KWNA 3FJUB 2MIQA 3DPLR 4PY6A 1F68A 5TRBA 2PNXA 5C87A 2MJVB 5AD2A 5HQ6A 2YQMA 3PUQA 2KFTA 5DY7A 3L1XA 3FL2A 5D7XA 4FO9A 1WEWA 2LAUA 5IBNA 4QC1A 5L8UA 5D3RA 1Z6UA 2DVRA 4YYGA 1VD4A 4AP4A 2G6QA 2YEMA 2LXPC 4AKNA 3MHSA 3PLWA 4PPEA 4TT4A 4LYIA 2FFWA 2GRCA 4UP5A 2NAAA 5ENCA 4HBVA 5ENFA 4QSRA 5EWWA 3DQVR 4LK9A 4O7BA 3RPGC 3HMFA 3NXBA 5CUGA 5EQ1A 5EWVA 3S91A 1V87A 2ECTA 5AMFA 4UIXA 4OGCA 2G43A 3LVRE 5KU3A 4GNFA 4LADB 5B78A 5A5PA 5E9MA 5EPBA 1N87A 3MHHA 2ECJA 3KV5A 5CUBA 2KR4A 4GNDA 5E9VA 5EP7A 2CKLA 3D1BA 1XWHA 4QEUA 5D3PA 2CT2A 3I3JA 4I7CA 3O35A 3QZTA 2QICA 1JM7B 5D24A 4XUAA 5L98A 3VKHA 2DVSA 4BW2A 1T1HA 5D0CA 2L80A 3C6WA 2R0SA 5I86A 3HCSA 4QQ4A 5F2PA 2VPBA 2RNYA 3U5PA 2KE1A 2LN0A 2YU4A 5KH3A 2YSMA 2EODA 3MB4A 5I88A 2ECWA 2OSSA 4GB0A 5EPSA 2ECNA 4NYVA 2FD4A 4IR3A 4F1PA 2DVQA 5CQ3A 4YK0A 3JVKA 4BHWA 5FH8A 3JVLA 2DSMA 5BT3A 1ZKRA 5FEYA 3I2DA 3ZTGA 4NRAA 3QZSA 4QC3A 3UVWA 4ZW1A 2MUMA 2JMIA 4CFLA 5IGNA 2L0BA 2P57A 3PURA 4UIUA 3GV4A 4OGEA 5E74A 3V43A 5IGMA 3KV6A 1RMDA 4MEPA 5FE8A 5EV9A 5HELA 5C8GA 5FE3A 5HENA 2K16A 5EVAA 4FK5A 2E7OA 4ZQLA 2M13A 3VKGA 3L1ZB 4N4IA 3M99A 5HCLA 3NG2A 3L11A 4X3GA 5CQ8A 5FE4A 3UV5A 4QUTA 4Z1SA 2KIZA 2R0YA 1ZS5A 2JM3A 3M7KA 5COIA 5I7XA 3UVXA 3U5JA 4Z6HA 4NUCA 3N9LA 4MR4A 1WENA 5IGLA 1HYIA 3C5KA 2RS9B 4OUFA 5IIDA 4YYNA 4HXSA 4IOOA 4XUBA 4DONA 2YQLA 3P1FA 4YYJA 4O76A 5FE7A 2M6MA 5E9IA 5DYCA 5D1KB 3KQIA 4CLBA 4LYWA 3SVFA 5E9KA 5F62A 5DINA 3DWDA 5IG6A 5F25A 4HBYA 5EGUA 5FB0A 4YAXA 2VJFB 4UI9B 5B76A 4R8PK 5EWDA 5FE5A 4AYCA 4MENA 4AI6A 4OGIA 3M63A 3SVGA 4OGJA 5F36A 1WEMA 4TKPB 5A5SA 4WIVA 4C9ZA 2E3KA 2QJ0A 4J0RA 5JWMA 5B77A 1JSPB 3P1DA 4KV4A 2KKXA 5TCMA 2LV9A 2VP7A 4NR5A 5HJCA 2HDPA 3LQIA 3MQMA 4J3IA 4V3KC 5DYXA 3LQJA 4LZ2A 3LDYA 4IR5A 4QB3A 3T6RA 3P1EA 4ZC9A 4UITA 4CUTA 4GNEA 4GPJA 3LQHA 2YW8A 5E7DA 3O70A 2DVVA 4F3IA 5TDWA 1WEEA 4MEQA 4HBWA 4A9MA 3SUBA 2K17A 4KCXA 3U5MA 2MT5A 4IC2A 5CQ6A 4UYFA 5BT5A 4AKHA 5F1LA 4YBSA 2DX8A 4A9LA 4GNGA 4J0SA 4A9KA 4N4GA 2JRJA 4S3OC 4IR4A 5EU1A 2YW5A 4WHUA 5F61A 1G25A 5L96A 5FH7A 2L75A 3LVQE 4A9OA 4NYXA 2EXUA 5TBNA 5DBMA 5ACYA 2ECVA 2NXBA 5D3TA 2KTBB 5ENBA 2VPGA 5KTWA 2VJEB 5JI8A 2YREA 5D1MB 4O71A 4O74A 5CGPA 3EB5A 3ASLA 4HXLA 4J1PA 1ZBDB 2R0VA 1VYXA 4A9FA 4TU6A 4XY8A 5TABA 5TDRA 5D26A 2LRIC 2DATA 3U5KA 1Z60A 3T9KA 5DX4A 2OXQC 1F62A 2LGGA 3ZVZB 4PCEA 4QEWA 4IOQA 5D3LA 4AVXA 5CUDA 5FE2A 1FP0A 5B8DA 4WZ0A 2CRRA 5AITA 2JMJA 4QSQA 5CP5A 5E9YA 5FFWA 1VFYA 4A4BA 5A85A 2Y43A 2VNFA 3UVYA 3O37A 2OWAA 5DKAA 4YY4A 5DKDA 5H1VA 5H1UA 4NQMA 5E3GA 2CONA 2XOCA 4QSSA 5EK9A 4Q0NA 5CQTA 5CZGA 3N9MA 4CUUA 1IYMA 4XYAA 2KWOA 1HYJA 3FKMX 5EA1A 2F6NA 5G0FA 2LGVA 3GG3A 3DAIA 3S92A 4A9EA 3VK6A 2KGIA 5G4RA 2FUIA 5CQ4A 5E9LA 4UIZA 5FE6A 2KREA 2YHNA 5FFVA 4IORA 5HM0A 3MB3A 5CQAA 5I83A 3RPGB 2ECGA 4QSVA 3N9NA 4Z0RA 5DW1A 4F52B 5ENHA 3IU6A 5ENIA 4N4HA 5LVQA 2PUYA 4ALGA 1MM3A 3Q2FA 5FE9A 5AIUA 2DWWA 3ERRA 2CSYA 5DFCA 5KH9A 5HQ7A 2C2VS 3ZNIA 4NUDA 4TU4A 5F1HA 5LKTA 2EA6A 4R2YA 4CA1A 4WA6A 5LJ0A 5CQ7A 4O72A 4N4FA 4TT2A 4QSTA 2XOZA 5CUEA 4E96A 4N3WA 5K29A 4A9IA 4TZ8A 5DLZA 4YYHA 4QBMA 3TLPA 3ZYUA 5FG6A 5I89A 3SOUA 3JUEA 4IC3A 2E61A 5LVRA 2Y1NA 2L5UA 2F6JA 4PCIA 5SVIB 3E2DA 4A49A 5LKUA 5I40A 3DDTA 1Z2QA 3KNVA 5CY9A 1BORA 1CHCA 1DVPA 4P5OB 2RR4A 1JOCA 5CFWA 2ZETC 4QSWA 3MDBC 3O7AA 5D3JA 4BJXA 3ZYQA 3AQAA 5B75A 4FLPA 5CQ5A 3HTKC 2YSJA 3U5OA 4HXMA 2D8SA 4CFKA 2C2LA 4CUQA 2YVRA 5DLXA 5EYAF 5HRWA 4YADA 5A82A 5FBXA 4A9NA 4CURA 2R10A 4TQNA 5G4SA 5CUAA 4QR4A 5A7CA 4HBXA 5J3XA 4QSXA 5ENEA 2WP1A 4O7FA 4UP0A 4WZ2A 1K2FA 3SOXA 4NS5A 2CSVA
chains in the Genus database with same CATH topology
4NRCA 4RVRA 2K4DA 4QF2A 4ZDTA 4YH4A 5LKZA 3O34A 4XI1A 4WHWA 5FERA 2H0DA 2K1JA 5I1QA 3UW9A 4FIPA 4B86C 3G0JA 1WESA 1WUMA 5G05B 5ENJA 2YEKA 3QZVA 2D9EA 4V3LC 3HCUA 1WUGA 1X0JA 4Y03A 1WEQA 2G4AA 1X4IA 3K2JA 5EISA 5C89A 2FSAA 2RSDA 2LGKA 2YURA 4LRGA 5I3LA 4NR9A 4LJNA 2I7KA 4TZ2A 2LQ6A 4LZRA 2L5EA 3ZVYA 5A5OA 2N9GA 4CUPA 2L85A 4QYDA 5D3SA 5AMEA 5HRVA 4CL9A 4UYDA 4QF3A 5L8TA 2L43A 5LCWB 3ZPVE 5KO4A 4O7EA 4AYCB 4BW3A 2E7NA 4O70A 4AUQB 2KWJA 3G0LA 4NR8A 3LJWA 1E6IA 4LZSA 5C4QA 1JM4B 3O33A 5DFDA 4C66A 2D82A 4ZUXU 3T7LA 5EWHA 5E0RA 4QEVA 2RNXA 5D3HA 5E73A 4YYMA 3U5LA 2Y1MA 3Q2EA 5CU8A 4UYEA 4A9JA 4CUSA 1WEVA 4LLBA 5CRMA 2RI7A 1N72A 3SHBA 3UV2A 5CPEA 2XEUA 4TTEA 3RCWA 5E3DA 4HXOA 1JM7A 2KWKA 2MA5A 5DW2A 5I29A 4B7YC 4TYLA 5HEMA 2XB1A 3U5NA 5L99A 3N9QA 5DYUA 5KH7A 4LR6A 5CS8A 4WZ3B 3DWYA 3MULA 4S3OB 4Z93A 5CUCA 4QNSA 2LXHC 3M62A 2YUCA 5D3NA 