4N4FA

Crystal structure of the bromodomain-phd finger module of human transcriptional co-activator cbp in complex with di-acetylated histone 4 peptide (h412ack16ac).
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
232
structure length
191
Chain Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 55
structure length 191
sequence length 232
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF06001 DUF902 Domain of Unknown Function (DUF902)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4n4fA01
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4n4fA02
4S3OC 4YH3A 5KH9A 5E9YA 4HBYA 4QSQA 5G04B 4LLBA 3HMFA 5HRWA 4NXJA 4MR5A 5A85A 5L99A 5HRVA 1U6GB 5C11A 3UVYA 5B79A 5DFDA 5LJ0A 4GB0A 2RNYA 5DFBA 2KWOA 2G43A 5ACYA 4YABA 2RI7A 4GPJA 4YYKA 2M85A 5CGPA 3P1CA 4TKPB 2YEKA 5G4RA 1E4UA 5EPBA 4RVRA 4J0SA 3MHHA 5B78A 2I8NA 4WHWA 1DVPA 2VJEB 4HXPA 4QSUA 2VNFA 5TRBA 4NYXA 5H1TA 4HXKA 5HM0A 3C5KA 4Z6HA 4R2YA 2ZETC 2KR4A 4V3LC 2I50A 5FE0A 2KREA 5A5OA 2VPDA 2OSSA 4YH4A 5A82A 3MHSA 3LJWA 5BT3A 4N4FA 3LRQA 5DKCA 2K16A 2LGVA 1FP0A 3UV4A 4ALGA 3QZTA 4WHUA 3U5KA 4NUEA 4UYFB 2QJ0A 4KCXA 5CQ8A 4FO9A 5HQ5A 5EWCA 2MNZA 5AD2A 4FK5A 5C85A 3O7AA 4GNGA 2YW5A 5EQ1A 3U5JA 1MM2A 4O76A 3GV4A 4QBMA 4UIYA 4F52B 1WEOA 2L0BA 2OUOA 4LC2A 5D1LB 1X4IA 4LZRA 3O33A 3PUQA 5ENEA 4L58A 2E7OA 5KU3A 3KV6A 4A9OA 4A9LA 4GNFA 2LXPC 1X4JA 1JM7B 2L43A 1F68A 2LGKA 4QF3A 4O72A 1X4UA 5F1LA 4NN2A 4Y03A 2GRCA 5FBXA 4IR6A 3UW9A 5F2PA 2OXQC 4YYHA 4HXSA 4MSXA 4AYCA 2MJVB 3LXJA 3Q2EA 4QEWA 3Q2FA 5D3SA 3T6RA 3K2JA 5L96A 2YHNA 3L11A 5A83A 4CUPA 2M6MA 4P5OB 5C89A 4QSRA 4N4GA 5AMEA 3V43A 5CQAA 5A5PA 4X3GA 1WUMA 2YQDA 4NUDA 4Z1QA 5DLXA 2VJFB 5D1KB 5F5ZA 5ENJA 2YU4A 1WEWA 5D3RA 4KV4A 4N3WA 4X2IA 5CUEA 5FH6A 4QSWA 4LZSA 4NRCA 5DKHA 5D3HA 2ECIA 4IC3A 3O37A 5CFWA 5EGUA 5ENFA 5LKTA 5ENHA 2MD7B 3O70A 5DYXA 