4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords CREB-binding protein
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
1WEOA 4X2IA 5E9MA 5H1UA 3NG2A 5EA1A 5KTXA 4O64A 4LYWA 5CUDA 4QSVA 5C85A 4LKAA 3U5NA 4MEOA 5KH3A 3SVHA 3UVDA 5EM3A 3UVYA 3LQHA 4XUBA 4QYDA 1JM4B 4BW4A 2KGIA 4HXRA 4N4IA 3UVWA 1WEMA 1VFYA 4IOOA 4QSWA 5ENCA 5EQ1A 2YW5A 5C8GA 2L5UA 5F60A 5C7NA 2YHOA 2KWJA 4Q0NA 5CUAA 4N4FA 1E6IA 4R2YA 4AP4A 5HQ7A 3Q2EA 5CRZA 4WIVA 5FB0A 1JOCA 4ALGA 2CSZA 4AKNA 1N72A 4MEPA 2MIQA 5E9KA 2EGPA 2D9EA 4L58A 5L96A 4PS5A 2KREA 4O76A 2KWOA 1WEUA 5IGMA 5FE2A 1MM3A 4DONA 4UITA 2FUUA 2H0DA 2K17A 4NRBA 5DFCA 1WGMA 2VJFA 5TB6A 2XB1A 2MD7B 5G04B 5J0DA 5EI4A 4QSPA 4Z6HA 3MXFA 5EPRA 1E4UA 2M3HA 4XUAA 2KTBB 5LKXA 4O72A 2ECJA 2OXQC 4WZ2A 4O78A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 4A9OA 5KU3A 4TT4A 3PHDA 5LKTA 3SOWA 2QICA 4IC3A 3UV2A 5G05B 5A5SA 5D3RA 1F62A 2YYNA 4GNGA 1K2FA 2ECNA 3O37A 4WHWA 1JM7A 4PY6A 5EWWA 5L8TA 3N9LA 5TDRA 5TBNA 3SHBA 5LKZA 5TDWA 1WEVA 5HRVA 5DYUA 3HMHA 3P1CA 5D7XA 4YYIA 5ACYA 5I89A 3G0LA 5CFWA 4A9FA 3M63A 2MNZA 4RVRA 1X4UA 2YURA 3C5KA 4BJXA 4NUCA 3S91A 5A5RA 2LXPC 3IHPA 5LJ2A 2LGGA 2YYRA 4O7EA 5E74A 3P1DA 3D7CA 3U5JA 4QSQA 5FE9A 2VP7A 3O35A 4A9MA 2MT5A 4XY9A 5EWCA 4MR5A 5B77A 3HMFA 5H85A 3I3JA 3IU6A 5A5QA 5FH6A 2F6NA 2L84A 5CPEA 2MJVB 3UW9A 5COIA 1CHCA 3SOXA 5B8DA 4J0SA 3AQAA 2HDPA 2MNYA 1VD4A 5B75A 2VJEA 4HXOA 2E3KA 3EB5A 4V3KC 4LZ2A 3JVMA 3SOUA 4BHWA 4UYEA 4A9JA 3S92A 3ZPV1 4UYDA 4LLBA 3IU5A 5FE7A 3ZTGA 4IR4A 5EWHA 2YQLA 5E0RA 4YY6A 2KYUA 5CQ8A 5DW2A 4QC1A 5IGKA 2BAYA 4UYFA 3DPLR 2R0YA 4HXNA 3GV4A 5ENGA 5JWMA 1FBVA 2ZETC 3T6RA 4R7EA 2PUYA 2DVVA 4QSXA 2ECTA 5DKAA 3LXJA 2D8SA 5IGNA 3VK6A 2YEKA 4A9EA 5BT3A 3U5LA 4YH3A 1WEWA 1VYXA 5CQTA 5HFQA 5EK9A 2YELA 5EISA 3RCWA 4YYNA 4XYAA 4TYLA 5HM0A 5HQ5A 4QNSA 3FL2A 3LQIA 3ZNIA 4O7AA 5F62A 3L1ZB 5AMEA 4QSTA 4CLBA 5FFVA 4FJCA 2RS9B 3JVLA 3M62A 3DWYA 4GPJA 2H60A 4NS5A 4NN2A 4CUSA 4A9NA 2RSDA 5FG4A 4MR6A 4FO9A 2DVRA 2E7OA 3O34A 4FK5A 3FKMX 4HXPA 4LJNA 4HXLA 5L98A 4S3OB 5FE6A 5EPBA 3RPGB 4UI9B 2H0DB 4YYDA 2KIZA 5E7DA 5TABA 4TQNA 4PPEA 5DKDA 4LRGA 4QSUA 4NR9A 4Q6FA 4TTEA 4QF2A 2KE1A 5FEYA 4NYXA 1LDKC 4X3GA 2DKWA 2CSYA 4O70A 5E3GA 5HEMA 4NR4A 5EICA 5HLSA 2VJEB 2FSAA 1RMDA 4QUUA 4NR8A 4PKLA 3UV5A 2ECIA 4I7DA 2YU4A 3V43A 4BBQA 5CY9A 2JMJA 5IIDA 1ZBDB 3L11A 3MUKA 5LKUA 5HFRA 2Y1NA 5F1LA 2L75A 5AIUA 4QEWA 1JSPB 3KQIA 5D3PA 2LN0A 3N9QA 5H1TA 4YATA 5FERA 1ZS5A 4F3IA 3RPGC 3P1FA 5TRBA 3HCUA 4HXKA 4I7BA 4S3OC 2VNFA 3G0JA 5F2PA 2XEUA 2L80A 5G4SA 3UVXA 4Y03A 3UV4A 5AD3A 2CT2A 3ZVYA 2F6JA 2KWNA 4A4CA 4O7CA 2L5EA 4NYVA 5FE1A 5LUUA 4MVTA 4WZ0A 2AN6A 5FFWA 3ASLA 3AADA 5FE3A 5C13A 4FLPA 4Z6IA 5HRXA 2LGKA 2YSMA 2R0VA 4IR6A 4LZRA 3TLPA 3NXBA 5F63A 5I7XA 2YHNA 4MENA 4TU4A 3M99A 4CFKA 1F68A 3KV6A 5JG6A 4YBSA 4Z93A 5DYCA 3DQVR 2R0SA 2CKLA 5D1MB 5FE4A 5EYAF 4HXSA 5D26A 5DKCA 4ZC9A 5F3AA 3ZVZB 3QZSA 5F1HA 2I7KA 4O74A 4UP0A 5LVRA 5IG6A 4OGIA 2F42A 5DBMA 4UIVA 2OSSA 2VPBA 5I80A 5L99A 3JVKA 4TZ8A 2E6RA 4QY4A 1WENA 4C67A 3QZVA 4HBXA 2K16A 4ZUXU 4AVXA 2G4AA 5A5OA 5E9IA 2ECWA 4LDFA 3SVGA 5B78A 4Z1QA 4HBYA 5B79A 2QIZA 5C89A 5E9YA 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 5ENJA 4YYJA 2JRJA 3RTRB 2RO1A 4PCEA 5H9MA 2RNWA 2K4DA 4I7CA 4QYLA 3KNVA 2KGGA 2LDRA 4TU6A 2WP1A 4UIXA 5EGUA 4QSRA 2G43A 5DYXA 4HXMA 5E73A 5JI8A 5HCLA 3MB4A 1WUMA 2JMIA 3HTKC 4TS8A 4LC2A 5ETDA 5G4RA 5CTLA 5C11A 4UP5A 4FIPA 5HRWA 1V87A 5CP5A 3GL6A 4AYCB 5EP7A 3ZYUA 4NUDA 4PCIA 5EV9A 4LYIA 5FB1A 4MR3A 4A9IA 5D3JA 4LR6A 5CQAA 5KTUA 4KCXA 4QSSA 4HBWA 5CQ7A 3EB6A 5E3DA 2L43A 5BT4A 2RNYA 4NR7A 5CZGA 2JMDA 2L85A 4YAXA 4KV4A 4YYHA 2G6QA 4WHUA 2YREA 5CU8A 5KH7A 2QJ0A 5CUEA 3DAIA 3HCTA 5D0CA 4C66A 5G0FA 3O7AA 1WFKA 4LZSA 5AITA 1X0JA 2VPDA 4NUEA 4XY8A 4QEUA 2K1JA 1HYIA 1Z2QA 3LJWA 4UIYA 2M6MA 3U5OA 3U5MA 5I83A 4N3WA 5DW1A 3PURA 4IR5A 5A7CA 4A9KA 3JVJA 2RI7A 4YH4A 2NAAA 4ZW1A 3ONIA 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 4QUTA 5HELA 4Q0OA 4UIWA 2YUCA 2LSPB 2EODA 5DFBA 4AUQB 5HENA 4CA1A 5I3LA 4GNFA 1EQFA 5EWVA 4QR3A 4MSXA 5A83A 5EVAA 4UYHA 5ENHA 2KWKA 5AD2A 2YQMA 4NYWA 2WP2A 5KTWA 4UYGA 4IORA 5A81A 5IBNA 2I50A 2DWWA 4W4UA 1WUGA 4LYSA 2NXBA 2D82A 2LXHC 1WIMA 5LCWB 1WILA 4HBVA 3P1EA 5CS8A 5I88A 5DINA 5KHMA 5LJ1A 3ZYQA 4A4BA 5CQ6A 2UZGA 5B76A 5A5NA 4YADA 2OUOA 4AYCA 4CCGX 5CQ5A 4Z1SA 2FUIA 2DX8A 2I8NA 2YQDA 4NRCA 3MB3A 3U5KA 5C87A 5D1KB 2RFJA 3HMEA 3K2JA 3O36A 5I1QA 5FE8A 5I7YA 4YC9A 5F25A 5BT5A 2MUMA 5LVQA 2LQ6A 3C6WA 5AMFA 4QBMA 1BORA 3L1XA 4CUQA 1IYMA 4ZQLA 4CL9A 5J3XA 4BW2A 5I40A 4YYKA 5ENEA 2GRCA 1WEQA 2M1RA 4XI1A 4BW3A 2OO1A 1X4IA 5DLXA 3O70A 4NR5A 4J0RA 4TT2A 3P5OA 2YEMA 5EPSA 5DKHA 4LK9A 4QZSA 4GB0A 2C2VS 3KV5A 2E7NA 4CUTA 5DFDA 4QR5A 4IC2A 5FBXA 5CRMA 3N9MA 3SVFA 5D3HA 5L97A 2EA6A 5ENIA 2YDWA 1XWHA 2HYED 5CGPA 4F52B 3HCSA 4NQMA 5D3NA 5II2A 4BW1A 4LADB 2Y1MA 3MULA 2MA5A 5HQ6A 4GNEA 4YABA 5CQ3A 1MM2A 1Z60A 3U5PA 4QEVA 5EWDA 1Z6UA 3T7LA 2ECVA 5E9LA 3N9NA 5D24A 1N87A 5FG6A 3ZPVE 2VPEA 4A9LA 1DVPA 5ENFA 4A9HA 3MHHA 5D3SA 5FFYA 4IOQA 4IR3A 4CUUA 5IGLA 2KFTA 5TCMA 5D3TA 5HJCA 4V3LC 5H1VA 2PNXA 4YK0A 2LGVA 4O75A 2G45A 3LRQA 5FG5A 4P5OB 4MEQA 4KV1A 4GNDA 5E9VA 5DX4A 5DY7A 4UYFB 4QF3A 5ETBA 4QC3A 2KR4A 2DVQA 5F36A 4UIZA 5D3LA 4WA6A 4QR4A 4B7YC 4N4HA 2N9GA 5ENBA 5CUBA 3I2DA 2KU3A 4E96A 4NQNA 2DVSA 3MQMA 4OUFA 4CURA 2LRIC 2MA6A 4YBTA 5FH8A 2L0BA 4PTBA 5A82A 4UIUA 2DATA 4R8PK 4CUPA 2YW8A 5A85A 3GG3A 4J3IA 4NXJA 5D25A 5I29A 4CFLA 2LV9A 1T1HA 4O7BA 5D1LB 4N4GA 2M85A 5DYAA 1FP0A 1WESA 2IDAA 5FDZA 5L8UA 4QB3A 2Y43A 5LJ0A 5FH7A 5CQ4A 5DLZA 5CUCA 5A5PA 4ALHA 4YYMA 4WZ3B 4TKPB 3O33A 5CUGA 2E6SA 4TT6A 5F61A 4NR6A 5F5ZA 4J1PA 3LQJA 5KO4A 1WEPA 4O77A 4O71A 4L7XA 4A49A 1HYJA 4TZ2A 4YBMA 4YY4A 4O7FA 4YYGA 4MR4A 2CKLB 2MD8C 2R10A 5FE0A 1JM7B 4NRAA 4OGJA 5FE5A 2RNXA 3MHSA 5I86A 3QZTA 2VJFB 1WE9A 5EU1A 4B86C 5C4QA 1G25A 5K29A 2YSJA 3Q2FA 5II1A