5FDZA 5FE0A 2VPEA 1U6GB 4UYFB 5EWCA 4UYGA 4QZSA 1WFKA 2I50A 4O7CA 2EGPA 2RO1A 2KYUA 2LDRA 4O75A 4UYHA 5ETDA 4Z1QA 3O36A 5KHMA 2MD7B 5ENGA 5DFBA 3P1CA 2E6RA 5A5RA 2KU3A 3JVMA 4YATA 1X4JA 4O78A 4HXNA 3IHPA 4BBQA 4QY4A 4YH3A 5F5ZA 5H9MA 5LJ1A 4W4UA 2DKWA 2YYNA 4YYDA 2KGGA 3N9PA 5C13A 4MR6A 4NQNA 1WEPA 3HCTA 3UV4A 4HXRA 4NRBA 4LC2A 5HLSA 2F42A 4UIYA 2MD8C 4IR6A 2AN6A 3ZPV1 5L97A 5EICA 5EPRA 2JMDA 4QYLA 4MSXA 5B79A 2RFJA 5A81A 2YQDA 4QUUA 4YY6A 1FBVA 2YT5A 3EB6A 3GL6A 2WP2A 4KV1A 4NUEA 3HMEA 2CSZA 5HRXA 2VJFA 2OUOA 2YELA 2CKLB 5EM3A 1WGMA 4BW1A 4R7EA 5II1A 5FFYA 5FG4A 4O7AA 2OO1A 5G04B 3D7CA 2G45A 4NR6A 4FJCA 2FUUA 4QR3A 4O64A 2VPDA 5LJ2A 2I8NA 5LUUA 4I7DA 5D25A 4ALHA 5EI4A 5FH6A 4C67A 2YHOA 4A9HA 5KTUA 5BT4A 5ETBA 4LKAA 5DKHA 3SVHA 1E4UA 2LSPB 4NR7A 2RNWA 2LGLA 2H60A 3MXFA 5AD3A 1MM2A 3JVJA 5FB1A 5F63A 4BW4A 5HFRA 1LDJB 3HMHA 5A83A 5I80A 4Q0OA 5F60A 4XY9A 3AADA 4Z6IA 4LDFA 5A5QA 3LRQA 4L7XA 3N9OA 2UZGA 5DYAA 5FG5A 2M85A 4O77A 4UIWA 4NYWA 5CRZA 1WIMA 4PS5A 1LDKC 4L58A 5LKXA 4MR3A 4Q6FA 4QSPA 5F3AA 2ECIA 4A4CA 5C11A 2BAYA 3PHDA 5C7NA 2QIZA 5JG6A 4YBMA 3SOWA 5FE1A 2YYRA 4PTBA 4A0CD 1X4UA 2L84A 2M1RA 3P5OA 5II2A 4YABA 4YBTA 5CTLA 4QR5A 2HYED 5I7YA 3RTRB 4YYKA 2VJEA 4MVTA 1WEOA 4MEOA 4X2IA 2IDAA 4UIVA 5A5NA 5H85A 4TT6A 2M3HA 5IGKA 4NXJA 3IU5A 4QSUA 4CCGX 3LXJA 1WE9A 2E6SA 5HQ5A 1WEUA 5C85A 1WILA 5D1LB 2YDWA 5H1TA 4YC9A 2MNZA 3MUKA 4PKLA 3ONIA 4HXKA 4TS8A 5TB6A 5J0DA 4LYSA 1EQFA 5KTXA 4HXPA 2MA6A 2MNYA 4I7BA 4MR5A 4NR4A 5HFQA 4YYIA 2H0DB 4NN2A 5DKCA 3UVDA 2KWNA 2MIQA 3DPLR 4PY6A 1F68A 5TRBA 2PNXA 5C87A 2MJVB 5AD2A 5HQ6A 2YQMA 3PUQA 2KFTA 5DY7A 3L1XA 3FL2A 5D7XA 4FO9A 1WEWA 5IBNA 4QC1A 5L8UA 5D3RA 1Z6UA 2DVRA 4YYGA 1VD4A 4AP4A 2G6QA 2YEMA 2LXPC 4AKNA 3MHSA 4PPEA 4TT4A 4LYIA 2GRCA 4UP5A 2NAAA 5ENCA 4HBVA 5ENFA 4QSRA 5EWWA 3DQVR 4LK9A 4O7BA 3RPGC 3HMFA 3NXBA 5CUGA 5EQ1A 5EWVA 3S91A 1V87A 2ECTA 5AMFA 4UIXA 2G43A 5KU3A 4GNFA 4LADB 5B78A 5A5PA 5E9MA 5EPBA 1N87A 3MHHA 2ECJA 3KV5A 5CUBA 2KR4A 4GNDA 5E9VA 5EP7A 2CKLA 1XWHA 4QEUA 5D3PA 2CT2A 3I3JA 4I7CA 3O35A 3QZTA 2QICA 1JM7B 5D24A 4XUAA 5L98A 1T1HA 2DVSA 4BW2A 2L80A 5D0CA 3C6WA 3HCSA 2R0SA 5I86A 5F2PA 2VPBA 2RNYA 3U5PA 2KE1A 2LN0A 2YU4A 5KH3A 2YSMA 2EODA 3MB4A 5I88A 2ECWA 2OSSA 4GB0A 5EPSA 2ECNA 4NYVA 4IR3A 2DVQA 5CQ3A 4YK0A 3JVKA 4BHWA 5FH8A 3JVLA 5BT3A 3ZTGA 5FEYA 3I2DA 4NRAA 3QZSA 4QC3A 3UVWA 4ZW1A 2MUMA 2JMIA 4CFLA 5IGNA 2L0BA 3PURA 4UIUA 3GV4A 5E74A 3V43A 5IGMA 3KV6A 1RMDA 4MEPA 5FE8A 5EV9A 5HELA 5C8GA 5FE3A 5HENA 2K16A 5EVAA 4FK5A 2E7OA 4ZQLA 3L1ZB 3M99A 4N4IA 5HCLA 3NG2A 3L11A 4X3GA 5CQ8A 5FE4A 3UV5A 4QUTA 4Z1SA 2KIZA 2R0YA 1ZS5A 5COIA 5I7XA 3UVXA 3U5JA 4Z6HA 4NUCA 3N9LA 4MR4A 1WENA 5IGLA 1HYIA 3C5KA 2RS9B 4OUFA 5IIDA 4YYNA 4HXSA 4IOOA 4XUBA 4DONA 2YQLA 3P1FA 4YYJA 4O76A 5FE7A 2M6MA 5E9IA 5DYCA 5D1KB 3KQIA 4CLBA 4LYWA 3SVFA 5E9KA 5F62A 5DINA 5IG6A 5F25A 4HBYA 5EGUA 5FB0A 4YAXA 2VJFB 4UI9B 5B76A 4R8PK 5EWDA 5FE5A 4AYCA 4MENA 4OGIA 3M63A 3SVGA 4OGJA 5F36A 1WEMA 4TKPB 5A5SA 4WIVA 4C9ZA 2E3KA 2QJ0A 4J0RA 5JWMA 5B77A 1JSPB 3P1DA 4KV4A 2LV9A 5TCMA 2VP7A 4NR5A 5HJCA 2HDPA 3LQIA 3MQMA 4J3IA 4V3KC 5DYXA 3LQJA 4LZ2A 4IR5A 4QB3A 3T6RA 3P1EA 4ZC9A 4UITA 4CUTA 4GNEA 4GPJA 3LQHA 2YW8A 5E7DA 3O70A 2DVVA 4F3IA 5TDWA 1WEEA 4MEQA 4HBWA 4A9MA 2K17A 4KCXA 3U5MA 2MT5A 4IC2A 5CQ6A 4UYFA 5BT5A 2DX8A 5F1LA 4YBSA 4A9LA 4GNGA 4J0SA 4A9KA 4N4GA 2JRJA 4S3OC 4IR4A 5EU1A 2YW5A 4WHUA 5F61A 1G25A 5L96A 5FH7A 2L75A 4A9OA 4NYXA 5TBNA 5DBMA 5ACYA 2ECVA 2NXBA 5D3TA 2KTBB 5ENBA 2VPGA 5KTWA 2VJEB 5JI8A 2YREA 5D1MB 4O71A 4O74A 5CGPA 3EB5A 3ASLA 4HXLA 4J1PA 1ZBDB 2R0VA 1VYXA 4A9FA 4TU6A 4XY8A 5TABA 5TDRA 5D26A 2LRIC 2DATA 3U5KA 1Z60A 5DX4A 2OXQC 1F62A 2LGGA 3ZVZB 4PCEA 4QEWA 4IOQA 5D3LA 4AVXA 5CUDA 5FE2A 1FP0A 5B8DA 4WZ0A 5AITA 2JMJA 4QSQA 5CP5A 5E9YA 5FFWA 1VFYA 4A4BA 5A85A 2Y43A 2VNFA 3UVYA 3O37A 5DKAA 4YY4A 5DKDA 5H1VA 5H1UA 4NQMA 5E3GA 4QSSA 5EK9A 4Q0NA 5CQTA 5CZGA 3N9MA 4CUUA 1IYMA 4XYAA 2KWOA 1HYJA 3FKMX 5EA1A 2F6NA 5G0FA 2LGVA 3GG3A 3DAIA 3S92A 4A9EA 3VK6A 2KGIA 5G4RA 2FUIA 5CQ4A 5E9LA 4UIZA 5FE6A 2KREA 2YHNA 5FFVA 4IORA 5HM0A 3MB3A 5CQAA 5I83A 3RPGB 2ECGA 4QSVA 3N9NA 5DW1A 4F52B 5ENHA 3IU6A 5ENIA 4N4HA 5LVQA 2PUYA 4ALGA 1MM3A 3Q2FA 5FE9A 5AIUA 2DWWA 2CSYA 5DFCA 5KH9A 5HQ7A 2C2VS 3ZNIA 4NUDA 4TU4A 5F1HA 5LKTA 2EA6A 4R2YA 4CA1A 4WA6A 5LJ0A 5CQ7A 4O72A 4N4FA 4TT2A 4QSTA 5CUEA 4E96A 4N3WA 5K29A 4A9IA 4TZ8A 5DLZA 4YYHA 4QBMA 3TLPA 3ZYUA 5FG6A 5I89A 3SOUA 4IC3A 5LVRA 2Y1NA 2L5UA 2F6JA 4PCIA 4A49A 5LKUA 