5D24A 5TDRA 5EYAF 5FFWA 2RNWA 5ETDA 5FE4A 5LKXA 5HJCA 5FG6A 5E9KA 5CUAA 1VFYA 3SVHA 4XY8A 1BORA 3ZTGA 2YSJA 5TDWA 3S91A 1WUGA 4UIUA 4BW2A 4AVXA 2VP7A 4HXNA 4HXRA 5KHMA 4UYHA 5HQ7A 5DYAA 4A9NA 1V87A 2LV9A 5FE9A 4YYMA 3RPGC 2DX8A 3O36A 4S3OB 4TT2A 4TT6A 2KGGA 3D7CA 4QEVA 4QYDA 5A5SA 2QIZA 4QC1A 2NXBA 5C13A 1E6IA 5KH3A 2EGPA 3SOWA 5D3JA 4CL9A 2L5EA 3QZVA 2CSYA 4LRGA 3P1DA 4YBTA 3DWYA 4QR4A 2UZGA 4I7CA 5AIUA 4QB3A 3JVMA 3MB3A 4B7YC 3C6WA 4B86C 4UIZA 4DONA 4QNSA 2YURA 4Q0NA 2LGLA 4QSXA 3UV5A 5B75A 3N9MA 5A5RA 4YYNA 1EQFA 5I40A 5IBNA 5IG6A 5A5NA 2KWNA 4NRBA 5E9IA 3GL6A 4XI1A 4A9IA 4PCEA 4CUUA 4QSSA 3PHDA 4CURA 5E0RA 2MIQA 3KV5A 5HCLA 3NG2A 4FIPA 2FUIA 3EB5A 4QSTA 4KV1A 5E3DA 2DVQA 4LADB 4AP4A 4QR5A 2FUUA 3HTKC 4PPEA 5IIDA 2MA6A 5KH7A 5H85A 5CQ5A 5JG6A 3UVWA 3QZSA 2K1JA 5LKUA 4O7EA 5AITA 3VK6A 5I89A 5C87A 2DVVA 4HBVA 4PTBA 3N9NA 4LYSA 5EVAA 4NYWA 5F62A 5KO4A 4TTEA 1HYIA 4QR3A 4A4BA 5EP7A 5E7DA 4LZ2A 4QSVA 5EM3A 5F36A 3O34A 5D26A 5CQ7A 3FL2A 3UVDA 3GG3A 5FB0A 5E9LA 2H60A 4TYLA 3FKMX 4TQNA 2C2VS 2K17A 1MM3A 2G4AA 2C2LA 1ZBDB 4UYDA 5FE3A 1WE9A 2HYED 2D9EA 3G0LA 2L85A 4UP5A 5DW2A 5EISA 3N9PA 5CPEA 3RCWA 5FH8A 3N9LA 4UIWA 5LVQA 4BHWA 4BW1A 2DWWA 4R7EA 2MA5A 4YYDA 4MENA 5TB6A 5DLZA 1X0JA 4UYEA 5A81A 4HXOA 4A9EA 4TZ2A 2MNYA 3DQVR 1G25A 4MR6A 5F25A 1WESA 4CLBA 2YELA 5G0FA 4NR8A 4HBWA 1HYJA 2KYUA 4LR6A 5BT5A 5KTUA 2EODA 4PKLA 4IOOA 4A9MA 5E73A 5TCMA 4GNEA 5KTWA 2MT5A 2KTBB 4LKAA 5FDZA 4CUTA 2G45A 3JVJA 3IU5A 3LQIA 4O71A 2PUYA 5FB1A 3UVXA 2HDPA 3HMEA 2Y43A 5I7XA 4NR7A 4MVTA 5KTXA 4I7BA 2VPBA 5B76A 5FE7A 4Q6FA 4AYCB 1JM4B 1Z2QA 5CUGA 3RTRB 2N9GA 2RNXA 5A5QA 2OO1A 5DYUA 5CRZA 4YYGA 5FFYA 1JSPB 5CQ3A 3MQMA 3ZYUA 4YBSA 4QYLA 4ZC9A 3P5OA 4C67A 3ZNIA 5K29A 4A0CD 1VD4A 1WEQA 4YAXA 4BBQA 5L98A 4O70A 3SOUA 5IGNA 4OGIA 2CT2A 2ECWA 4CUSA 4LJNA 4NS5A 3RPGB 3EB6A 5ENIA 2H0DA 5E74A 