chains in the Genus database with same CATH superfamily
1WEOA 3SUBA 4X2IA 5E9MA 5H1UA 3NG2A 5EA1A 5KTXA 4O64A 4LYWA 5CUDA 4QSVA 5C85A 4LKAA 3U5NA 4MEOA 5KH3A 3SVHA 3UVDA 5EM3A 3UVYA 3JUEA 3ERRA 3LQHA 1ZKRA 4QYDA 4XUBA 1JM4B 4BW4A 2KGIA 4HXRA 4N4IA 3UVWA 1WEMA 1VFYA 4IOOA 4QSWA 5ENCA 5EQ1A 2M13A 2YW5A 5C8GA 2L5UA 5F60A 5C7NA 2YHOA 2KWJA 4AKHA 4Q0NA 2B0OE 5CUAA 4N4FA 1E6IA 4R2YA 4AP4A 5HQ7A 3Q2EA 5CRZA 4WIVA 5FB0A 1JOCA 4ALGA 2CSZA 4AKNA 1N72A 4MEPA 2DSMA 2MIQA 5E9KA 2EGPA 2D9EA 3PLWA 4L58A 5L96A 3T9KA 4PS5A 2KREA 4O76A 2KWOA 1WEUA 5IGMA 5FE2A 1MM3A 4DONA 4UITA 2FUUA 2H0DA 2K17A 4NRBA 5DFCA 2RR4A 1WGMA 2VJFA 5TB6A 2XB1A 2MD7B 5G04B 5J0DA 5EI4A 4QSPA 4Z6HA 3MXFA 5EPRA 1E4UA 2M3HA 4XUAA 2KTBB 5LKXA 2JM3A 4AI6A 4O72A 2ECJA 2OXQC 4WZ2A 4O78A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 4A9OA 5KU3A 4H9DA 4TT4A 3PHDA 5LKTA 3SOWA 2LAUA 2QICA 4IC3A 3UV2A 5G05B 5A5SA 5D3RA 1F62A 2YYNA 4GNGA 1K2FA 2ECNA 3O37A 4WHWA 1JM7A 4PY6A 5EWWA 5L8TA 3N9LA 5TDRA 5TBNA 3SHBA 5LKZA 3H7HA 5TDWA 1WEVA 5HRVA 5DYUA 3HMHA 3P1CA 5D7XA 4YYIA 5ACYA 3FEHA 5I89A 3G0LA 5CFWA 4A9FA 3M63A 2MNZA 4RVRA 1X4UA 2YURA 3C5KA 2XOYA 4BJXA 4NUCA 3S91A 5A5RA 2LXPC 3IHPA 5LJ2A 2LGGA 2YYRA 4O7EA 5E74A 3P1DA 3D7CA 3U5JA 4QSQA 5FE9A 2VP7A 3O35A 4A9MA 2XOZA 2MT5A 4XY9A 5EWCA 4MR5A 5B77A 3HMFA 5H85A 3I3JA 3IU6A 5A5QA 5FH6A 2F6NA 2L84A 5CPEA 2MJVB 3UW9A 5COIA 1CHCA 3SOXA 5B8DA 4J0SA 3AQAA 2HDPA 2MNYA 1VD4A 5B75A 2VJEA 4HXOA 2E3KA 4QQ4A 3EB5A 4V3KC 4LZ2A 3JVMA 3SOUA 4BHWA 4UYEA 4A9JA 3S92A 3ZPV1 4UYDA 4LLBA 3IU5A 5FE7A 3ZTGA 4IR4A 5EWHA 2YQLA 5E0RA 4YY6A 2KYUA 5CQ8A 5DW2A 4QC1A 5IGKA 2BAYA 3DDTA 3FAOA 3D1BA 4UYFA 3DPLR 2R0YA 4HXNA 3GV4A 5ENGA 2DJAA 5JWMA 1FBVA 3DWDA 2ZETC 2CONA 3T6RA 4R7EA 2PUYA 2DVVA 4QSXA 2ECTA 5DKAA 3LXJA 2D8SA 5IGNA 3VK6A 1MBMA 2YEKA 4A9EA 5BT3A 3U5LA 4YH3A 1WEWA 1VYXA 5CQTA 5HFQA 5EK9A 2YELA 5EISA 3RCWA 4YYNA 4XYAA 4TYLA 5HM0A 5HQ5A 4QNSA 3FL2A 3LQIA 3ZNIA 4O7AA 5F62A 3L1ZB 5AMEA 4QSTA 4CLBA 5FFVA 4FJCA 2RS9B 3JVLA 3M62A 3VKGA 3DWYA 4GPJA 2H60A 4NS5A 4NN2A 4CUSA 4A9NA 2RSDA 5FG4A 4MR6A 4FO9A 2DVRA 2E7OA 3O34A 4FK5A 3FKMX 4HXPA 4LJNA 4HXLA 5L98A 4S3OB 2IQJA 5FE6A 5EPBA 2XP0A 3RPGB 4UI9B 2H0DB 4YYDA 2KIZA 5E7DA 5TABA 4TQNA 4PPEA 5DKDA 4LRGA 4QSUA 4NR9A 4Q6FA 4AKIA 4TTEA 4QF2A 2KE1A 5FEYA 4NYXA 1LDKC 4X3GA 2DKWA 2CSYA 4O70A 5E3GA 5HEMA 4NR4A 5EICA 5HLSA 2VJEB 2FSAA 3M7KA 1RMDA 4QUUA 2FD4A 4NR8A 4PKLA 3UV5A 2ECIA 4I7DA 2YU4A 3V43A 4BBQA 5CY9A 2JMJA 5IIDA 1ZBDB 3L11A 2CSVA 3MUKA 5LKUA 5HFRA 2Y1NA 2EXUA 5F1LA 2L75A 5AIUA 4QEWA 1JSPB 3KQIA 5D3PA 2JUNA 2LN0A 5H1TA 4YATA 3N9QA 5FERA 1ZS5A 4F3IA 3RPGC 3P1FA 5TRBA 3HCUA 4HXKA 4I7BA 4S3OC 2VNFA 3G0JA 5F2PA 2XEUA 4OGEA 2L80A 5G4SA 3UVXA 4Y03A 3UV4A 5AD3A 2CT2A 3ZVYA 2F6JA 2KWNA 2CRWA 4A4CA 4O7CA 2L5EA 4NYVA 5FE1A 5LUUA 4MVTA 4WZ0A 5SVIB 2AN6A 5FFWA 3ASLA 3AADA 5FE3A 5C13A 4FLPA 4Z6IA 5HRXA 2LGKA 2YSMA 2R0VA 3E2DA 4IR6A 4LZRA 3TLPA 3NXBA 5F63A 5I7XA 2YHNA 4MENA 4TU4A 3M99A 4CFKA 1F68A 3KV6A 5JG6A 4YBSA 4Z93A 5SVXA 5DYCA 3DQVR 2EJNA 2R0SA 2CKLA 5D1MB 5FE4A 5EYAF 4HXSA 5D26A 5DKCA 4ZC9A 5F3AA 3ZVZB 3QZSA 5F1HA 2I7KA 4O74A 4UP0A 3LVRE 5LVRA 5IG6A 4OGIA 2F42A 5DBMA 4UIVA 2OSSA 2VPBA 5I80A 5L99A 3JVKA 4TZ8A 2E6RA 4QY4A 1WENA 4C67A 3QZVA 4HBXA 2K16A 4ZUXU 4AVXA 2G4AA 5A5OA 2OWAA 5E9IA 2ECWA 4LDFA 3SVGA 4AKGA 4Z1QA 4HBYA 5B78A 5B79A 2QIZA 3LVQE 5C89A 5E9YA 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 5ENJA 4YYJA 2JRJA 3RTRB 4F1PA 2RO1A 4PCEA 5H9MA 2RNWA 2K4DA 4I7CA 4QYLA 3KNVA 2KGGA 2LDRA 4TU6A 2WP1A 4UIXA 5EGUA 4QSRA 2G43A 5DYXA 4HXMA 5E73A 5JI8A 5HCLA 3MB4A 1WUMA 2JMIA 3HTKC 4TS8A 4LC2A 5ETDA 5G4RA 5CTLA 5C11A 4UP5A 4FIPA 5HRWA 3VKHA 1V87A 5CP5A 3GL6A 4AYCB 5EP7A 3ZYUA 4NUDA 4PCIA 5EV9A 4LYIA 5FB1A 4MR3A 4A9IA 5D3JA 4LR6A 5CQAA 5KTUA 4KCXA 4QSSA 4HBWA 5CQ7A 2EGMA 2KKXA 3EB6A 5E3DA 2L43A 5BT4A 2RNYA 4NR7A 5CZGA 2JMDA 2L85A 4YAXA 4KV4A 4YYHA 2G6QA 5K3QA 4WHUA 2XOCA 2YREA 5CU8A 5KH7A 2QJ0A 5CUEA 3DAIA 3HCTA 5D0CA 2FFWA 4C66A 2YVRA 5G0FA 3O7AA 1WFKA 4LZSA 5AITA 1X0JA 2VPDA 4NUEA 4XY8A 4QEUA 2K1JA 1HYIA 1Z2QA 3LJWA 4UIYA 2M6MA 3U5OA 3U5MA 5I83A 4N3WA 5DW1A 3MDBC 3PURA 4IR5A 5A7CA 4A9KA 3JVJA 2RI7A 4YH4A 2NAAA 4ZW1A 2L7PA 3ONIA 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 4QUTA 5HELA 4Q0OA 4UIWA 2YUCA 2LSPB 2EODA 5DFBA 4AUQB 5HENA 4CA1A 5I3LA 4GNFA 1EQFA 5EWVA 4QR3A 4MSXA 5A83A 5EVAA 1PUOA 4UYHA 5ENHA 2KWKA 5AD2A 2E61A 2YQMA 4NYWA 4O62A 2MKEA 2WP2A 5KTWA 4UYGA 4IORA 5A81A 5IBNA 2I50A 2DWWA 4W4UA 1WUGA 2KKYA 4LYSA 2NXBA 2D82A 2LXHC 1WIMA 5LCWB 1DCQA 1WILA 4HBVA 3P1EA 5SVIA 5CS8A 5I88A 5DINA 5KHMA 5LJ1A 3ZYQA 4A4BA 5CQ6A 2UZGA 5B76A 5A5NA 4YADA 2OUOA 4AYCA 4CCGX 5CQ5A 4Z1SA 2FUIA 2DX8A 2I8NA 2YQDA 4NRCA 3MB3A 3U5KA 5C87A 5D1KB 2RFJA 3HMEA 3K2JA 3O36A 5I1QA 5FE8A 5I7YA 2P57A 3FANA 4YC9A 5F25A 5BT5A 2MUMA 5LVQA 2D8UA 2LQ6A 3C6WA 3Q1DA 5AMFA 4QBMA 1BORA 3L1XA 4CUQA 1IYMA 4ZQLA 4CL9A 3LJUX 5J3XA 4BW2A 5I40A 4YYKA 5ENEA 2GRCA 1WEQA 2M1RA 4XI1A 4BW3A 2OO1A 1X4IA 5DLXA 3O70A 4NR5A 5SVYA 4J0RA 4TT2A 3P5OA 2YEMA 5EPSA 5DKHA 4LK9A 4QZSA 3O47A 4GB0A 4Z0RA 2C2VS 3KV5A 2E7NA 4CUTA 5DFDA 4QR5A 4IC2A 5FBXA 5CRMA 3N9MA 3SVFA 5D3HA 5L97A 2EA6A 5ENIA 2YDWA 1XWHA 2HYED 5CGPA 4F52B 3HCSA 4NQMA 5D3NA 5II2A 4BW1A 4LADB 2Y1MA 3MULA 2MA5A 5HQ6A 2CRRA 4GNEA 4YABA 5CQ3A 