5I40A 1Z2QA 3KNVA 5CY9A 1BORA 1CHCA 1DVPA 4P5OB 1JOCA 5CFWA 2ZETC 4QSWA 3O7AA 3ZYQA 5D3JA 4BJXA 5B75A 3AQAA 4FLPA 5CQ5A 3HTKC 2YSJA 3U5OA 4HXMA 2D8SA 4CFKA 2C2LA 4CUQA 5DLXA 5EYAF 5HRWA 4YADA 5A82A 5FBXA 4A9NA 4CURA 2R10A 4TQNA 5G4SA 5CUAA 4QR4A 5A7CA 4HBXA 5J3XA 4QSXA 5ENEA 2WP1A 4O7FA 4UP0A 4WZ2A 1K2FA 3SOXA 4NS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRC A;  4RVR A;  2K4D A;  4QF2 A;  4ZDT A;  4YH4 A;  5LKZ A;  3O34 A;  4XI1 A;  4WHW A;  5FER A;  2H0D A;  2K1J A;  5I1Q A;  3UW9 A;  4FIP A;  4B86 C;  3G0J A;  1WES A;  1WUM A;  5G05 B;  5ENJ A;  2YEK A;  3QZV A;  2D9E A;  4V3L C;  3HCU A;  1WUG A;  1X0J A;  4Y03 A;  1WEQ A;  2G4A A;  1X4I A;  3K2J A;  5EIS A;  5C89 A;  2FSA A;  2RSD A;  2LGK A;  2YUR A;  4LRG A;  5I3L A;  4NR9 A;  4LJN A;  2I7K A;  4TZ2 A;  2LQ6 A;  4LZR A;  2L5E A;  3ZVY A;  5A5O A;  2N9G A;  4CUP A;  2L85 A;  4QYD A;  5D3S A;  5AME A;  5HRV A;  4CL9 A;  4UYD A;  4QF3 A;  5L8T A;  2L43 A;  5LCW B;  3ZPV E;  5KO4 A;  4O7E A;  4AYC B;  4BW3 A;  2E7N A;  4O70 A;  4AUQ B;  2KWJ A;  3G0L A;  4NR8 A;  3LJW A;  1E6I A;  4LZS A;  5C4Q A;  1JM4 B;  3O33 A;  5DFD A;  4C66 A;  2D82 A;  4ZUX U;  3T7L A;  5EWH A;  5E0R A;  4QEV A;  2RNX A;  5D3H A;  5E73 A;  4YYM A;  3U5L A;  2Y1M A;  3Q2E A;  5CU8 A;  4UYE A;  4A9J A;  4CUS A;  1WEV A;  4LLB A;  5CRM A;  2RI7 A;  1N72 A;  3SHB A;  3UV2 A;  5CPE A;  2XEU A;  4TTE A;  3RCW A;  5E3D A;  4HXO A;  1JM7 A;  2KWK A;  2MA5 A;  5DW2 A;  5I29 A;  4B7Y C;  4TYL A;  5HEM A;  2XB1 A;  3U5N A;  5L99 A;  3N9Q A;  5DYU A;  5KH7 A;  4LR6 A;  5CS8 A;  4WZ3 B;  3DWY A;  3MUL A;  4S3O B;  4Z93 A;  5CUC A;  4QNS A;  2LXH C;  3M62 A;  2YUC A;  5D3N A;  5FDZ A;  5FE0 A;  2VPE A;  1U6G B;  4UYF B;  5EWC A;  4UYG A;  4QZS A;  1WFK A;  2I50 A;  4O7C A;  2EGP A;  2RO1 A;  2KYU A;  2LDR A;  4O75 A;  4UYH A;  5ETD A;  4Z1Q A;  3O36 A;  5KHM A;  2MD7 B;  5ENG A;  5DFB A;  3P1C A;  2E6R A;  5A5R A;  2KU3 A;  3JVM A;  4YAT A;  1X4J A;  4O78 A;  4HXN A;  3IHP A;  4BBQ A;  4QY4 A;  4YH3 A;  5F5Z A;  5H9M A;  5LJ1 A;  4W4U A;  2DKW A;  2YYN A;  4YYD A;  2KGG A;  3N9P A;  5C13 A;  4MR6 A;  4NQN A;  1WEP A;  3HCT A;  3UV4 A;  4HXR A;  4NRB A;  4LC2 A;  5HLS A;  2F42 A;  4UIY A;  2MD8 C;  4IR6 A;  2AN6 A;  3ZPV 1;  5L97 A;  5EIC A;  5EPR A;  2JMD A;  4QYL A;  4MSX A;  5B79 A;  2RFJ A;  5A81 A;  2YQD A;  4QUU A;  4YY6 A;  1FBV A;  2YT5 A;  3EB6 A;  3GL6 A;  2WP2 A;  4KV1 A;  4NUE A;  3HME A;  2CSZ A;  5HRX A;  2VJF A;  2OUO A;  2YEL A;  2CKL B;  5EM3 A;  1WGM A;  4BW1 A;  4R7E A;  5II1 A;  5FFY A;  5FG4 A;  4O7A A;  2OO1 A;  5G04 B;  3D7C A;  2G45 A;  4NR6 A;  4FJC A;  2FUU A;  4QR3 A;  4O64 A;  2VPD A;  5LJ2 A;  2I8N A;  5LUU A;  4I7D A;  5D25 A;  4ALH A;  5EI4 A;  5FH6 A;  4C67 A;  2YHO A;  4A9H A;  5KTU A;  5BT4 A;  5ETB A;  4LKA A;  5DKH A;  3SVH A;  1E4U A;  2LSP B;  4NR7 A;  2RNW A;  2LGL A;  2H60 A;  3MXF A;  5AD3 A;  1MM2 A;  3JVJ A;  5FB1 A;  5F63 A;  4BW4 A;  5HFR A;  1LDJ B;  3HMH A;  5A83 A;  5I80 A;  4Q0O A;  5F60 A;  4XY9 A;  3AAD A;  4Z6I A;  4LDF A;  5A5Q A;  3LRQ A;  4L7X A;  3N9O A;  2UZG A;  5DYA A;  5FG5 A;  2M85 A;  4O77 A;  4UIW A;  4NYW A;  5CRZ A;  1WIM A;  4PS5 A;  1LDK C;  4L58 A;  5LKX A;  4MR3 A;  4Q6F A;  4QSP A;  5F3A A;  2ECI A;  4A4C A;  5C11 A;  2BAY A;  3PHD A;  5C7N A;  2QIZ A;  5JG6 A;  4YBM A;  3SOW A;  5FE1 A;  2YYR A;  4PTB A;  4A0C D;  1X4U A;  2L84 A;  2M1R A;  3P5O A;  5II2 A;  4YAB A;  4YBT A;  5CTL A;  4QR5 A;  2HYE D;  5I7Y A;  3RTR B;  4YYK A;  2VJE A;  4MVT A;  1WEO A;  4MEO A;  4X2I A;  2IDA A;  4UIV A;  5A5N A;  5H85 A;  4TT6 A;  2M3H A;  5IGK A;  4NXJ A;  3IU5 A;  4QSU A;  4CCG X;  3LXJ A;  1WE9 A;  2E6S A;  5HQ5 A;  1WEU A;  5C85 A;  1WIL A;  5D1L B;  2YDW A;  5H1T A;  4YC9 A;  2MNZ A;  3MUK A;  4PKL A;  3ONI A;  4HXK A;  4TS8 A;  5TB6 A;  5J0D A;  4LYS A;  1EQF A;  5KTX A;  4HXP A;  2MA6 A;  2MNY A;  4I7B A;  4MR5 A;  4NR4 A;  5HFQ A;  4YYI A;  2H0D B;  4NN2 A;  5DKC A;  3UVD A;  2KWN A;  2MIQ A;  3DPL R;  4PY6 A;  1F68 A;  5TRB A;  2PNX A;  5C87 A;  2MJV B;  5AD2 A;  5HQ6 A;  2YQM A;  3PUQ A;  2KFT A;  5DY7 A;  3L1X A;  3FL2 A;  5D7X A;  4FO9 A;  1WEW A;  5IBN A;  4QC1 A;  5L8U A;  5D3R A;  1Z6U A;  2DVR A;  4YYG A;  1VD4 A;  4AP4 A;  2G6Q A;  2YEM A;  2LXP C;  4AKN A;  3MHS A;  4PPE A;  4TT4 A;  4LYI A;  2GRC A;  4UP5 A;  2NAA A;  5ENC A;  4HBV A;  5ENF A;  4QSR A;  5EWW A;  3DQV R;  4LK9 A;  4O7B A;  3RPG C;  3HMF A;  3NXB A;  