2RO1A 2DATA 5CS8A 4LYIA 5B8DA 3IHPA 4QSPA 4L7XA 5II1A 5J3XA 2FSAA 4Z6IA 5E3GA 2R0SA 5DFCA 2JMDA 2CKLA 4C9ZA 4AKNA 5LCWB 5I3LA 5II2A 3ZVYA 4XY9A 3MUKA 2KGIA 4TS8A 4UP0A 2QICA 1WEVA 5HQ6A 3JVLA 1VYXA 5D3PA 4QF2A 2VPEA 4MR4A 2ECNA 4O7AA 3U5PA 4UYGA 5DYCA 4QZSA 2JMIA 5EWDA 5AMFA 5JWMA 3PURA 5E9VA 5H9MA 4CA1A 3N9OA 4N4HA 4BW4A 2ECTA 4IR5A 4MEQA 4MEOA 2YEMA 3SVFA 2PNXA 2KE1A 2R0VA 5HFQA 2YW8A 1F62A 4PCIA 3IU6A 2F6JA 5EU1A 3HCSA 4A9JA 5D7XA 4NYVA 3SVGA 1N72A 5FH7A 2CSZA 5I29A 2WP2A 5I1QA 5F61A 3S92A 5CTLA 5D3LA 1WEEA 3L1XA 2YQMA 5ENCA 4QEUA 2IDAA 4PS5A 1Z6UA 5FE8A 4NUCA 5DBMA 3U5NA 1WFKA 5CQTA 3DAIA 4NR6A 4IC2A 4C66A 5C7NA 4QUUA 5C4QA 2YUCA 3N9QA 3ZPVE 2I7KA 2L80A 3U5MA 3U5OA 4YATA 1Z60A 4O64A 5FG4A 2Y1MA 4UIXA 5CQ4A 2KIZA 4V3KC 5D25A 5CUCA 3O35A 5CU8A 5EPRA 2F6NA 4XUAA 3P1EA 4YY4A 2NAAA 3SHBA 3ZPV1 2ECVA 2LN0A 2LRIC 2VJEA 2D82A 2XB1A 3I2DA 4NQNA 5EV9A 2R0YA 4ZW1A 4XUBA 5JI8A 1WILA 4N4IA 4E96A 4NR9A 4O77A 4CUQA 2DKWA 4QY4A 3M99A 2L5UA 2ECGA 2LDRA 4ZQLA 4A9KA 3UV2A 2AN6A 2E6SA 5B77A 5D3TA 4O78A 4Z1SA 2MUMA 5TABA 5F60A 5FE1A 2LGGA 4YADA 2D8SA 5EICA 3HCTA 4A9FA 2YT5A 4YY6A 4WA6A 4WZ0A 3T7LA 4CFLA 3HMHA 1ZS5A 4CFKA 2YQLA 4TU6A 3HCUA 5EPSA 4UYFA 4BW3A 4J0RA 5H1VA 4IORA 2LXHC 4UITA 5HRXA 5L8TA 5IGLA 2EA6A 5BT4A 1IYMA 3AADA 5LKZA 3SOXA 1WEMA 2E3KA 2RFJA 5DKDA 5DX4A 5EA1A 3ONIA 5H1UA 5I7YA 5FEYA 1N87A 3M63A 5LUUA 3LQJA 5FFVA 1WENA 2VPGA 2MD8C 5CUBA 4Q0OA 1WIMA 1JM7A 4TZ8A 5A7CA 5LJ1A 1CHCA 3LQHA 4FLPA 3I3JA 4OGJA 5CZGA 5IGKA 4I7DA 2R10A 2YYNA 5EWVA 1WEUA 5ETBA 3AQAA 5G4SA 5C8GA 1RMDA 2RSDA 4A9HA 4IOQA 5DY7A 5ENBA 2K4DA 4O7BA 5F63A 4NR5A 4O7FA 5LJ2A 4YC9A 3DPLR 4LDFA 3MB4A 5HEMA 3ZVZB 5FE5A 2YREA 4YK0A 5HENA 5HLSA 2G6QA 1T1HA 2YYRA 4HXMA 1LDJB 4NRAA 4OUFA 5FERA 4F3IA 2DVSA 4O75A 5G05B 3MULA 2VJFA 2RS9B 4YYIA 5I80A 5FG5A 1LDKC 2F42A 3NXBA 4AUQB 3U5LA 4LK9A 5F1HA 3KQIA 