1MM2A 1Z60A 3U5PA 4QEVA 5EWDA 1Z6UA 3T7LA 2ECVA 5E9LA 3N9NA 5D24A 1N87A 5FG6A 4OGCA 3ZPVE 2VPEA 4A9LA 1DVPA 5ENFA 4A9HA 3MHHA 5D3SA 5FFYA 4IOQA 4IR3A 4CUUA 5IGLA 3FJUB 2KFTA 3D1DA 5TCMA 5D3TA 5HJCA 4V3LC 5H1VA 2PNXA 3KDEC 4YK0A 2LGVA 4O75A 2G45A 3LRQA 5FG5A 4P5OB 4MEQA 4KV1A 4GNDA 5E9VA 5DX4A 5DY7A 4UYFB 4QF3A 5ETBA 4QC3A 2KR4A 2DVQA 5F36A 4UIZA 5D3LA 4WA6A 4QR4A 4B7YC 4N4HA 2N9GA 5ENBA 5CUBA 3I2DA 4Z0OA 2KU3A 4E96A 4NQNA 2DVSA 3MQMA 4OUFA 4CURA 2LRIC 3FM8C 2MA6A 4YBTA 5FH8A 2L0BA 4PTBA 5A82A 4UIUA 2DATA 4R8PK 4CUPA 2YW8A 5A85A 3GG3A 4J3IA 4NXJA 5D25A 5I29A 4CFLA 2LV9A 1T1HA 4O7BA 5D1LB 4N4GA 2M85A 5DYAA 1FP0A 3LDYA 1WESA 2IDAA 5FDZA 5L8UA 4QB3A 2Y43A 5LJ0A 5FH7A 5CQ4A 5DLZA 5CUCA 5A5PA 4ALHA 4YYMA 4WZ3B 4TKPB 3O33A 5CUGA 2E6SA 4TT6A 5F61A 4NR6A 5F5ZA 4J1PA 3LQJA 5KO4A 1WEPA 4O77A 4O71A 4L7XA 4A49A 1HYJA 4TZ2A 4YBMA 4YY4A 4O7FA 4YYGA 4MR4A 2CKLB 2MD8C 2R10A 5FE0A 1JM7B 4NRAA 4OGJA 5FE5A 2RNXA 3MHSA 5I86A 3QZTA 2VJFB 1WE9A 5EU1A 4B86C 5C4QA 1G25A 5K29A 2YSJA 3Q2FA 5II1A
chains in the Genus database with same CATH topology
1WEOA 4X2IA 5E9MA 5H1UA 3NG2A 5EA1A 5KTXA 4O64A 4LYWA 5CUDA 4QSVA 5C85A 4LKAA 3U5NA 4MEOA 5KH3A 3SVHA 3UVDA 5EM3A 3UVYA 3LQHA 4XUBA 4QYDA 1JM4B 4BW4A 2KGIA 4HXRA 4N4IA 3UVWA 1WEMA 1VFYA 4IOOA 4QSWA 5ENCA 5EQ1A 2YW5A 5C8GA 2L5UA 5F60A 5C7NA 2YHOA 2KWJA 4Q0NA 5CUAA 4N4FA 1E6IA 4R2YA 4AP4A 5HQ7A 3Q2EA 5CRZA 4WIVA 5FB0A 1JOCA 4ALGA 2CSZA 4AKNA 1N72A 4MEPA 2MIQA 5E9KA 2EGPA 2D9EA 4L58A 5L96A 4PS5A 2KREA 4O76A 2KWOA 1WEUA 5IGMA 5FE2A 1MM3A 4DONA 4UITA 2FUUA 2H0DA 2K17A 4NRBA 5DFCA 1WGMA 2VJFA 5TB6A 2XB1A 2MD7B 5G04B 5J0DA 5EI4A 4QSPA 4Z6HA 3MXFA 5EPRA 1E4UA 2M3HA 4XUAA 2KTBB 5LKXA 4O72A 2ECJA 2OXQC 4WZ2A 4O78A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 4A9OA 5KU3A 4TT4A 3PHDA 5LKTA 3SOWA 2QICA 4IC3A 3UV2A 5G05B 5A5SA 5D3RA 1F62A 2YYNA 4GNGA 1K2FA 2ECNA 3O37A 4WHWA 1JM7A 4PY6A 5EWWA 5L8TA 3N9LA 5TDRA 5TBNA 3SHBA 5LKZA 5TDWA 1WEVA 5HRVA 5DYUA 3HMHA 3P1CA 5D7XA 4YYIA 5ACYA 5I89A 3G0LA 5CFWA 4A9FA 3M63A 2MNZA 4RVRA 1X4UA 2YURA 3C5KA 4BJXA 4NUCA 3S91A 5A5RA 2LXPC 3IHPA 5LJ2A 2LGGA 2YYRA 4O7EA 5E74A 3P1DA 3D7CA 3U5JA 4QSQA 5FE9A 2VP7A 3O35A 4A9MA 2MT5A 4XY9A 5EWCA 4MR5A 5B77A 3HMFA 5H85A 3I3JA 3IU6A 5A5QA 5FH6A 2F6NA 2L84A 5CPEA 2MJVB 3UW9A 5COIA 1CHCA 3SOXA 5B8DA 4J0SA 3AQAA 2HDPA 2MNYA 1VD4A 5B75A 2VJEA 4HXOA 2E3KA 3EB5A 4V3KC 4LZ2A 3JVMA 3SOUA 4BHWA 4UYEA 4A9JA 3S92A 3ZPV1 4UYDA 4LLBA 3IU5A 5FE7A 3ZTGA 4IR4A 5EWHA 2YQLA 5E0RA 4YY6A 2KYUA 5CQ8A 5DW2A 4QC1A 5IGKA 2BAYA 4UYFA 3DPLR 2R0YA 4HXNA 3GV4A 5ENGA 5JWMA 1FBVA 2ZETC 3T6RA 4R7EA 2PUYA 2DVVA 4QSXA 2ECTA 5DKAA 3LXJA 2D8SA 5IGNA 3VK6A 2YEKA 4A9EA 5BT3A 3U5LA 4YH3A 1WEWA 1VYXA 5CQTA 5HFQA 5EK9A 2YELA 5EISA 3RCWA 4YYNA 4XYAA 4TYLA 5HM0A 5HQ5A 4QNSA 3FL2A 3LQIA 3ZNIA 4O7AA 5F62A 3L1ZB 5AMEA 4QSTA 4CLBA 5FFVA 4FJCA 2RS9B 3JVLA 3M62A 3DWYA 4GPJA 2H60A 4NS5A 4NN2A 4CUSA 4A9NA 2RSDA 5FG4A 4MR6A 4FO9A 2DVRA 2E7OA 3O34A 4FK5A 3FKMX 4HXPA 4LJNA 4HXLA 5L98A 4S3OB 5FE6A 5EPBA 3RPGB 4UI9B 2H0DB 4YYDA 2KIZA 5E7DA 5TABA 4TQNA 4PPEA 5DKDA 4LRGA 4QSUA 4NR9A 4Q6FA 4TTEA 4QF2A 2KE1A 5FEYA 4NYXA 1LDKC 4X3GA 2DKWA 2CSYA 4O70A 5E3GA 5HEMA 4NR4A 5EICA 5HLSA 2VJEB 2FSAA 1RMDA 4QUUA 4NR8A 4PKLA 3UV5A 2ECIA 4I7DA 2YU4A 3V43A 4BBQA 5CY9A 2JMJA 5IIDA 1ZBDB 3L11A 3MUKA 5LKUA 5HFRA 2Y1NA 5F1LA 2L75A 5AIUA 4QEWA 1JSPB 3KQIA 5D3PA 2LN0A 3N9QA 5H1TA 4YATA 5FERA 1ZS5A 4F3IA 3RPGC 3P1FA 5TRBA 3HCUA 4HXKA 4I7BA 4S3OC 2VNFA 3G0JA 5F2PA 2XEUA 2L80A 5G4SA 3UVXA 4Y03A 3UV4A 5AD3A 2CT2A 3ZVYA 2F6JA 2KWNA 4A4CA 4O7CA 2L5EA 4NYVA 5FE1A 5LUUA 4MVTA 4WZ0A 2AN6A 5FFWA 3ASLA 3AADA 5FE3A 5C13A 4FLPA 4Z6IA 5HRXA 2LGKA 2YSMA 2R0VA 4IR6A 4LZRA 3TLPA 3NXBA 5F63A 5I7XA 2YHNA 4MENA 4TU4A 3M99A 4CFKA 1F68A 3KV6A 5JG6A 4YBSA 4Z93A 5DYCA 3DQVR 2R0SA 2CKLA 5D1MB 5FE4A 5EYAF 4HXSA 5D26A 5DKCA 4ZC9A 5F3AA 3ZVZB 3QZSA 5F1HA 2I7KA 4O74A 4UP0A 5LVRA 5IG6A 4OGIA 2F42A 5DBMA 4UIVA 2OSSA 2VPBA 5I80A 5L99A 3JVKA 4TZ8A 2E6RA 4QY4A 1WENA 4C67A 3QZVA 4HBXA 2K16A 4ZUXU 4AVXA 2G4AA 5A5OA 5E9IA 2ECWA 4LDFA 3SVGA 5B78A 4Z1QA 4HBYA 5B79A 2QIZA 5C89A 5E9YA 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 5ENJA 4YYJA 2JRJA 3RTRB 2RO1A 4PCEA 5H9MA 2RNWA 2K4DA 4I7CA 4QYLA 3KNVA 2KGGA 2LDRA 4TU6A 2WP1A 4UIXA 5EGUA 4QSRA 2G43A 5DYXA 4HXMA 5E73A 5JI8A 5HCLA 3MB4A 1WUMA 2JMIA 3HTKC 4TS8A 4LC2A 5ETDA 5G4RA 5CTLA 5C11A 4UP5A 4FIPA 5HRWA 1V87A 5CP5A 3GL6A 4AYCB 5EP7A 3ZYUA 4NUDA 4PCIA 5EV9A 4LYIA 5FB1A 4MR3A 4A9IA 5D3JA 4LR6A 5CQAA 5KTUA 4KCXA 4QSSA 4HBWA 5CQ7A 3EB6A 5E3DA 2L43A 5BT4A 2RNYA 4NR7A 5CZGA 2JMDA 2L85A 4YAXA 4KV4A 4YYHA 2G6QA 4WHUA 2YREA 5CU8A 5KH7A 2QJ0A 5CUEA 3DAIA 3HCTA 5D0CA 4C66A 5G0FA 3O7AA 1WFKA 4LZSA 5AITA 1X0JA 2VPDA 4NUEA 4XY8A 4QEUA 2K1JA 1HYIA 1Z2QA 3LJWA 4UIYA 2M6MA 3U5OA 3U5MA 5I83A 4N3WA 5DW1A 3PURA 4IR5A 5A7CA 4A9KA 3JVJA 2RI7A 4YH4A 2NAAA 4ZW1A 3ONIA 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 4QUTA 5HELA 4Q0OA 4UIWA 2YUCA 2LSPB 2EODA 5DFBA 4AUQB 5HENA 4CA1A 5I3LA 4GNFA 1EQFA 5EWVA 4QR3A 4MSXA 5A83A 5EVAA 4UYHA 5ENHA 2KWKA 5AD2A 2YQMA 4NYWA 2WP2A 5KTWA 4UYGA 4IORA 5A81A 5IBNA 2I50A 2DWWA 4W4UA 1WUGA 4LYSA 2NXBA 2D82A 2LXHC 1WIMA 5LCWB 1WILA 4HBVA 3P1EA 5CS8A 5I88A 5DINA 5KHMA 5LJ1A 3ZYQA 4A4BA 5CQ6A 2UZGA 5B76A 5A5NA 4YADA 2OUOA 4AYCA 4CCGX 5CQ5A 4Z1SA 2FUIA 2DX8A 2I8NA 2YQDA 4NRCA 3MB3A 3U5KA 5C87A 5D1KB 2RFJA 3HMEA 3K2JA 3O36A 5I1QA 5FE8A 5I7YA 4YC9A 5F25A 5BT5A 2MUMA 5LVQA 2LQ6A 3C6WA 5AMFA 4QBMA 1BORA 3L1XA 4CUQA 1IYMA 4ZQLA 4CL9A 5J3XA 4BW2A 5I40A 4YYKA 5ENEA 2GRCA 1WEQA 2M1RA 4XI1A 4BW3A 2OO1A 1X4IA 5DLXA 3O70A 4NR5A 