5CUG A;  5EQ1 A;  5EWV A;  3S91 A;  1V87 A;  2ECT A;  5AMF A;  4UIX A;  2G43 A;  5KU3 A;  4GNF A;  4LAD B;  5B78 A;  5A5P A;  5E9M A;  5EPB A;  1N87 A;  3MHH A;  2ECJ A;  3KV5 A;  5CUB A;  2KR4 A;  4GND A;  5E9V A;  5EP7 A;  2CKL A;  1XWH A;  4QEU A;  5D3P A;  2CT2 A;  3I3J A;  4I7C A;  3O35 A;  3QZT A;  2QIC A;  1JM7 B;  5D24 A;  4XUA A;  5L98 A;  1T1H A;  2DVS A;  4BW2 A;  2L80 A;  5D0C A;  3C6W A;  3HCS A;  2R0S A;  5I86 A;  5F2P A;  2VPB A;  2RNY A;  3U5P A;  2KE1 A;  2LN0 A;  2YU4 A;  5KH3 A;  2YSM A;  2EOD A;  3MB4 A;  5I88 A;  2ECW A;  2OSS A;  4GB0 A;  5EPS A;  2ECN A;  4NYV A;  4IR3 A;  2DVQ A;  5CQ3 A;  4YK0 A;  3JVK A;  4BHW A;  5FH8 A;  3JVL A;  5BT3 A;  3ZTG A;  5FEY A;  3I2D A;  4NRA A;  3QZS A;  4QC3 A;  3UVW A;  4ZW1 A;  2MUM A;  2JMI A;  4CFL A;  5IGN A;  2L0B A;  3PUR A;  4UIU A;  3GV4 A;  5E74 A;  3V43 A;  5IGM A;  3KV6 A;  1RMD A;  4MEP A;  5FE8 A;  5EV9 A;  5HEL A;  5C8G A;  5FE3 A;  5HEN A;  2K16 A;  5EVA A;  4FK5 A;  2E7O A;  4ZQL A;  3L1Z B;  3M99 A;  4N4I A;  5HCL A;  3NG2 A;  3L11 A;  4X3G A;  5CQ8 A;  5FE4 A;  3UV5 A;  4QUT A;  4Z1S A;  2KIZ A;  2R0Y A;  1ZS5 A;  5COI A;  5I7X A;  3UVX A;  3U5J A;  4Z6H A;  4NUC A;  3N9L A;  4MR4 A;  1WEN A;  5IGL A;  1HYI A;  3C5K A;  2RS9 B;  4OUF A;  5IID A;  4YYN A;  4HXS A;  4IOO A;  4XUB A;  4DON A;  2YQL A;  3P1F A;  4YYJ A;  4O76 A;  5FE7 A;  2M6M A;  5E9I A;  5DYC A;  5D1K B;  3KQI A;  4CLB A;  4LYW A;  3SVF A;  5E9K A;  5F62 A;  5DIN A;  5IG6 A;  5F25 A;  4HBY A;  5EGU A;  5FB0 A;  4YAX A;  2VJF B;  4UI9 B;  5B76 A;  4R8P K;  5EWD A;  5FE5 A;  4AYC A;  4MEN A;  4OGI A;  3M63 A;  3SVG A;  4OGJ A;  5F36 A;  1WEM A;  4TKP B;  5A5S A;  4WIV A;  4C9Z A;  2E3K A;  2QJ0 A;  4J0R A;  5JWM A;  5B77 A;  1JSP B;  3P1D A;  4KV4 A;  2LV9 A;  5TCM A;  2VP7 A;  4NR5 A;  5HJC A;  2HDP A;  3LQI A;  3MQM A;  4J3I A;  4V3K C;  5DYX A;  3LQJ A;  4LZ2 A;  4IR5 A;  4QB3 A;  3T6R A;  3P1E A;  4ZC9 A;  4UIT A;  4CUT A;  4GNE A;  4GPJ A;  3LQH A;  2YW8 A;  5E7D A;  3O70 A;  2DVV A;  4F3I A;  5TDW A;  1WEE A;  4MEQ A;  4HBW A;  4A9M A;  2K17 A;  4KCX A;  3U5M A;  2MT5 A;  4IC2 A;  5CQ6 A;  4UYF A;  5BT5 A;  2DX8 A;  5F1L A;  4YBS A;  4A9L A;  4GNG A;  4J0S A;  4A9K A;  4N4G A;  2JRJ A;  4S3O C;  4IR4 A;  5EU1 A;  2YW5 A;  4WHU A;  5F61 A;  1G25 A;  5L96 A;  5FH7 A;  2L75 A;  4A9O A;  4NYX A;  5TBN A;  5DBM A;  5ACY A;  2ECV A;  2NXB A;  5D3T A;  2KTB B;  5ENB A;  2VPG A;  5KTW A;  2VJE B;  5JI8 A;  2YRE A;  5D1M B;  4O71 A;  4O74 A;  5CGP A;  3EB5 A;  3ASL A;  4HXL A;  4J1P A;  1ZBD B;  2R0V A;  1VYX A;  4A9F A;  4TU6 A;  4XY8 A;  5TAB A;  5TDR A;  5D26 A;  2LRI C;  2DAT A;  3U5K A;  1Z60 A;  5DX4 A;  2OXQ C;  1F62 A;  2LGG A;  3ZVZ B;  4PCE A;  4QEW A;  4IOQ A;  5D3L A;  4AVX A;  5CUD A;  5FE2 A;  1FP0 A;  5B8D A;  4WZ0 A;  5AIT A;  2JMJ A;  4QSQ A;  5CP5 A;  5E9Y A;  5FFW A;  1VFY A;  4A4B A;  5A85 A;  2Y43 A;  2VNF A;  3UVY A;  3O37 A;  5DKA A;  4YY4 A;  5DKD A;  5H1V A;  5H1U A;  4NQM A;  5E3G A;  4QSS A;  5EK9 A;  4Q0N A;  5CQT A;  5CZG A;  3N9M A;  4CUU A;  1IYM A;  4XYA A;  2KWO A;  1HYJ A;  3FKM X;  5EA1 A;  2F6N A;  5G0F A;  2LGV A;  3GG3 A;  3DAI A;  3S92 A;  4A9E A;  3VK6 A;  2KGI A;  5G4R A;  2FUI A;  5CQ4 A;  5E9L A;  4UIZ A;  5FE6 A;  2KRE A;  2YHN A;  5FFV A;  4IOR A;  5HM0 A;  3MB3 A;  5CQA A;  5I83 A;  3RPG B;  2ECG A;  4QSV A;  3N9N A;  5DW1 A;  4F52 B;  5ENH A;  3IU6 A;  5ENI A;  4N4H A;  5LVQ A;  2PUY A;  4ALG A;  1MM3 A;  3Q2F A;  5FE9 A;  5AIU A;  2DWW A;  2CSY A;  5DFC A;  5KH9 A;  5HQ7 A;  2C2V S;  3ZNI A;  4NUD A;  4TU4 A;  5F1H A;  5LKT A;  2EA6 A;  4R2Y A;  4CA1 A;  4WA6 A;  5LJ0 A;  5CQ7 A;  4O72 A;  4N4F A;  4TT2 A;  4QST A;  5CUE A;  4E96 A;  4N3W A;  5K29 A;  4A9I A;  4TZ8 A;  5DLZ A;  4YYH A;  4QBM A;  3TLP A;  3ZYU A;  5FG6 A;  5I89 A;  3SOU A;  4IC3 A;  5LVR A;  2Y1N A;  2L5U A;  2F6J A;  4PCI A;  4A49 A;  5LKU A;  5I40 A;  1Z2Q A;  3KNV A;  5CY9 A;  1BOR A;  1CHC A;  1DVP A;  4P5O B;  1JOC A;  5CFW A;  2ZET C;  4QSW A;  3O7A A;  3ZYQ A;  5D3J A;  4BJX A;  5B75 A;  3AQA A;  4FLP A;  5CQ5 A;  3HTK C;  2YSJ A;  3U5O A;  4HXM A;  2D8S A;  4CFK A;  2C2L A;  4CUQ A;  5DLX A;  5EYA F;  5HRW A;  4YAD A;  5A82 A;  5FBX A;  4A9N A;  4CUR A;  2R10 A;  4TQN A;  5G4S A;  5CUA A;  4QR4 A;  5A7C A;  4HBX A;  5J3X A;  4QSX A;  5ENE A;  2WP1 A;  4O7F A;  4UP0 A;  4WZ2 A;  1K2F A;  3SOX A;  4NS5 A; 
#chains in the Genus database with same CATH topology