2Y1NA 3P1FA 2DVRA 3G0JA 3MXFA 2E7NA 4NQMA 4O74A 4PY6A 5FE6A 5IGMA 5J0DA 2WP1A 4ZUXU 2KFTA 5D0CA 4QUTA 5HFRA 4MR3A 4QC3A 4YYJA 2BAYA 5CY9A 4ZDTA 3TLPA 5I83A 3L1ZB 5CQ6A 3KNVA 2LQ6A 5D1MB 5COIA 2H0DB 4GNDA 5EWHA 4WIVA 2E6RA 4NR4A 4A49A 5L8UA 5TBNA 4IR4A 4WZ2A 3ASLA 5FE2A 2KU3A 3JVKA 3ZYQA 4O7CA 5L97A 5EK9A 2XEUA 2ECJA 2YHOA 4BJXA 4J1PA 2L75A 4WZ3B 2CKLB 1XWHA 2KWKA 3M62A 5E9MA 5F3AA 4TT4A 5LVRA 1K2FA 2M3HA 4CCGX 2YSMA 1WEPA 5I88A 4FJCA 4A4CA 4TU4A 5HELA 4MEPA 5DINA 4Z93A 2LSPB 4UI9B 2YDWA 4J3IA 4XYAA 5D3NA 5CP5A 5DKAA 4W4UA 5EWWA 4ALHA 4LYWA 5DW1A 5AD3A 1JOCA 5ENGA 2KWJA 5CRMA 1FBVA 1WGMA 5CUDA 2JMJA 4R8PK 2M1RA 4IR3A 5I86A 2JRJA 2L84A 4UIVA 4YBMA 5EI4A 4HXLA 4HBXA
chains in the Genus database with same CATH superfamily
4S3OC 4YH3A 5KH9A 5E9YA 4HBYA 4QSQA 5G04B 3FAOA 4LLBA 3HMFA 5HRWA 4NXJA 4MR5A 5A85A 5L99A 5HRVA 1U6GB 5C11A 3UVYA 5B79A 3FM8C 5DFDA 5LJ0A 4GB0A 2RNYA 5DFBA 2KWOA 2EGMA 2G43A 5ACYA 4YABA 2RI7A 4GPJA 4YYKA 2M85A 5CGPA 3P1CA 4TKPB 2YEKA 3MDBC 5G4RA 1E4UA 5EPBA 4RVRA 4J0SA 3MHHA 5B78A 2I8NA 4WHWA 1DVPA 2VJEB 4HXPA 4QSUA 2VNFA 5TRBA 4NYXA 5H1TA 4HXKA 5HM0A 3C5KA 4Z6HA 4R2YA 2ZETC 2KR4A 4V3LC 2I50A 5FE0A 4AKIA 2KREA 5A5OA 2VPDA 2OSSA 4YH4A 5A82A 3MHSA 3LJWA 5K3QA 3Q1DA 3SUBA 5BT3A 4N4FA 2MKEA 3LRQA 5DKCA 2K16A 2LGVA 1FP0A 3UV4A 4ALGA 3QZTA 4WHUA 5SVIB 3U5KA 4NUEA 4UYFB 2FD4A 4KCXA 2QJ0A 5CQ8A 4FO9A 5HQ5A 5EWCA 2MNZA 5AD2A 4FK5A 5C85A 3O7AA 4GNGA 2YW5A 5EQ1A 3U5JA 1MM2A 4O76A 3GV4A 4QBMA 4UIYA 4F52B 1WEOA 2L0BA 2OUOA 4LC2A 5D1LB 1X4IA 4LZRA 3O33A 3PUQA 5ENEA 4L58A 2E7OA 5KU3A 3KV6A 4A9OA 4A9LA 4GNFA 2LXPC 1X4JA 1JM7B 2L43A 1F68A 2LGKA 4QF3A 4O72A 1X4UA 5F1LA 4NN2A 4Y03A 2GRCA 5FBXA 4IR6A 3UW9A 5F2PA 2OXQC 3FANA 4YYHA 4HXSA 4MSXA 2M13A 4AYCA 2MJVB 3LXJA 3Q2EA 4QEWA 3Q2FA 5D3SA 3T6RA 3K2JA 5L96A 2YHNA 3L11A 2XOYA 5A83A 4CUPA 2M6MA 4P5OB 5C89A 