4J0RA 4TT2A 3P5OA 2YEMA 5EPSA 5DKHA 4LK9A 4QZSA 4GB0A 2C2VS 3KV5A 2E7NA 4CUTA 5DFDA 4QR5A 4IC2A 5FBXA 5CRMA 3N9MA 3SVFA 5D3HA 5L97A 2EA6A 5ENIA 2YDWA 1XWHA 2HYED 5CGPA 4F52B 3HCSA 4NQMA 5D3NA 5II2A 4BW1A 4LADB 2Y1MA 3MULA 2MA5A 5HQ6A 4GNEA 4YABA 5CQ3A 1MM2A 1Z60A 3U5PA 4QEVA 5EWDA 1Z6UA 3T7LA 2ECVA 5E9LA 3N9NA 5D24A 1N87A 5FG6A 3ZPVE 2VPEA 4A9LA 1DVPA 5ENFA 4A9HA 3MHHA 5D3SA 5FFYA 4IOQA 4IR3A 4CUUA 5IGLA 2KFTA 5TCMA 5D3TA 5HJCA 4V3LC 5H1VA 2PNXA 4YK0A 2LGVA 4O75A 2G45A 3LRQA 5FG5A 4P5OB 4MEQA 4KV1A 4GNDA 5E9VA 5DX4A 5DY7A 4UYFB 4QF3A 5ETBA 4QC3A 2KR4A 2DVQA 5F36A 4UIZA 5D3LA 4WA6A 4QR4A 4B7YC 4N4HA 2N9GA 5ENBA 5CUBA 3I2DA 2KU3A 4E96A 4NQNA 2DVSA 3MQMA 4OUFA 4CURA 2LRIC 2MA6A 4YBTA 5FH8A 2L0BA 4PTBA 5A82A 4UIUA 2DATA 4R8PK 4CUPA 2YW8A 5A85A 3GG3A 4J3IA 4NXJA 5D25A 5I29A 4CFLA 2LV9A 1T1HA 4O7BA 5D1LB 4N4GA 2M85A 5DYAA 1FP0A 1WESA 2IDAA 5FDZA 5L8UA 4QB3A 2Y43A 5LJ0A 5FH7A 5CQ4A 5DLZA 5CUCA 5A5PA 4ALHA 4YYMA 4WZ3B 4TKPB 3O33A 5CUGA 2E6SA 4TT6A 5F61A 4NR6A 5F5ZA 4J1PA 3LQJA 5KO4A 1WEPA 4O77A 4O71A 4L7XA 4A49A 1HYJA 4TZ2A 4YBMA 4YY4A 4O7FA 4YYGA 4MR4A 2CKLB 2MD8C 2R10A 5FE0A 1JM7B 4NRAA 4OGJA 5FE5A 2RNXA 3MHSA 5I86A 3QZTA 2VJFB 1WE9A 5EU1A 4B86C 5C4QA 1G25A 5K29A 2YSJA 3Q2FA 5II1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEO A;  4X2I A;  5E9M A;  5H1U A;  3NG2 A;  5EA1 A;  5KTX A;  4O64 A;  4LYW A;  5CUD A;  4QSV A;  5C85 A;  4LKA A;  3U5N A;  4MEO A;  5KH3 A;  3SVH A;  3UVD A;  5EM3 A;  3UVY A;  3LQH A;  4XUB A;  4QYD A;  1JM4 B;  4BW4 A;  2KGI A;  4HXR A;  4N4I A;  3UVW A;  1WEM A;  1VFY A;  4IOO A;  4QSW A;  5ENC A;  5EQ1 A;  2YW5 A;  5C8G A;  2L5U A;  5F60 A;  5C7N A;  2YHO A;  2KWJ A;  4Q0N A;  5CUA A;  4N4F A;  1E6I A;  4R2Y A;  4AP4 A;  5HQ7 A;  3Q2E A;  5CRZ A;  4WIV A;  5FB0 A;  1JOC A;  4ALG A;  2CSZ A;  4AKN A;  1N72 A;  4MEP A;  2MIQ A;  5E9K A;  2EGP A;  2D9E A;  4L58 A;  5L96 A;  4PS5 A;  2KRE A;  4O76 A;  2KWO A;  1WEU A;  5IGM A;  5FE2 A;  1MM3 A;  4DON A;  4UIT A;  2FUU A;  2H0D A;  2K17 A;  4NRB A;  5DFC A;  1WGM A;  2VJF A;  5TB6 A;  2XB1 A;  2MD7 B;  5G04 B;  5J0D A;  5EI4 A;  4QSP A;  4Z6H A;  3MXF A;  5EPR A;  1E4U A;  2M3H A;  4XUA A;  2KTB B;  5LKX A;  4O72 A;  2ECJ A;  2OXQ C;  4WZ2 A;  4O78 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  4A9O A;  5KU3 A;  4TT4 A;  3PHD A;  5LKT A;  3SOW A;  2QIC A;  4IC3 A;  3UV2 A;  5G05 B;  5A5S A;  5D3R A;  1F62 A;  2YYN A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  4WHW A;  1JM7 A;  4PY6 A;  5EWW A;  5L8T A;  3N9L A;  5TDR A;  5TBN A;  3SHB A;  5LKZ A;  5TDW A;  1WEV A;  5HRV A;  5DYU A;  3HMH A;  3P1C A;  5D7X A;  4YYI A;  5ACY A;  5I89 A;  3G0L A;  5CFW A;  4A9F A;  3M63 A;  2MNZ A;  4RVR A;  1X4U A;  2YUR A;  3C5K A;  4BJX A;  4NUC A;  3S91 A;  5A5R A;  2LXP C;  3IHP A;  5LJ2 A;  2LGG A;  2YYR A;  4O7E A;  5E74 A;  3P1D A;  3D7C A;  3U5J A;  4QSQ A;  5FE9 A;  2VP7 A;  3O35 A;  4A9M A;  2MT5 A;  4XY9 A;  5EWC A;  4MR5 A;  5B77 A;  3HMF A;  5H85 A;  3I3J A;  3IU6 A;  5A5Q A;  5FH6 A;  2F6N A;  2L84 A;  5CPE A;  2MJV B;  3UW9 A;  5COI A;  1CHC A;  3SOX A;  5B8D A;  4J0S A;  3AQA A;  2HDP A;  2MNY A;  1VD4 A;  5B75 A;  2VJE A;  4HXO A;  2E3K A;  3EB5 A;  4V3K C;  4LZ2 A;  3JVM A;  3SOU A;  4BHW A;  4UYE A;  4A9J A;  3S92 A;  3ZPV 1;  4UYD A;  4LLB A;  3IU5 A;  5FE7 A;  3ZTG A;  4IR4 A;  5EWH A;  2YQL A;  5E0R A;  4YY6 A;  2KYU A;  5CQ8 A;  5DW2 A;  4QC1 A;  5IGK A;  2BAY A;  4UYF A;  3DPL R;  2R0Y A;  4HXN A;  3GV4 A;  5ENG A;  5JWM A;  1FBV A;  2ZET C;  3T6R A;  4R7E A;  2PUY A;  2DVV A;  4QSX A;  2ECT A;  5DKA A;  3LXJ A;  2D8S A;  5IGN A;  3VK6 A;  2YEK A;  4A9E A;  5BT3 A;  3U5L A;  4YH3 A;  1WEW A;  1VYX A;  5CQT A;  5HFQ A;  5EK9 A;  2YEL A;  5EIS A;  3RCW A;  4YYN A;  4XYA A;  4TYL A;  5HM0 A;  5HQ5 A;  4QNS A;  3FL2 A;  3LQI A;  3ZNI A;  4O7A A;  5F62 A;  3L1Z B;  5AME A;  4QST A;  4CLB A;  5FFV A;  4FJC A;  2RS9 B;  3JVL A;  3M62 A;  3DWY A;  4GPJ A;  2H60 A;  4NS5 A;  4NN2 A;  4CUS A;  4A9N A;  2RSD A;  5FG4 A;  4MR6 A;  4FO9 A;  2DVR A;  2E7O A;  3O34 A;  4FK5 A;  3FKM X;  4HXP A;  4LJN A;  4HXL A;  5L98 A;  4S3O B;  5FE6 A;  5EPB A;  3RPG B;  4UI9 B;  2H0D B;  4YYD A;  2KIZ A;  5E7D A;  5TAB A;  4TQN A;  4PPE A;  5DKD A;  4LRG A;  4QSU A;  4NR9 A;  4Q6F A;  4TTE A;  4QF2 A;  2KE1 A;  5FEY A;  4NYX A;  1LDK C;  4X3G A;  2DKW A;  2CSY A;  4O70 A;  5E3G A;  5HEM A;  4NR4 A;  5EIC A;  5HLS A;  2VJE B;  2FSA A;  1RMD A;  4QUU A;  4NR8 A;  4PKL A;  3UV5 A;  2ECI A;  4I7D A;  2YU4 A;  3V43 A;  4BBQ A;  5CY9 A;  2JMJ A;  5IID A;  1ZBD B;  3L11 A;  3MUK A;  5LKU A;  5HFR A;  2Y1N A;  5F1L A;  2L75 A;  5AIU A;  4QEW A;  1JSP B;  3KQI A;  5D3P A;  2LN0 A;  3N9Q A;  5H1T A;  4YAT A;  5FER A;  1ZS5 A;  4F3I A;  3RPG C;  3P1F A;  5TRB A;  3HCU A;  4HXK A;  4I7B A;  4S3O C;  2VNF A;  3G0J A;  5F2P A;  2XEU A;  2L80 A;  5G4S A;  3UVX A;  4Y03 A;  3UV4 A;  5AD3 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  4A4C A;  4O7C A;  2L5E A;  4NYV A;  5FE1 A;  5LUU A;  4MVT A;  4WZ0 A;  2AN6 A;  5FFW A;  3ASL A;  3AAD A;  5FE3 A;  5C13 A;  4FLP A;  4Z6I A;  5HRX A;  2LGK A;  2YSM A;  2R0V A;  4IR6 A;  4LZR A;  3TLP A;  3NXB A;  5F63 A;  5I7X A;  2YHN A;  4MEN A;  4TU4 A;  3M99 A;  4CFK A;  1F68 A;  3KV6 A;  5JG6 A;  4YBS A;  4Z93 A;  5DYC A;  3DQV R;  2R0S A;  2CKL A;  5D1M B;  5FE4 A;  5EYA F;  4HXS A;  5D26 A;  5DKC A;  4ZC9 A;  5F3A A;  3ZVZ B;  3QZS A;  5F1H A;  2I7K A;  4O74 A;  4UP0 A;  5LVR A;  5IG6 A;  4OGI A;  2F42 A;  5DBM A;  4UIV A;  2OSS A;  2VPB A;  5I80 