 4NRC A;  4RVR A;  2K4D A;  4QF2 A;  4ZDT A;  4YH4 A;  5LKZ A;  3O34 A;  4XI1 A;  4WHW A;  5FER A;  2H0D A;  2K1J A;  5I1Q A;  3UW9 A;  4FIP A;  4B86 C;  3G0J A;  1WES A;  1WUM A;  5G05 B;  5ENJ A;  2YEK A;  3QZV A;  2D9E A;  4V3L C;  3HCU A;  1WUG A;  1X0J A;  4Y03 A;  5SVY A;  1WEQ A;  2G4A A;  1X4I A;  3K2J A;  2KKY A;  5EIS A;  5C89 A;  2FSA A;  2RSD A;  2LGK A;  2YUR A;  4LRG A;  5I3L A;  4NR9 A;  4LJN A;  2I7K A;  4TZ2 A;  2LQ6 A;  4LZR A;  2L5E A;  3ZVY A;  5A5O A;  2N9G A;  4CUP A;  2L85 A;  4QYD A;  5D3S A;  5AME A;  5HRV A;  4CL9 A;  4UYD A;  4QF3 A;  5L8T A;  2L43 A;  5LCW B;  3ZPV E;  5KO4 A;  4O7E A;  4AYC B;  4BW3 A;  2E7N A;  4O70 A;  4AUQ B;  2KWJ A;  3G0L A;  4NR8 A;  3LJW A;  1E6I A;  4LZS A;  5C4Q A;  1JM4 B;  3O33 A;  5DFD A;  4C66 A;  2D82 A;  4AKI A;  4ZUX U;  3T7L A;  3KDE C;  5EWH A;  5E0R A;  4QEV A;  2RNX A;  5D3H A;  5E73 A;  4YYM A;  3U5L A;  2Y1M A;  3Q2E A;  5CU8 A;  4UYE A;  4A9J A;  4CUS A;  1WEV A;  4LLB A;  5CRM A;  2RI7 A;  1N72 A;  3SHB A;  3UV2 A;  3FEH A;  5CPE A;  2XEU A;  4TTE A;  3RCW A;  5E3D A;  4HXO A;  3LJU X;  1JM7 A;  2KWK A;  2XP0 A;  2MA5 A;  5DW2 A;  5I29 A;  4B7Y C;  4TYL A;  5HEM A;  2XB1 A;  3U5N A;  5L99 A;  3N9Q A;  5DYU A;  5KH7 A;  4LR6 A;  5CS8 A;  4WZ3 B;  3DWY A;  3MUL A;  4S3O B;  4Z93 A;  5CUC A;  4QNS A;  2LXH C;  3M62 A;  2YUC A;  3D1D A;  5D3N A;  5FDZ A;  5FE0 A;  2VPE A;  1U6G B;  4UYF B;  5EWC A;  4UYG A;  4QZS A;  3FAN A;  1WFK A;  2I50 A;  4Z0O A;  4O7C A;  2EGP A;  2RO1 A;  4O62 A;  2KYU A;  2LDR A;  4O75 A;  4UYH A;  5ETD A;  4Z1Q A;  3O36 A;  5KHM A;  2MD7 B;  5SVX A;  3H7H A;  5ENG A;  5DFB A;  3P1C A;  3FM8 C;  4AKG A;  5A5R A;  2E6R A;  3JVM A;  2KU3 A;  4YAT A;  1X4J A;  4O78 A;  4HXN A;  3IHP A;  4BBQ A;  4QY4 A;  4YH3 A;  5F5Z A;  5H9M A;  5LJ1 A;  4W4U A;  5SVI A;  2DKW A;  2YYN A;  4YYD A;  2KGG A;  3N9P A;  5C13 A;  4MR6 A;  4NQN A;  1WEP A;  3HCT A;  3UV4 A;  4HXR A;  4NRB A;  4LC2 A;  5HLS A;  2F42 A;  4UIY A;  2MD8 C;  4IR6 A;  2AN6 A;  3ZPV 1;  5L97 A;  5EIC A;  5EPR A;  2JMD A;  4QYL A;  4MSX A;  5B79 A;  2RFJ A;  5A81 A;  2YQD A;  4QUU A;  4YY6 A;  1FBV A;  2D8U A;  2YT5 A;  3EB6 A;  2CRW A;  3GL6 A;  2WP2 A;  4KV1 A;  4NUE A;  3HME A;  2CSZ A;  5HRX A;  3Q1D A;  2VJF A;  2OUO A;  2YEL A;  2CKL B;  5EM3 A;  1WGM A;  4BW1 A;  4R7E A;  5II1 A;  5FFY A;  5FG4 A;  4O7A A;  2OO1 A;  3O47 A;  2IQJ A;  5G04 B;  3D7C A;  2DJA A;  4NR6 A;  2G45 A;  2FUU A;  4FJC A;  4H9D A;  4QR3 A;  4O64 A;  2VPD A;  5LJ2 A;  2I8N A;  5LUU A;  4I7D A;  5K3Q A;  5D25 A;  4ALH A;  5EI4 A;  5FH6 A;  4C67 A;  2YHO A;  4A9H A;  5KTU A;  5BT4 A;  5ETB A;  3FAO A;  4LKA A;  5DKH A;  3SVH A;  1E4U A;  2LSP B;  4NR7 A;  2RNW A;  2LGL A;  2H60 A;  3MXF A;  5AD3 A;  1MM2 A;  3JVJ A;  5FB1 A;  5F63 A;  4BW4 A;  2XOY A;  5HFR A;  2MKE A;  1LDJ B;  3HMH A;  5A83 A;  5I80 A;  4Q0O A;  5F60 A;  2EGM A;  4XY9 A;  3AAD A;  4Z6I A;  4LDF A;  5A5Q A;  3LRQ A;  4L7X A;  3N9O A;  2UZG A;  5DYA A;  5FG5 A;  2M85 A;  4O77 A;  4UIW A;  4NYW A;  5CRZ A;  1WIM A;  4PS5 A;  1LDK C;  4L58 A;  1MBM A;  5LKX A;  2EJN A;  4MR3 A;  4Q6F A;  1PUO A;  4QSP A;  5F3A A;  2ECI A;  4A4C A;  5C11 A;  2BAY A;  3PHD A;  5C7N A;  2QIZ A;  5JG6 A;  4YBM A;  3SOW A;  5FE1 A;  2YYR A;  4PTB A;  4A0C D;  1X4U A;  2L84 A;  2M1R A;  3P5O A;  5II2 A;  4YAB A;  4YBT A;  2B0O E;  5CTL A;  4QR5 A;  2HYE D;  5I7Y A;  3RTR B;  4YYK A;  2VJE A;  4MVT A;  1WEO A;  4MEO A;  2L7P A;  4X2I A;  2IDA A;  4UIV A;  5A5N A;  5H85 A;  4TT6 A;  2M3H A;  5IGK A;  4NXJ A;  3IU5 A;  4QSU A;  4CCG X;  3LXJ A;  1WE9 A;  2JUN A;  2E6S A;  5HQ5 A;  1WEU A;  5C85 A;  1WIL A;  5D1L B;  2YDW A;  5H1T A;  4YC9 A;  2MNZ A;  3MUK A;  1DCQ A;  4PKL A;  3ONI A;  4HXK A;  4TS8 A;  5TB6 A;  5J0D A;  4LYS A;  1EQF A;  5KTX A;  4HXP A;  2MA6 A;  2MNY A;  4I7B A;  4MR5 A;  4NR4 A;  5HFQ A;  4YYI A;  2H0D B;  4NN2 A;  5DKC A;  3UVD A;  2KWN A;  3FJU B;  2MIQ A;  3DPL R;  4PY6 A;  1F68 A;  5TRB A;  2PNX A;  5C87 A;  2MJV B;  5AD2 A;  5HQ6 A;  2YQM A;  3PUQ A;  2KFT A;  5DY7 A;  3L1X A;  3FL2 A;  5D7X A;  4FO9 A;  1WEW A;  2LAU A;  5IBN A;  4QC1 A;  5L8U A;  5D3R A;  1Z6U A;  2DVR A;  4YYG A;  1VD4 A;  4AP4 A;  2G6Q A;  2YEM A;  2LXP C;  4AKN A;  3MHS A;  3PLW A;  4PPE A;  4TT4 A;  4LYI A;  2FFW A;  2GRC A;  4UP5 A;  2NAA A;  5ENC A;  4HBV A;  5ENF A;  4QSR A;  5EWW A;  3DQV R;  4LK9 A;  4O7B A;  3RPG C;  3HMF A;  3NXB A;  5CUG A;  5EQ1 A;  5EWV A;  3S91 A;  1V87 A;  2ECT A;  5AMF A;  4UIX A;  4OGC A;  2G43 A;  3LVR E;  5KU3 A;  4GNF A;  4LAD B;  5B78 A;  5A5P A;  5E9M A;  5EPB A;  1N87 A;  3MHH A;  2ECJ A;  3KV5 A;  5CUB A;  2KR4 A;  4GND A;  5E9V A;  5EP7 A;  2CKL A;  3D1B A;  1XWH A;  4QEU A;  5D3P A;  2CT2 A;  3I3J A;  4I7C A;  3O35 A;  3QZT A;  2QIC A;  1JM7 B;  5D24 A;  4XUA A;  5L98 A;  3VKH A;  2DVS A;  4BW2 A;  1T1H A;  5D0C A;  2L80 A;  3C6W A;  2R0S A;  5I86 A;  3HCS A;  4QQ4 A;  5F2P A;  2VPB A;  2RNY A;  3U5P A;  2KE1 A;  2LN0 A;  2YU4 A;  5KH3 A;  2YSM A;  2EOD A;  3MB4 A;  5I88 A;  2ECW A;  2OSS A;  4GB0 A;  5EPS A;  2ECN A;  4NYV A;  2FD4 A;  4IR3 A;  4F1P A;  2DVQ A;  5CQ3 A;  4YK0 A;  3JVK A;  4BHW A;  5FH8 A;  3JVL A;  2DSM A;  5BT3 A;  1ZKR A;  5FEY A;  3I2D A;  3ZTG A;  4NRA A;  3QZS A;  4QC3 A;  3UVW A;  4ZW1 A;  2MUM A;  2JMI A;  4CFL A;  5IGN A;  2L0B A;  2P57 A;  3PUR A;  4UIU A;  3GV4 A;  4OGE A;  5E74 A;  3V43 A;  5IGM A;  3KV6 A;  1RMD A;  4MEP A;  5FE8 A;  5EV9 A;  5HEL A;  5C8G A;  5FE3 A;  5HEN A;  2K16 A;  5EVA A;  4FK5 A;  2E7O A;  4ZQL A;  2M13 A;  3VKG A;  3L1Z B;  4N4I A;  3M99 A;  5HCL A;  3NG2 A;  3L11 A;  4X3G A;  5CQ8 A;  5FE4 A;  3UV5 A;  4QUT A;  4Z1S A;  2KIZ A;  2R0Y A;  1ZS5 A;  2JM3 A;  3M7K A;  5COI A;  5I7X A;  3UVX A;  3U5J A;  4Z6H A;  4NUC A;  3N9L A;  4MR4 A;  1WEN A;  5IGL A;  1HYI A;  3C5K A;  2RS9 B;  4OUF A;  5IID A;  4YYN A;  4HXS A;  4IOO A;  4XUB A;  4DON A;  2YQL A;  3P1F A;  4YYJ A;  4O76 A;  5FE7 A;  2M6M A;  5E9I A;  5DYC A;  5D1K B;  3KQI A;  4CLB A;  4LYW A;  3SVF A;  5E9K A;  5F62 A;  5DIN A;  3DWD A;  5IG6 A;  5F25 A;  4HBY A;  5EGU A;  5FB0 A;  4YAX A;  2VJF B;  4UI9 B;  5B76 A;  4R8P K;  5EWD A;  5FE5 A;  4AYC A;  4MEN A;  4AI6 A;  4OGI A;  3M63 A;  3SVG A;  4OGJ A;  5F36 A;  1WEM A;  4TKP B;  5A5S A;  4WIV A;  4C9Z A;  2E3K A;  2QJ0 A;  4J0R A;  5JWM A;  5B77 A;  1JSP B;  3P1D A;  4KV4 A;  2KKX A;  5TCM A;  2LV9 A;  2VP7 A;  4NR5 A;  5HJC A;  2HDP A;  3LQI A;  3MQM A;  4J3I A;  4V3K C;  5DYX A;  3LQJ A;  4LZ2 A;  3LDY A;  4IR5 A;  4QB3 A;  3T6R A;  3P1E A;  4ZC9 A;  4UIT A;  4CUT A;  4GNE A;  4GPJ A;  3LQH A;  2YW8 A;  5E7D A;  3O70 A;  2DVV A;  4F3I A;  5TDW A;  1WEE A;  4MEQ A;  4HBW A;  4A9M A;  3SUB A;  2K17 A;  4KCX A;  3U5M A;  2MT5 A;  4IC2 A;  5CQ6 A;  4UYF A;  5BT5 A;  4AKH A;  5F1L A;  4YBS A;  2DX8 A;  4A9L A;  4GNG A;  4J0S A;  4A9K A;  4N4G A;  2JRJ A;  4S3O C;  4IR4 A;  5EU1 A;  2YW5 A;  4WHU A;  5F61 A;  1G25 A;  5L96 A;  5FH7 A;  2L75 A;  3LVQ E;  4A9O A;  4NYX A;  2EXU A;  5TBN A;  5DBM A;  5ACY A;  2ECV A;  2NXB A;  5D3T A;  2KTB B;  5ENB A;  2VPG A;  5KTW A;  2VJE B;  5JI8 A;  2YRE A;  5D1M B;  4O71 A;  4O74 A;  5CGP A;  3EB5 A;  3ASL A;  4HXL A;  4J1P A;  1ZBD B;  2R0V A;  1VYX A;  4A9F A;  4TU6 A;  4XY8 A;  5TAB A;  5TDR A;  5D26 A;  2LRI C;  2DAT A;  3U5K A;  1Z60 A;  3T9K A;  5DX4 A;  2OXQ C;  1F62 A;  2LGG A;  3ZVZ B;  4PCE A;  4QEW A;  4IOQ A;  5D3L A;  4AVX A;  5CUD A;  5FE2 A;  1FP0 A;  5B8D A;  4WZ0 A;  2CRR A;  5AIT A;  2JMJ A;  4QSQ A;  5CP5 A;  5E9Y A;  5FFW A;  1VFY A;  4A4B A;  5A85 A;  2Y43 A;  2VNF A;  3UVY A;  3O37 A;  2OWA A;  5DKA A;  4YY4 A;  5DKD A;  5H1V A;  5H1U A;  4NQM A;  5E3G A;  2CON A;  2XOC A;  4QSS A;  5EK9 A;  4Q0N A;  5CQT A;  5CZG A;  3N9M A;  4CUU A;  1IYM A;  4XYA A;  2KWO A;  1HYJ A;  3FKM X;  5EA1 A;  2F6N A;  5G0F A;  2LGV A;  3GG3 A;  3DAI A;  3S92 A;  4A9E A;  3VK6 A;  2KGI A;  5G4R A;  2FUI A;  5CQ4 A;  5E9L A;  4UIZ A;  5FE6 A;  2KRE A;  2YHN A;  5FFV A;  4IOR A;  5HM0 A;  3MB3 A;  5CQA A;  5I83 A;  3RPG B;  2ECG A;  4QSV A;  3N9N A;  4Z0R A;  5DW1 A;  4F52 B;  5ENH A;  3IU6 A;  5ENI A;  4N4H A;  5LVQ A;  2PUY A;  4ALG A;  1MM3 A;  3Q2F A;  5FE9 A;  5AIU A;  2DWW A;  3ERR A;  2CSY A;  5DFC A;  5KH9 A;  5HQ7 A;  2C2V S;  3ZNI A;  4NUD A;  4TU4 A;  5F1H A;  5LKT A;  2EA6 A;  4R2Y A;  4CA1 A;  4WA6 A;  5LJ0 A;  5CQ7 A;  4O72 A;  4N4F A;  4TT2 A;  4QST A;  2XOZ A;  5CUE A;  4E96 A;  4N3W A;  5K29 A;  4A9I A;  4TZ8 A;  5DLZ A;  4YYH A;  4QBM A;  3TLP A;  3ZYU A;  5FG6 A;  5I89 A;  3SOU A;  3JUE A;  4IC3 A;  2E61 A;  5LVR A;  2Y1N A;  2L5U A;  2F6J A;  4PCI A;  5SVI B;  3E2D A;  4A49 A;  5LKU A;  5I40 A;  3DDT A;  1Z2Q A;  3KNV A;  5CY9 A;  1BOR A;  1CHC A;  1DVP A;  4P5O B;  2RR4 A;  1JOC A;  5CFW A;  2ZET C;  4QSW A;  3MDB C;  3O7A A;  5D3J A;  4BJX A;  3ZYQ A;  3AQA A;  5B75 A;  4FLP A;  5CQ5 A;  3HTK C;  2YSJ A;  3U5O A;  4HXM A;  2D8S A;  4CFK A;  2C2L A;  4CUQ A;  2YVR A;  5DLX A;  5EYA F;  5HRW A;  4YAD A;  5A82 A;  5FBX A;  4A9N A;  4CUR A;  2R10 A;  4TQN A;  5G4S A;  5CUA A;  4QR4 A;  5A7C A;  4HBX A;  5J3X A;  4QSX A;  5ENE A;  2WP1 A;  4O7F A;  4UP0 A;  4WZ2 A;  1K2F A;  3SOX A;  4NS5 A;  2CSV A; 