A;  5L99 A;  3JVK A;  4TZ8 A;  2E6R A;  4QY4 A;  1WEN A;  4C67 A;  3QZV A;  4HBX A;  2K16 A;  4ZUX U;  4AVX A;  2G4A A;  5A5O A;  5E9I A;  2ECW A;  4LDF A;  3SVG A;  5B78 A;  4Z1Q A;  4HBY A;  5B79 A;  2QIZ A;  5C89 A;  5E9Y A;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  5ENJ A;  4YYJ A;  2JRJ A;  3RTR B;  2RO1 A;  4PCE A;  5H9M A;  2RNW A;  2K4D A;  4I7C A;  4QYL A;  3KNV A;  2KGG A;  2LDR A;  4TU6 A;  2WP1 A;  4UIX A;  5EGU A;  4QSR A;  2G43 A;  5DYX A;  4HXM A;  5E73 A;  5JI8 A;  5HCL A;  3MB4 A;  1WUM A;  2JMI A;  3HTK C;  4TS8 A;  4LC2 A;  5ETD A;  5G4R A;  5CTL A;  5C11 A;  4UP5 A;  4FIP A;  5HRW A;  1V87 A;  5CP5 A;  3GL6 A;  4AYC B;  5EP7 A;  3ZYU A;  4NUD A;  4PCI A;  5EV9 A;  4LYI A;  5FB1 A;  4MR3 A;  4A9I A;  5D3J A;  4LR6 A;  5CQA A;  5KTU A;  4KCX A;  4QSS A;  4HBW A;  5CQ7 A;  3EB6 A;  5E3D A;  2L43 A;  5BT4 A;  2RNY A;  4NR7 A;  5CZG A;  2JMD A;  2L85 A;  4YAX A;  4KV4 A;  4YYH A;  2G6Q A;  4WHU A;  2YRE A;  5CU8 A;  5KH7 A;  2QJ0 A;  5CUE A;  3DAI A;  3HCT A;  5D0C A;  4C66 A;  5G0F A;  3O7A A;  1WFK A;  4LZS A;  5AIT A;  1X0J A;  2VPD A;  4NUE A;  4XY8 A;  4QEU A;  2K1J A;  1HYI A;  1Z2Q A;  3LJW A;  4UIY A;  2M6M A;  3U5O A;  3U5M A;  5I83 A;  4N3W A;  5DW1 A;  3PUR A;  4IR5 A;  5A7C A;  4A9K A;  3JVJ A;  2RI7 A;  4YH4 A;  2NAA A;  4ZW1 A;  3ONI A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  4QUT A;  5HEL A;  4Q0O A;  4UIW A;  2YUC A;  2LSP B;  2EOD A;  5DFB A;  4AUQ B;  5HEN A;  4CA1 A;  5I3L A;  4GNF A;  1EQF A;  5EWV A;  4QR3 A;  4MSX A;  5A83 A;  5EVA A;  4UYH A;  5ENH A;  2KWK A;  5AD2 A;  2YQM A;  4NYW A;  2WP2 A;  5KTW A;  4UYG A;  4IOR A;  5A81 A;  5IBN A;  2I50 A;  2DWW A;  4W4U A;  1WUG A;  4LYS A;  2NXB A;  2D82 A;  2LXH C;  1WIM A;  5LCW B;  1WIL A;  4HBV A;  3P1E A;  5CS8 A;  5I88 A;  5DIN A;  5KHM A;  5LJ1 A;  3ZYQ A;  4A4B A;  5CQ6 A;  2UZG A;  5B76 A;  5A5N A;  4YAD A;  2OUO A;  4AYC A;  4CCG X;  5CQ5 A;  4Z1S A;  2FUI A;  2DX8 A;  2I8N A;  2YQD A;  4NRC A;  3MB3 A;  3U5K A;  5C87 A;  5D1K B;  2RFJ A;  3HME A;  3K2J A;  3O36 A;  5I1Q A;  5FE8 A;  5I7Y A;  4YC9 A;  5F25 A;  5BT5 A;  2MUM A;  5LVQ A;  2LQ6 A;  3C6W A;  5AMF A;  4QBM A;  1BOR A;  3L1X A;  4CUQ A;  1IYM A;  4ZQL A;  4CL9 A;  5J3X A;  4BW2 A;  5I40 A;  4YYK A;  5ENE A;  2GRC A;  1WEQ A;  2M1R A;  4XI1 A;  4BW3 A;  2OO1 A;  1X4I A;  5DLX A;  3O70 A;  4NR5 A;  4J0R A;  4TT2 A;  3P5O A;  2YEM A;  5EPS A;  5DKH A;  4LK9 A;  4QZS A;  4GB0 A;  2C2V S;  3KV5 A;  2E7N A;  4CUT A;  5DFD A;  4QR5 A;  4IC2 A;  5FBX A;  5CRM A;  3N9M A;  3SVF A;  5D3H A;  5L97 A;  2EA6 A;  5ENI A;  2YDW A;  1XWH A;  2HYE D;  5CGP A;  4F52 B;  3HCS A;  4NQM A;  5D3N A;  5II2 A;  4BW1 A;  4LAD B;  2Y1M A;  3MUL A;  2MA5 A;  5HQ6 A;  4GNE A;  4YAB A;  5CQ3 A;  1MM2 A;  1Z60 A;  3U5P A;  4QEV A;  5EWD A;  1Z6U A;  3T7L A;  2ECV A;  5E9L A;  3N9N A;  5D24 A;  1N87 A;  5FG6 A;  3ZPV E;  2VPE A;  4A9L A;  1DVP A;  5ENF A;  4A9H A;  3MHH A;  5D3S A;  5FFY A;  4IOQ A;  4IR3 A;  4CUU A;  5IGL A;  2KFT A;  5TCM A;  5D3T A;  5HJC A;  4V3L C;  5H1V A;  2PNX A;  4YK0 A;  2LGV A;  4O75 A;  2G45 A;  3LRQ A;  5FG5 A;  4P5O B;  4MEQ A;  4KV1 A;  4GND A;  5E9V A;  5DX4 A;  5DY7 A;  4UYF B;  4QF3 A;  5ETB A;  4QC3 A;  2KR4 A;  2DVQ A;  5F36 A;  4UIZ A;  5D3L A;  4WA6 A;  4QR4 A;  4B7Y C;  4N4H A;  2N9G A;  5ENB A;  5CUB A;  3I2D A;  2KU3 A;  4E96 A;  4NQN A;  2DVS A;  3MQM A;  4OUF A;  4CUR A;  2LRI C;  2MA6 A;  4YBT A;  5FH8 A;  2L0B A;  4PTB A;  5A82 A;  4UIU A;  2DAT A;  4R8P K;  4CUP A;  2YW8 A;  5A85 A;  3GG3 A;  4J3I A;  4NXJ A;  5D25 A;  5I29 A;  4CFL A;  2LV9 A;  1T1H A;  4O7B A;  5D1L B;  4N4G A;  2M85 A;  5DYA A;  1FP0 A;  1WES A;  2IDA A;  5FDZ A;  5L8U A;  4QB3 A;  2Y43 A;  5LJ0 A;  5FH7 A;  5CQ4 A;  5DLZ A;  5CUC A;  5A5P A;  4ALH A;  4YYM A;  4WZ3 B;  4TKP B;  3O33 A;  5CUG A;  2E6S A;  4TT6 A;  5F61 A;  4NR6 A;  5F5Z A;  4J1P A;  3LQJ A;  5KO4 A;  1WEP A;  4O77 A;  4O71 A;  4L7X A;  4A49 A;  1HYJ A;  4TZ2 A;  4YBM A;  4YY4 A;  4O7F A;  4YYG A;  4MR4 A;  2CKL B;  2MD8 C;  2R10 A;  5FE0 A;  1JM7 B;  4NRA A;  4OGJ A;  5FE5 A;  2RNX A;  3MHS A;  5I86 A;  3QZT A;  2VJF B;  1WE9 A;  5EU1 A;  4B86 C;  5C4Q A;  1G25 A;  5K29 A;  2YSJ A;  3Q2F A;  5II1 A; 
#chains in the Genus database with same CATH topology
 1WEO A;  3SUB A;  4X2I A;  5E9M A;  5H1U A;  3NG2 A;  5EA1 A;  5KTX A;  4O64 A;  4LYW A;  5CUD A;  4QSV A;  5C85 A;  4LKA A;  3U5N A;  4MEO A;  5KH3 A;  3SVH A;  3UVD A;  5EM3 A;  3UVY A;  3JUE A;  3ERR A;  3LQH A;  1ZKR A;  4QYD A;  4XUB A;  1JM4 B;  4BW4 A;  2KGI A;  4HXR A;  4N4I A;  3UVW A;  1WEM A;  1VFY A;  4IOO A;  4QSW A;  5ENC A;  5EQ1 A;  2M13 A;  2YW5 A;  5C8G A;  2L5U A;  5F60 A;  5C7N A;  2YHO A;  2KWJ A;  4AKH A;  4Q0N A;  2B0O E;  5CUA A;  4N4F A;  1E6I A;  4R2Y A;  4AP4 A;  5HQ7 A;  3Q2E A;  5CRZ A;  4WIV A;  5FB0 A;  1JOC A;  4ALG A;  2CSZ A;  4AKN A;  1N72 A;  4MEP A;  2DSM A;  2MIQ A;  5E9K A;  2EGP A;  2D9E A;  3PLW A;  4L58 A;  5L96 A;  3T9K A;  4PS5 A;  2KRE A;  4O76 A;  2KWO A;  1WEU A;  5IGM A;  5FE2 A;  1MM3 A;  4DON A;  4UIT A;  2FUU A;  2H0D A;  2K17 A;  4NRB A;  5DFC A;  2RR4 A;  1WGM A;  2VJF A;  5TB6 A;  2XB1 A;  2MD7 B;  5G04 B;  5J0D A;  5EI4 A;  4QSP A;  4Z6H A;  3MXF A;  5EPR A;  1E4U A;  2M3H A;  4XUA A;  2KTB B;  5LKX A;  2JM3 A;  4AI6 A;  4O72 A;  2ECJ A;  2OXQ C;  4WZ2 A;  4O78 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  4A9O A;  5KU3 A;  4H9D A;  4TT4 A;  3PHD A;  5LKT A;  3SOW A;  2LAU A;  2QIC A;  4IC3 A;  3UV2 A;  5G05 