#chains in the Genus database with same CATH homology
 4NRC A;  4RVR A;  2K4D A;  4QF2 A;  4ZDT A;  4YH4 A;  5LKZ A;  3O34 A;  4XI1 A;  4WHW A;  5FER A;  2H0D A;  2K1J A;  5I1Q A;  3UW9 A;  4FIP A;  4B86 C;  3G0J A;  1WES A;  1WUM A;  5G05 B;  5ENJ A;  2YEK A;  3QZV A;  2D9E A;  4V3L C;  3HCU A;  1WUG A;  1X0J A;  4Y03 A;  1WEQ A;  2G4A A;  1X4I A;  3K2J A;  5EIS A;  5C89 A;  2FSA A;  2RSD A;  2LGK A;  2YUR A;  4LRG A;  5I3L A;  4NR9 A;  4LJN A;  2I7K A;  4TZ2 A;  2LQ6 A;  4LZR A;  2L5E A;  3ZVY A;  5A5O A;  2N9G A;  4CUP A;  2L85 A;  4QYD A;  5D3S A;  5AME A;  5HRV A;  4CL9 A;  4UYD A;  4QF3 A;  5L8T A;  2L43 A;  5LCW B;  3ZPV E;  5KO4 A;  4O7E A;  4AYC B;  4BW3 A;  2E7N A;  4O70 A;  4AUQ B;  2KWJ A;  3G0L A;  4NR8 A;  3LJW A;  1E6I A;  4LZS A;  5C4Q A;  1JM4 B;  3O33 A;  5DFD A;  4C66 A;  2D82 A;  4ZUX U;  3T7L A;  5EWH A;  5E0R A;  4QEV A;  2RNX A;  5D3H A;  5E73 A;  4YYM A;  3U5L A;  2Y1M A;  3Q2E A;  5CU8 A;  4UYE A;  4A9J A;  4CUS A;  1WEV A;  4LLB A;  5CRM A;  2RI7 A;  1N72 A;  3SHB A;  3UV2 A;  5CPE A;  2XEU A;  4TTE A;  3RCW A;  5E3D A;  4HXO A;  1JM7 A;  2KWK A;  2MA5 A;  5DW2 A;  5I29 A;  4B7Y C;  4TYL A;  5HEM A;  2XB1 A;  3U5N A;  5L99 A;  3N9Q A;  5DYU A;  5KH7 A;  4LR6 A;  5CS8 A;  4WZ3 B;  3DWY A;  3MUL A;  4S3O B;  4Z93 A;  5CUC A;  4QNS A;  2LXH C;  3M62 A;  2YUC A;  5D3N A;  5FDZ A;  5FE0 A;  2VPE A;  1U6G B;  4UYF B;  5EWC A;  4UYG A;  4QZS A;  1WFK A;  2I50 A;  4O7C A;  2EGP A;  2RO1 A;  2KYU A;  2LDR A;  4O75 A;  4UYH A;  5ETD A;  4Z1Q A;  3O36 A;  5KHM A;  2MD7 B;  5ENG A;  5DFB A;  3P1C A;  2E6R A;  5A5R A;  2KU3 A;  3JVM A;  4YAT A;  1X4J A;  4O78 A;  4HXN A;  3IHP A;  4BBQ A;  4QY4 A;  4YH3 A;  5F5Z A;  5H9M A;  5LJ1 A;  4W4U A;  2DKW A;  2YYN A;  4YYD A;  2KGG A;  3N9P A;  5C13 A;  4MR6 A;  4NQN A;  1WEP A;  3HCT A;  3UV4 A;  4HXR A;  4NRB A;  4LC2 A;  5HLS A;  2F42 A;  4UIY A;  2MD8 C;  4IR6 A;  2AN6 A;  3ZPV 1;  5L97 A;  5EIC A;  5EPR A;  2JMD A;  4QYL A;  4MSX A;  5B79 A;  2RFJ A;  5A81 A;  2YQD A;  4QUU A;  4YY6 A;  1FBV A;  2YT5 A;  3EB6 A;  3GL6 A;  2WP2 A;  4KV1 A;  4NUE A;  3HME A;  2CSZ A;  5HRX A;  2VJF A;  2OUO A;  2YEL A;  2CKL B;  5EM3 A;  1WGM A;  4BW1 A;  4R7E A;  5II1 A;  5FFY A;  5FG4 A;  4O7A A;  2OO1 A;  5G04 B;  3D7C A;  2G45 A;  4NR6 A;  4FJC A;  2FUU A;  4QR3 A;  4O64 A;  2VPD A;  5LJ2 A;  2I8N A;  5LUU A;  4I7D A;  5D25 A;  4ALH A;  5EI4 A;  5FH6 A;  4C67 A;  2YHO A;  4A9H A;  5KTU A;  5BT4 A;  5ETB A;  4LKA A;  5DKH A;  3SVH A;  1E4U A;  2LSP B;  4NR7 A;  2RNW A;  2LGL A;  2H60 A;  3MXF A;  5AD3 A;  1MM2 A;  3JVJ A;  5FB1 A;  5F63 A;  4BW4 A;  5HFR A;  1LDJ B;  3HMH A;  5A83 A;  5I80 A;  4Q0O A;  5F60 A;  4XY9 A;  3AAD A;  4Z6I A;  4LDF A;  5A5Q A;  3LRQ A;  4L7X A;  3N9O A;  2UZG A;  5DYA A;  5FG5 A;  2M85 A;  4O77 A;  4UIW A;  4NYW A;  5CRZ A;  1WIM A;  4PS5 A;  1LDK C;  4L58 A;  5LKX A;  4MR3 A;  4Q6F A;  4QSP A;  5F3A A;  2ECI A;  4A4C A;  5C11 A;  2BAY A;  3PHD A;  5C7N A;  2QIZ A;  5JG6 A;  4YBM A;  3SOW A;  5FE1 A;  2YYR A;  4PTB A;  4A0C D;  1X4U A;  2L84 A;  2M1R A;  3P5O A;  5II2 A;  4YAB A;  4YBT A;  5CTL A;  4QR5 A;  2HYE D;  5I7Y A;  3RTR B;  4YYK A;  2VJE A;  4MVT A;  1WEO A;  4MEO A;  4X2I A;  2IDA A;  4UIV A;  5A5N A;  5H85 A;  4TT6 A;  2M3H A;  5IGK A;  4NXJ A;  3IU5 A;  4QSU A;  4CCG X;  3LXJ A;  1WE9 A;  2E6S A;  5HQ5 A;  1WEU A;  5C85 A;  1WIL A;  5D1L B;  2YDW A;  5H1T A;  4YC9 A;  2MNZ A;  3MUK A;  4PKL A;  3ONI A;  4HXK A;  4TS8 A;  5TB6 A;  5J0D A;  4LYS A;  1EQF A;  5KTX A;  4HXP A;  2MA6 A;  2MNY A;  4I7B A;  4MR5 A;  4NR4 A;  5HFQ A;  4YYI A;  2H0D B;  4NN2 A;  5DKC A;  3UVD A;  2KWN A;  2MIQ A;  3DPL R;  4PY6 A;  1F68 A;  5TRB A;  2PNX A;  5C87 A;  2MJV B;  5AD2 A;  5HQ6 A;  2YQM A;  3PUQ A;  2KFT A;  5DY7 A;  3L1X A;  3FL2 A;  5D7X A;  4FO9 A;  1WEW A;  5IBN A;  4QC1 A;  5L8U A;  5D3R A;  1Z6U A;  2DVR A;  4YYG A;  1VD4 A;  4AP4 A;  2G6Q A;  2YEM A;  2LXP C;  4AKN A;  3MHS A;  4PPE A;  4TT4 A;  4LYI A;  2GRC A;  4UP5 A;  2NAA A;  5ENC A;  4HBV A;  5ENF A;  4QSR A;  5EWW A;  3DQV R;  4LK9 A;  4O7B A;  3RPG C;  3HMF A;  3NXB A;  