B;  5A5S A;  5D3R A;  1F62 A;  2YYN A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  4WHW A;  1JM7 A;  4PY6 A;  5EWW A;  5L8T A;  3N9L A;  5TDR A;  5TBN A;  3SHB A;  5LKZ A;  3H7H A;  5TDW A;  1WEV A;  5HRV A;  5DYU A;  3HMH A;  3P1C A;  5D7X A;  4YYI A;  5ACY A;  3FEH A;  5I89 A;  3G0L A;  5CFW A;  4A9F A;  3M63 A;  2MNZ A;  4RVR A;  1X4U A;  2YUR A;  3C5K A;  2XOY A;  4BJX A;  4NUC A;  3S91 A;  5A5R A;  2LXP C;  3IHP A;  5LJ2 A;  2LGG A;  2YYR A;  4O7E A;  5E74 A;  3P1D A;  3D7C A;  3U5J A;  4QSQ A;  5FE9 A;  2VP7 A;  3O35 A;  4A9M A;  2XOZ A;  2MT5 A;  4XY9 A;  5EWC A;  4MR5 A;  5B77 A;  3HMF A;  5H85 A;  3I3J A;  3IU6 A;  5A5Q A;  5FH6 A;  2F6N A;  2L84 A;  5CPE A;  2MJV B;  3UW9 A;  5COI A;  1CHC A;  3SOX A;  5B8D A;  4J0S A;  3AQA A;  2HDP A;  2MNY A;  1VD4 A;  5B75 A;  2VJE A;  4HXO A;  2E3K A;  4QQ4 A;  3EB5 A;  4V3K C;  4LZ2 A;  3JVM A;  3SOU A;  4BHW A;  4UYE A;  4A9J A;  3S92 A;  3ZPV 1;  4UYD A;  4LLB A;  3IU5 A;  5FE7 A;  3ZTG A;  4IR4 A;  5EWH A;  2YQL A;  5E0R A;  4YY6 A;  2KYU A;  5CQ8 A;  5DW2 A;  4QC1 A;  5IGK A;  2BAY A;  3DDT A;  3FAO A;  3D1B A;  4UYF A;  3DPL R;  2R0Y A;  4HXN A;  3GV4 A;  5ENG A;  2DJA A;  5JWM A;  1FBV A;  3DWD A;  2ZET C;  2CON A;  3T6R A;  4R7E A;  2PUY A;  2DVV A;  4QSX A;  2ECT A;  5DKA A;  3LXJ A;  2D8S A;  5IGN A;  3VK6 A;  1MBM A;  2YEK A;  4A9E A;  5BT3 A;  3U5L A;  4YH3 A;  1WEW A;  1VYX A;  5CQT A;  5HFQ A;  5EK9 A;  2YEL A;  5EIS A;  3RCW A;  4YYN A;  4XYA A;  4TYL A;  5HM0 A;  5HQ5 A;  4QNS A;  3FL2 A;  3LQI A;  3ZNI A;  4O7A A;  5F62 A;  3L1Z B;  5AME A;  4QST A;  4CLB A;  5FFV A;  4FJC A;  2RS9 B;  3JVL A;  3M62 A;  3VKG A;  3DWY A;  4GPJ A;  2H60 A;  4NS5 A;  4NN2 A;  4CUS A;  4A9N A;  2RSD A;  5FG4 A;  4MR6 A;  4FO9 A;  2DVR A;  2E7O A;  3O34 A;  4FK5 A;  3FKM X;  4HXP A;  4LJN A;  4HXL A;  5L98 A;  4S3O B;  2IQJ A;  5FE6 A;  5EPB A;  2XP0 A;  3RPG B;  4UI9 B;  2H0D B;  4YYD A;  2KIZ A;  5E7D A;  5TAB A;  4TQN A;  4PPE A;  5DKD A;  4LRG A;  4QSU A;  4NR9 A;  4Q6F A;  4AKI A;  4TTE A;  4QF2 A;  2KE1 A;  5FEY A;  4NYX A;  1LDK C;  4X3G A;  2DKW A;  2CSY A;  4O70 A;  5E3G A;  5HEM A;  4NR4 A;  5EIC A;  5HLS A;  2VJE B;  2FSA A;  3M7K A;  1RMD A;  4QUU A;  2FD4 A;  4NR8 A;  4PKL A;  3UV5 A;  2ECI A;  4I7D A;  2YU4 A;  3V43 A;  4BBQ A;  5CY9 A;  2JMJ A;  5IID A;  1ZBD B;  3L11 A;  2CSV A;  3MUK A;  5LKU A;  5HFR A;  2Y1N A;  2EXU A;  5F1L A;  2L75 A;  5AIU A;  4QEW A;  1JSP B;  3KQI A;  5D3P A;  2JUN A;  2LN0 A;  5H1T A;  4YAT A;  3N9Q A;  5FER A;  1ZS5 A;  4F3I A;  3RPG C;  3P1F A;  5TRB A;  3HCU A;  4HXK A;  4I7B A;  4S3O C;  2VNF A;  3G0J A;  5F2P A;  2XEU A;  4OGE A;  2L80 A;  5G4S A;  3UVX A;  4Y03 A;  3UV4 A;  5AD3 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  2CRW A;  4A4C A;  4O7C A;  2L5E A;  4NYV A;  5FE1 A;  5LUU A;  4MVT A;  4WZ0 A;  5SVI B;  2AN6 A;  5FFW A;  3ASL A;  3AAD A;  5FE3 A;  5C13 A;  4FLP A;  4Z6I A;  5HRX A;  2LGK A;  2YSM A;  2R0V A;  3E2D A;  4IR6 A;  4LZR A;  3TLP A;  3NXB A;  5F63 A;  5I7X A;  2YHN A;  4MEN A;  4TU4 A;  3M99 A;  4CFK A;  1F68 A;  3KV6 A;  5JG6 A;  4YBS A;  4Z93 A;  5SVX A;  5DYC A;  3DQV R;  2EJN A;  2R0S A;  2CKL A;  5D1M B;  5FE4 A;  5EYA F;  4HXS A;  5D26 A;  5DKC A;  4ZC9 A;  5F3A A;  3ZVZ B;  3QZS A;  5F1H A;  2I7K A;  4O74 A;  4UP0 A;  3LVR E;  5LVR A;  5IG6 A;  4OGI A;  2F42 A;  5DBM A;  4UIV A;  2OSS A;  2VPB A;  5I80 A;  5L99 A;  3JVK A;  4TZ8 A;  2E6R A;  4QY4 A;  1WEN A;  4C67 A;  3QZV A;  4HBX A;  2K16 A;  4ZUX U;  4AVX A;  2G4A A;  5A5O A;  2OWA A;  5E9I A;  2ECW A;  4LDF A;  3SVG A;  4AKG A;  4Z1Q A;  4HBY A;  5B78 A;  5B79 A;  2QIZ A;  3LVQ E;  5C89 A;  5E9Y A;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  5ENJ A;  4YYJ A;  2JRJ A;  3RTR B;  4F1P A;  2RO1 A;  4PCE A;  5H9M A;  2RNW A;  2K4D A;  4I7C A;  4QYL A;  3KNV A;  2KGG A;  2LDR A;  4TU6 A;  2WP1 A;  4UIX A;  5EGU A;  4QSR A;  2G43 A;  5DYX A;  4HXM A;  5E73 A;  5JI8 A;  5HCL A;  3MB4 A;  1WUM A;  2JMI A;  3HTK C;  4TS8 A;  4LC2 A;  5ETD A;  5G4R A;  5CTL A;  5C11 A;  4UP5 A;  4FIP A;  5HRW A;  3VKH A;  1V87 A;  5CP5 A;  3GL6 A;  4AYC B;  5EP7 A;  3ZYU A;  4NUD A;  4PCI A;  5EV9 A;  4LYI A;  5FB1 A;  4MR3 A;  4A9I A;  5D3J A;  4LR6 A;  5CQA A;  5KTU A;  4KCX A;  4QSS A;  4HBW A;  5CQ7 A;  2EGM A;  2KKX A;  3EB6 A;  5E3D A;  2L43 A;  5BT4 A;  2RNY A;  4NR7 A;  5CZG A;  2JMD A;  2L85 A;  4YAX A;  4KV4 A;  4YYH A;  2G6Q A;  5K3Q A;  4WHU A;  2XOC A;  2YRE A;  5CU8 A;  5KH7 A;  2QJ0 A;  5CUE A;  3DAI A;  3HCT A;  5D0C A;  2FFW A;  4C66 A;  2YVR A;  5G0F A;  3O7A A;  1WFK A;  4LZS A;  5AIT A;  1X0J A;  2VPD A;  4NUE A;  4XY8 A;  4QEU A;  2K1J A;  1HYI A;  1Z2Q A;  3LJW A;  4UIY A;  2M6M A;  3U5O A;  3U5M A;  5I83 A;  4N3W A;  5DW1 A;  3MDB C;  3PUR A;  4IR5 A;  5A7C A;  4A9K A;  3JVJ A;  2RI7 A;  4YH4 A;  2NAA A;  4ZW1 A;  2L7P A;  3ONI A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  4QUT A;  5HEL A;  4Q0O A;  4UIW A;  2YUC A;  2LSP B;  2EOD A;  5DFB A;  4AUQ B;  5HEN A;  4CA1 A;  5I3L A;  4GNF A;  1EQF A;  5EWV A;  4QR3 A;  4MSX A;  5A83 A;  5EVA A;  1PUO A;  4UYH A;  5ENH A;  2KWK A;  5AD2 A;  2E61 A;  2YQM A;  4NYW A;  4O62 A;  2MKE A;  2WP2 A;  5KTW A;  4UYG A;  4IOR A;  5A81 A;  5IBN A;  2I50 A;  2DWW A;  4W4U A;  1WUG A;  2KKY A;  4LYS A;  2NXB A;  2D82 A;  2LXH C;  1WIM A;  5LCW B;  1DCQ A;  1WIL A;  4HBV A;  3P1E A;  5SVI A;  5CS8 A;  5I88 A;  5DIN A;  5KHM A;  5LJ1 A;  3ZYQ A;  4A4B A;  5CQ6 A;  2UZG A;  5B76 A;  5A5N A;  4YAD A;  2OUO A;  4AYC A;  4CCG X;  5CQ5 A;  4Z1S A;  2FUI A;  2DX8 A;  2I8N A;  2YQD A;  4NRC A;  3MB3 A;  3U5K A;  5C87 A;  5D1K B;  2RFJ A;  3HME A;  3K2J A;  3O36 A;  5I1Q A;  5FE8 A;  5I7Y A;  2P57 A;  3FAN A;  4YC9 A;  5F25 A;  5BT5 A;  2MUM A;  5LVQ A;  2D8U A;  2LQ6 A;  3C6W A;  3Q1D A;  5AMF A;  4QBM A;  1BOR A;  3L1X A;  4CUQ A;  1IYM A;  4ZQL A;  4CL9 A;  3LJU X;  5J3X A;  4BW2 A;  5I40 A;  4YYK A;  5ENE A;  2GRC A;  1WEQ A;  2M1R A;  4XI1 A;  4BW3 A;  2OO1 A;  1X4I A;  5DLX A;  3O70 A;  4NR5 A;  5SVY A;  4J0R A;  4TT2 A;  3P5O A;  2YEM A;  5EPS A;  5DKH A;  4LK9 A;  4QZS A;  3O47 A;  4GB0 A;  4Z0R A;  2C2V S;  3KV5 A;  2E7N A;  4CUT A;  5DFD A;  4QR5 A;  4IC2 A;  5FBX A;  5CRM A;  3N9M A;  3SVF A;  5D3H A;  5L97 A;  2EA6 A;  5ENI A;  2YDW A;  1XWH A;  2HYE D;  5CGP A;  4F52 B;  3HCS A;  4NQM A;  5D3N A;  5II2 A;  4BW1 A;  4LAD B;  2Y1M A;  3MUL A;  2MA5 A;  5HQ6 A;  2CRR A;  4GNE A;  4YAB A;  5CQ3 A;  1MM2 A;  1Z60 A;  3U5P A;  4QEV A;  5EWD A;  1Z6U A;  3T7L A;  2ECV A;  5E9L A;  3N9N A;  5D24 A;  1N87 A;  5FG6 A;  4OGC A;  3ZPV E;  2VPE A;  4A9L A;  1DVP A;  5ENF A;  4A9H A;  3MHH A;  5D3S A;  5FFY A;  4IOQ A;  4IR3 A;  4CUU A;  5IGL A;  3FJU B;  2KFT A;  3D1D A;  5TCM A;  5D3T A;  5HJC A;  4V3L C;  5H1V A;  2PNX A;  3KDE C;  4YK0 A;  2LGV A;  4O75 A;  2G45 A;  3LRQ A;  5FG5 A;  4P5O B;  4MEQ A;  4KV1 A;  4GND A;  5E9V A;  5DX4 A;  5DY7 A;  4UYF B;  4QF3 A;  5ETB A;  4QC3 A;  2KR4 A;  2DVQ A;  5F36 A;  4UIZ A;  5D3L A;  4WA6 A;  4QR4 A;  4B7Y C;  4N4H A;  2N9G A;  5ENB A;  5CUB A;  3I2D A;  4Z0O A;  2KU3 A;  4E96 A;  4NQN A;  2DVS A;  3MQM A;  4OUF A;  4CUR A;  2LRI C;  3FM8 C;  2MA6 A;  4YBT A;  5FH8 A;  2L0B A;  4PTB A;  5A82 A;  4UIU A;  2DAT A;  4R8P K;  4CUP A;  2YW8 A;  5A85 A;  3GG3 A;  4J3I A;  4NXJ A;  5D25 A;  5I29 A;  4CFL A;  2LV9 A;  1T1H A;  4O7B A;  5D1L B;  4N4G A;  2M85 A;  5DYA A;  1FP0 A;  3LDY A;  1WES A;  2IDA A;  5FDZ A;  5L8U A;  4QB3 A;  2Y43 A;  5LJ0 A;  5FH7 A;  5CQ4 A;  5DLZ A;  5CUC A;  5A5P A;  4ALH A;  4YYM A;  4WZ3 B;  4TKP B;  3O33 A;  5CUG A;  2E6S A;  4TT6 A;  5F61 A;  4NR6 A;  5F5Z A;  4J1P A;  3LQJ A;  5KO4 A;  1WEP A;  4O77 A;  4O71 A;  4L7X A;  4A49 A;  1HYJ A;  4TZ2 A;  4YBM A;  4YY4 A;  4O7F A;  4YYG A;  4MR4 A;  2CKL B;  2MD8 C;  2R10 A;  5FE0 A;  1JM7 B;  4NRA A;  4OGJ A;  5FE5 A;  2RNX A;  3MHS A;  5I86 A;  3QZT A;  2VJF B;  1WE9 A;  5EU1 A;  4B86 C;  5C4Q A;  1G25 A;  5K29 A;  2YSJ A;  3Q2F A;  5II1 A; 
#chains in the Genus database with same CATH homology
 1WEO A;  4X2I A;  5E9M A;  5H1U A;  3NG2 A;  5EA1 A;  5KTX A;  4O64 A;  4LYW A;  5CUD A;  4QSV A;  5C85 A;  4LKA A;  3U5N A;  4MEO A;  5KH3 A;  3SVH A;  3UVD A;  5EM3 A;  3UVY A;  3LQH A;  4XUB A;  4QYD A;  1JM4 B;  4BW4 A;  2KGI A;  4HXR A;  4N4I A;  3UVW A;  1WEM A;  1VFY A;  4IOO A;  4QSW A;  5ENC A;  5EQ1 A;  2YW5 A;  5C8G A;  2L5U A;  5F60 A;  5C7N A;  2YHO A;  2KWJ A;  4Q0N A;  5CUA A;  4N4F A;  1E6I A;  4R2Y A;  4AP4 A;  5HQ7 A;  3Q2E A;  5CRZ A;  4WIV A;  5FB0 A;  1JOC A;  4ALG A;  2CSZ A;  4AKN A;  1N72 A;  4MEP A;  2MIQ A;  5E9K A;  2EGP A;  2D9E A;  4L58 A;  5L96 A;  4PS5 A;  2KRE A;  4O76 A;  2KWO A;  1WEU A;  5IGM A;  5FE2 A;  1MM3 A;  4DON A;  4UIT A;  2FUU A;  2H0D A;  2K17 A;  4NRB A;  5DFC A;  1WGM A;  2VJF A;  5TB6 A;  2XB1 A;  2MD7 B;  5G04 B;  5J0D A;  5EI4 A;  4QSP A;  4Z6H A;  3MXF A;  5EPR A;  1E4U A;  2M3H A;  4XUA A;  2KTB B;  5LKX A;  4O72 A;  2ECJ A;  2OXQ C;  4WZ2 A;  4O78 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  4A9O A;  5KU3 A;  4TT4 A;  3PHD A;  5LKT A;  3SOW A;  2QIC A;  4IC3 A;  3UV2 A;  5G05 B;  5A5S A;  5D3R A;  1F62 A;  2YYN A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  4WHW A;  1JM7 A;  4PY6 A;  5EWW A;  5L8T A;  3N9L A;  5TDR A;  5TBN A;  3SHB A;  5LKZ A;  5TDW A;  1WEV A;  5HRV A;  5DYU A;  3HMH A;  3P1C A;  5D7X A;  4YYI A;  5ACY A;  5I89 A;  3G0L A;  5CFW A;  4A9F A;  3M63 A;  2MNZ A;  4RVR A;  1X4U A;  2YUR A;  3C5K A;  4BJX A;  4NUC A;  3S91 A;  5A5R A;  2LXP C;  3IHP A;  5LJ2 A;  2LGG A;  2YYR A;  4O7E A;  5E74 A;  3P1D A;  3D7C A;  3U5J A;  4QSQ A;  5FE9 A;  2VP7 A;  3O35 A;  4A9M A;  2MT5 A;  4XY9 A;  5EWC A;  4MR5 A;  5B77 A;  3HMF A;  5H85 A;  3I3J A;  3IU6 A;  5A5Q A;  5FH6 A;  2F6N A;  2L84 A;  5CPE A;  2MJV B;  3UW9 A;  5COI A;  1CHC A;  3SOX A;  5B8D A;  4J0S A;  3AQA A;  2HDP A;  2MNY A;  1VD4 A;  5B75 A;  2VJE A;  4HXO A;  2E3K A;  3EB5 A;  4V3K C;  4LZ2 A;  3JVM A;  3SOU A;  4BHW A;  4UYE A;  4A9J A;  3S92 A;  3ZPV 1;  4UYD A;  4LLB A;  3IU5 A;  5FE7 A;  3ZTG A;  4IR4 A;  5EWH A;  2YQL A;  5E0R A;  4YY6 A;  2KYU A;  5CQ8 A;  5DW2 A;  4QC1 A;  5IGK A;  2BAY A;  4UYF A;  3DPL R;  2R0Y A;  4HXN A;  3GV4 A;  5ENG A;  5JWM A;  1FBV A;  2ZET C;  3T6R A;  4R7E A;  2PUY A;  2DVV A;  4QSX A;  2ECT A;  5DKA A;  3LXJ A;  2D8S A;  5IGN A;  3VK6 A;  2YEK A;  4A9E A;  5BT3 A;  3U5L A;  4YH3 A;  1WEW A;  1VYX A;  5CQT A;  5HFQ A;  5EK9 A;  2YEL A;  5EIS A;  3RCW A;  4YYN A;  4XYA A;  4TYL A;  5HM0 A;  5HQ5 A;  4QNS A;  3FL2 A;  3LQI A;  3ZNI A;  4O7A A;  5F62 A;  3L1Z B;  5AME A;  4QST A;  4CLB A;  5FFV A;  4FJC A;  2RS9 B;  3JVL A;  3M62 A;  3DWY A;  4GPJ A;  2H60 A;  4NS5 A;  4NN2 A;  4CUS A;  4A9N A;  2RSD A;  5FG4 A;  4MR6 A;  4FO9 A;  2DVR A;  2E7O A;  3O34 A;  4FK5 A;  3FKM X;  4HXP A;  4LJN A;  4HXL A;  5L98 A;  4S3O B;  5FE6 A;  5EPB A;  3RPG B;  4UI9 B;  2H0D B;  4YYD A;  2KIZ A;  5E7D A;  5TAB A;  4TQN A;  4PPE A;  5DKD A;  4LRG A;  4QSU A;  4NR9 A;  4Q6F A;  4TTE A;  4QF2 A;  2KE1 A;  