5CUG A;  5EQ1 A;  5EWV A;  3S91 A;  1V87 A;  2ECT A;  5AMF A;  4UIX A;  2G43 A;  5KU3 A;  4GNF A;  4LAD B;  5B78 A;  5A5P A;  5E9M A;  5EPB A;  1N87 A;  3MHH A;  2ECJ A;  3KV5 A;  5CUB A;  2KR4 A;  4GND A;  5E9V A;  5EP7 A;  2CKL A;  1XWH A;  4QEU A;  5D3P A;  2CT2 A;  3I3J A;  4I7C A;  3O35 A;  3QZT A;  2QIC A;  1JM7 B;  5D24 A;  4XUA A;  5L98 A;  1T1H A;  2DVS A;  4BW2 A;  2L80 A;  5D0C A;  3C6W A;  3HCS A;  2R0S A;  5I86 A;  5F2P A;  2VPB A;  2RNY A;  3U5P A;  2KE1 A;  2LN0 A;  2YU4 A;  5KH3 A;  2YSM A;  2EOD A;  3MB4 A;  5I88 A;  2ECW A;  2OSS A;  4GB0 A;  5EPS A;  2ECN A;  4NYV A;  4IR3 A;  2DVQ A;  5CQ3 A;  4YK0 A;  3JVK A;  4BHW A;  5FH8 A;  3JVL A;  5BT3 A;  3ZTG A;  5FEY A;  3I2D A;  4NRA A;  3QZS A;  4QC3 A;  3UVW A;  4ZW1 A;  2MUM A;  2JMI A;  4CFL A;  5IGN A;  2L0B A;  3PUR A;  4UIU A;  3GV4 A;  5E74 A;  3V43 A;  5IGM A;  3KV6 A;  1RMD A;  4MEP A;  5FE8 A;  5EV9 A;  5HEL A;  5C8G A;  5FE3 A;  5HEN A;  2K16 A;  5EVA A;  4FK5 A;  2E7O A;  4ZQL A;  3L1Z B;  3M99 A;  4N4I A;  5HCL A;  3NG2 A;  3L11 A;  4X3G A;  5CQ8 A;  5FE4 A;  3UV5 A;  4QUT A;  4Z1S A;  2KIZ A;  2R0Y A;  1ZS5 A;  5COI A;  5I7X A;  3UVX A;  3U5J A;  4Z6H A;  4NUC A;  3N9L A;  4MR4 A;  1WEN A;  5IGL A;  1HYI A;  3C5K A;  2RS9 B;  4OUF A;  5IID A;  4YYN A;  4HXS A;  4IOO A;  4XUB A;  4DON A;  2YQL A;  3P1F A;  4YYJ A;  4O76 A;  5FE7 A;  2M6M A;  5E9I A;  5DYC A;  5D1K B;  3KQI A;  4CLB A;  4LYW A;  3SVF A;  5E9K A;  5F62 A;  5DIN A;  5IG6 A;  5F25 A;  4HBY A;  5EGU A;  5FB0 A;  4YAX A;  2VJF B;  4UI9 B;  5B76 A;  4R8P K;  5EWD A;  5FE5 A;  4AYC A;  4MEN A;  4OGI A;  3M63 A;  3SVG A;  4OGJ A;  5F36 A;  1WEM A;  4TKP B;  5A5S A;  4WIV A;  4C9Z A;  2E3K A;  2QJ0 A;  4J0R A;  5JWM A;  5B77 A;  1JSP B;  3P1D A;  4KV4 A;  2LV9 A;  5TCM A;  2VP7 A;  4NR5 A;  5HJC A;  2HDP A;  3LQI A;  3MQM A;  4J3I A;  4V3K C;  5DYX A;  3LQJ A;  4LZ2 A;  4IR5 A;  4QB3 A;  3T6R A;  3P1E A;  4ZC9 A;  4UIT A;  4CUT A;  4GNE A;  4GPJ A;  3LQH A;  2YW8 A;  5E7D A;  3O70 A;  2DVV A;  4F3I A;  5TDW A;  1WEE A;  4MEQ A;  4HBW A;  4A9M A;  2K17 A;  4KCX A;  3U5M A;  2MT5 A;  4IC2 A;  5CQ6 A;  4UYF A;  5BT5 A;  2DX8 A;  5F1L A;  4YBS A;  4A9L A;  4GNG A;  4J0S A;  4A9K A;  4N4G A;  2JRJ A;  4S3O C;  4IR4 A;  5EU1 A;  2YW5 A;  4WHU A;  5F61 A;  1G25 A;  5L96 A;  5FH7 A;  2L75 A;  4A9O A;  4NYX A;  5TBN A;  5DBM A;  5ACY A;  2ECV A;  2NXB A;  5D3T A;  2KTB B;  5ENB A;  2VPG A;  5KTW A;  2VJE B;  5JI8 A;  2YRE A;  5D1M B;  4O71 A;  4O74 A;  5CGP A;  3EB5 A;  3ASL A;  4HXL A;  4J1P A;  1ZBD B;  2R0V A;  1VYX A;  4A9F A;  4TU6 A;  4XY8 A;  5TAB A;  5TDR A;  5D26 A;  2LRI C;  2DAT A;  3U5K A;  1Z60 A;  5DX4 A;  2OXQ C;  1F62 A;  2LGG A;  3ZVZ B;  4PCE A;  4QEW A;  4IOQ A;  5D3L A;  4AVX A;  5CUD A;  5FE2 A;  1FP0 A;  5B8D A;  4WZ0 A;  5AIT A;  2JMJ A;  4QSQ A;  5CP5 A;  5E9Y A;  5FFW A;  1VFY A;  4A4B A;  5A85 A;  2Y43 A;  2VNF A;  3UVY A;  3O37 A;  5DKA A;  4YY4 A;  5DKD A;  5H1V A;  5H1U A;  4NQM A;  5E3G A;  4QSS A;  5EK9 A;  4Q0N A;  5CQT A;  5CZG A;  3N9M A;  4CUU A;  1IYM A;  4XYA A;  2KWO A;  1HYJ A;  3FKM X;  5EA1 A;  2F6N A;  5G0F A;  2LGV A;  3GG3 A;  3DAI A;  3S92 A;  4A9E A;  3VK6 A;  2KGI A;  5G4R A;  2FUI A;  5CQ4 A;  5E9L A;  4UIZ A;  5FE6 A;  2KRE A;  2YHN A;  5FFV A;  4IOR A;  5HM0 A;  3MB3 A;  5CQA A;  5I83 A;  3RPG B;  2ECG A;  4QSV A;  3N9N A;  5DW1 A;  4F52 B;  5ENH A;  3IU6 A;  5ENI A;  4N4H A;  5LVQ A;  2PUY A;  4ALG A;  1MM3 A;  3Q2F A;  5FE9 A;  5AIU A;  2DWW A;  2CSY A;  5DFC A;  5KH9 A;  5HQ7 A;  2C2V S;  3ZNI A;  4NUD A;  4TU4 A;  5F1H A;  5LKT A;  2EA6 A;  4R2Y A;  4CA1 A;  4WA6 A;  5LJ0 A;  5CQ7 A;  4O72 A;  4N4F A;  4TT2 A;  4QST A;  5CUE A;  4E96 A;  4N3W A;  5K29 A;  4A9I A;  4TZ8 A;  5DLZ A;  4YYH A;  4QBM A;  3TLP A;  3ZYU A;  5FG6 A;  5I89 A;  3SOU A;  4IC3 A;  5LVR A;  2Y1N A;  2L5U A;  2F6J A;  4PCI A;  4A49 A;  5LKU A;  5I40 A;  1Z2Q A;  3KNV A;  5CY9 A;  1BOR A;  1CHC A;  1DVP A;  4P5O B;  1JOC A;  5CFW A;  2ZET C;  4QSW A;  3O7A A;  3ZYQ A;  5D3J A;  4BJX A;  5B75 A;  3AQA A;  4FLP A;  5CQ5 A;  3HTK C;  2YSJ A;  3U5O A;  4HXM A;  2D8S A;  4CFK A;  2C2L A;  4CUQ A;  5DLX A;  5EYA F;  5HRW A;  4YAD A;  5A82 A;  5FBX A;  4A9N A;  4CUR A;  2R10 A;  4TQN A;  5G4S A;  5CUA A;  4QR4 A;  5A7C A;  4HBX A;  5J3X A;  4QSX A;  5ENE A;  2WP1 A;  4O7F A;  4UP0 A;  4WZ2 A;  1K2F A;  3SOX A;  4NS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...