5FEY A;  4NYX A;  1LDK C;  4X3G A;  2DKW A;  2CSY A;  4O70 A;  5E3G A;  5HEM A;  4NR4 A;  5EIC A;  5HLS A;  2VJE B;  2FSA A;  1RMD A;  4QUU A;  4NR8 A;  4PKL A;  3UV5 A;  2ECI A;  4I7D A;  2YU4 A;  3V43 A;  4BBQ A;  5CY9 A;  2JMJ A;  5IID A;  1ZBD B;  3L11 A;  3MUK A;  5LKU A;  5HFR A;  2Y1N A;  5F1L A;  2L75 A;  5AIU A;  4QEW A;  1JSP B;  3KQI A;  5D3P A;  2LN0 A;  3N9Q A;  5H1T A;  4YAT A;  5FER A;  1ZS5 A;  4F3I A;  3RPG C;  3P1F A;  5TRB A;  3HCU A;  4HXK A;  4I7B A;  4S3O C;  2VNF A;  3G0J A;  5F2P A;  2XEU A;  2L80 A;  5G4S A;  3UVX A;  4Y03 A;  3UV4 A;  5AD3 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  4A4C A;  4O7C A;  2L5E A;  4NYV A;  5FE1 A;  5LUU A;  4MVT A;  4WZ0 A;  2AN6 A;  5FFW A;  3ASL A;  3AAD A;  5FE3 A;  5C13 A;  4FLP A;  4Z6I A;  5HRX A;  2LGK A;  2YSM A;  2R0V A;  4IR6 A;  4LZR A;  3TLP A;  3NXB A;  5F63 A;  5I7X A;  2YHN A;  4MEN A;  4TU4 A;  3M99 A;  4CFK A;  1F68 A;  3KV6 A;  5JG6 A;  4YBS A;  4Z93 A;  5DYC A;  3DQV R;  2R0S A;  2CKL A;  5D1M B;  5FE4 A;  5EYA F;  4HXS A;  5D26 A;  5DKC A;  4ZC9 A;  5F3A A;  3ZVZ B;  3QZS A;  5F1H A;  2I7K A;  4O74 A;  4UP0 A;  5LVR A;  5IG6 A;  4OGI A;  2F42 A;  5DBM A;  4UIV A;  2OSS A;  2VPB A;  5I80 A;  5L99 A;  3JVK A;  4TZ8 A;  2E6R A;  4QY4 A;  1WEN A;  4C67 A;  3QZV A;  4HBX A;  2K16 A;  4ZUX U;  4AVX A;  2G4A A;  5A5O A;  5E9I A;  2ECW A;  4LDF A;  3SVG A;  5B78 A;  4Z1Q A;  4HBY A;  5B79 A;  2QIZ A;  5C89 A;  5E9Y A;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  5ENJ A;  4YYJ A;  2JRJ A;  3RTR B;  2RO1 A;  4PCE A;  5H9M A;  2RNW A;  2K4D A;  4I7C A;  4QYL A;  3KNV A;  2KGG A;  2LDR A;  4TU6 A;  2WP1 A;  4UIX A;  5EGU A;  4QSR A;  2G43 A;  5DYX A;  4HXM A;  5E73 A;  5JI8 A;  5HCL A;  3MB4 A;  1WUM A;  2JMI A;  3HTK C;  4TS8 A;  4LC2 A;  5ETD A;  5G4R A;  5CTL A;  5C11 A;  4UP5 A;  4FIP A;  5HRW A;  1V87 A;  5CP5 A;  3GL6 A;  4AYC B;  5EP7 A;  3ZYU A;  4NUD A;  4PCI A;  5EV9 A;  4LYI A;  5FB1 A;  4MR3 A;  4A9I A;  5D3J A;  4LR6 A;  5CQA A;  5KTU A;  4KCX A;  4QSS A;  4HBW A;  5CQ7 A;  3EB6 A;  5E3D A;  2L43 A;  5BT4 A;  2RNY A;  4NR7 A;  5CZG A;  2JMD A;  2L85 A;  4YAX A;  4KV4 A;  4YYH A;  2G6Q A;  4WHU A;  2YRE A;  5CU8 A;  5KH7 A;  2QJ0 A;  5CUE A;  3DAI A;  3HCT A;  5D0C A;  4C66 A;  5G0F A;  3O7A A;  1WFK A;  4LZS A;  5AIT A;  1X0J A;  2VPD A;  4NUE A;  4XY8 A;  4QEU A;  2K1J A;  1HYI A;  1Z2Q A;  3LJW A;  4UIY A;  2M6M A;  3U5O A;  3U5M A;  5I83 A;  4N3W A;  5DW1 A;  3PUR A;  4IR5 A;  5A7C A;  4A9K A;  3JVJ A;  2RI7 A;  4YH4 A;  2NAA A;  4ZW1 A;  3ONI A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  4QUT A;  5HEL A;  4Q0O A;  4UIW A;  2YUC A;  2LSP B;  2EOD A;  5DFB A;  4AUQ B;  5HEN A;  4CA1 A;  5I3L A;  4GNF A;  1EQF A;  5EWV A;  4QR3 A;  4MSX A;  5A83 A;  5EVA A;  4UYH A;  5ENH A;  2KWK A;  5AD2 A;  2YQM A;  4NYW A;  2WP2 A;  5KTW A;  4UYG A;  4IOR A;  5A81 A;  5IBN A;  2I50 A;  2DWW A;  4W4U A;  1WUG A;  4LYS A;  2NXB A;  2D82 A;  2LXH C;  1WIM A;  5LCW B;  1WIL A;  4HBV A;  3P1E A;  5CS8 A;  5I88 A;  5DIN A;  5KHM A;  5LJ1 A;  3ZYQ A;  4A4B A;  5CQ6 A;  2UZG A;  5B76 A;  5A5N A;  4YAD A;  2OUO A;  4AYC A;  4CCG X;  5CQ5 A;  4Z1S A;  2FUI A;  2DX8 A;  2I8N A;  2YQD A;  4NRC A;  3MB3 A;  3U5K A;  5C87 A;  5D1K B;  2RFJ A;  3HME A;  3K2J A;  3O36 A;  5I1Q A;  5FE8 A;  5I7Y A;  4YC9 A;  5F25 A;  5BT5 A;  2MUM A;  5LVQ A;  2LQ6 A;  3C6W A;  5AMF A;  4QBM A;  1BOR A;  3L1X A;  4CUQ A;  1IYM A;  4ZQL A;  4CL9 A;  5J3X A;  4BW2 A;  5I40 A;  4YYK A;  5ENE A;  2GRC A;  1WEQ A;  2M1R A;  4XI1 A;  4BW3 A;  2OO1 A;  1X4I A;  5DLX A;  3O70 A;  4NR5 A;  4J0R A;  4TT2 A;  3P5O A;  2YEM A;  5EPS A;  5DKH A;  4LK9 A;  4QZS A;  4GB0 A;  2C2V S;  3KV5 A;  2E7N A;  4CUT A;  5DFD A;  4QR5 A;  4IC2 A;  5FBX A;  5CRM A;  3N9M A;  3SVF A;  5D3H A;  5L97 A;  2EA6 A;  5ENI A;  2YDW A;  1XWH A;  2HYE D;  5CGP A;  4F52 B;  3HCS A;  4NQM A;  5D3N A;  5II2 A;  4BW1 A;  4LAD B;  2Y1M A;  3MUL A;  2MA5 A;  5HQ6 A;  4GNE A;  4YAB A;  5CQ3 A;  1MM2 A;  1Z60 A;  3U5P A;  4QEV A;  5EWD A;  1Z6U A;  3T7L A;  2ECV A;  5E9L A;  3N9N A;  5D24 A;  1N87 A;  5FG6 A;  3ZPV E;  2VPE A;  4A9L A;  1DVP A;  5ENF A;  4A9H A;  3MHH A;  5D3S A;  5FFY A;  4IOQ A;  4IR3 A;  4CUU A;  5IGL A;  2KFT A;  5TCM A;  5D3T A;  5HJC A;  4V3L C;  5H1V A;  2PNX A;  4YK0 A;  2LGV A;  4O75 A;  2G45 A;  3LRQ A;  5FG5 A;  4P5O B;  4MEQ A;  4KV1 A;  4GND A;  5E9V A;  5DX4 A;  5DY7 A;  4UYF B;  4QF3 A;  5ETB A;  4QC3 A;  2KR4 A;  2DVQ A;  5F36 A;  4UIZ A;  5D3L A;  4WA6 A;  4QR4 A;  4B7Y C;  4N4H A;  2N9G A;  5ENB A;  5CUB A;  3I2D A;  2KU3 A;  4E96 A;  4NQN A;  2DVS A;  3MQM A;  4OUF A;  4CUR A;  2LRI C;  2MA6 A;  4YBT A;  5FH8 A;  2L0B A;  4PTB A;  5A82 A;  4UIU A;  2DAT A;  4R8P K;  4CUP A;  2YW8 A;  5A85 A;  3GG3 A;  4J3I A;  4NXJ A;  5D25 A;  5I29 A;  4CFL A;  2LV9 A;  1T1H A;  4O7B A;  5D1L B;  4N4G A;  2M85 A;  5DYA A;  1FP0 A;  1WES A;  2IDA A;  5FDZ A;  5L8U A;  4QB3 A;  2Y43 A;  5LJ0 A;  5FH7 A;  5CQ4 A;  5DLZ A;  5CUC A;  5A5P A;  4ALH A;  4YYM A;  4WZ3 B;  4TKP B;  3O33 A;  5CUG A;  2E6S A;  4TT6 A;  5F61 A;  4NR6 A;  5F5Z A;  4J1P A;  3LQJ A;  5KO4 A;  1WEP A;  4O77 A;  4O71 A;  4L7X A;  4A49 A;  1HYJ A;  4TZ2 A;  4YBM A;  4YY4 A;  4O7F A;  4YYG A;  4MR4 A;  2CKL B;  2MD8 C;  2R10 A;  5FE0 A;  1JM7 B;  4NRA A;  4OGJ A;  5FE5 A;  2RNX A;  3MHS A;  5I86 A;  3QZT A;  2VJF B;  1WE9 A;  5EU1 A;  4B86 C;  5C4Q A;  1G25 A;  5K29 A;  2YSJ A;  3Q2F A;  5II1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...