3LVQE 4QSRA 4N4GA 5AMEA 3V43A 5CQAA 5A5PA 4X3GA 1WUMA 2YQDA 4NUDA 4Z1QA 5DLXA 2VJFB 5D1KB 5F5ZA 5ENJA 2YU4A 1WEWA 5D3RA 4KV4A 4N3WA 4X2IA 5CUEA 5FH6A 4QSWA 4LZSA 4NRCA 5DKHA 5D3HA 2ECIA 4IC3A 3O37A 5CFWA 5EGUA 5ENFA 5LKTA 5ENHA 2MD7B 3O70A 1PUOA 5DYXA 5D24A 5TDRA 5EYAF 5FFWA 2RNWA 5ETDA 5FE4A 2E61A 5LKXA 3KDEC 5HJCA 5FG6A 4AKGA 4OGEA 3D1DA 5E9KA 5CUAA 1VFYA 3SVHA 4XY8A 1BORA 3ZTGA 2YSJA 5TDWA 3S91A 1WUGA 4UIUA 4BW2A 4AVXA 2VP7A 4HXNA 4HXRA 2FFWA 5KHMA 4UYHA 5HQ7A 5DYAA 4A9NA 3T9KA 3LVRE 1V87A 2CRRA 2LV9A 5FE9A 4YYMA 3RPGC 2DX8A 3O36A 4S3OB 4TT2A 4TT6A 2KGGA 3D7CA 4QEVA 4QYDA 5A5SA 2QIZA 2XP0A 4QC1A 2NXBA 5C13A 1E6IA 5KH3A 2EGPA 3SOWA 5D3JA 3LDYA 4CL9A 2L5EA 3QZVA 2CSYA 4LRGA 3P1DA 3PLWA 4YBTA 3LJUX 3DWYA 4QR4A 2UZGA 2JUNA 4I7CA 5AIUA 4QB3A 3JVMA 3MB3A 4B7YC 3C6WA 4B86C 4UIZA 4DONA 4QNSA 2YURA 4Q0NA 2LGLA 4QSXA 3UV5A 5B75A 3N9MA 5A5RA 4YYNA 1EQFA 5I40A 2CRWA 5IBNA 5IG6A 5A5NA 2KWNA 4NRBA 5E9IA 3GL6A 4XI1A 4A9IA 4PCEA 4CUUA 2JM3A 4QSSA 3PHDA 4CURA 5E0RA 2MIQA 3KV5A 5HCLA 3NG2A 4FIPA 2FUIA 3EB5A 4QSTA 4KV1A 5E3DA 2DVQA 4LADB 4AP4A 4QR5A 2FUUA 3HTKC 4PPEA 5IIDA 2MA6A 5KH7A 5H85A 5CQ5A 5JG6A 3UVWA 3QZSA 2K1JA 3D1BA 4O7EA 5LKUA 5AITA 3VK6A 2L7PA 5I89A 5C87A 2DVVA 4HBVA 4PTBA 3E2DA 3N9NA 4LYSA 5EVAA 4NYWA 5F62A 5KO4A 4TTEA 1HYIA 4QR3A 4A4BA 5EP7A 5E7DA 3VKHA 4LZ2A 4QSVA 5EM3A 5F36A 3O34A 5D26A 5CQ7A 3FL2A 3UVDA 3GG3A 5FB0A 5E9LA 2H60A 4TYLA 3FKMX 4TQNA 2C2VS 2K17A 2YVRA 1MM3A 2G4AA 2C2LA 1ZBDB 4UYDA 5FE3A 1WE9A 2HYED 2D9EA 3G0LA 2L85A 4AKHA 5DW2A 4UP5A 5EISA 3N9PA 5CPEA 3RCWA 5FH8A 3N9LA 4UIWA 5LVQA 4BHWA 4BW1A 2DWWA 4R7EA 2MA5A 4YYDA 4MENA 5TB6A 5DLZA 1X0JA 4UYEA 5A81A 4HXOA 4A9EA 4TZ2A 2MNYA 3DQVR 1G25A 4MR6A 5F25A 1WESA 4CLBA 2YELA 5G0FA 4NR8A 4HBWA 1HYJA 2KYUA 4LR6A 5BT5A 5KTUA 2EODA 2KKYA 4PKLA 4IOOA 4A9MA 5E73A 5TCMA 4GNEA 5KTWA 2MT5A 2KTBB 4LKAA 5FDZA 4CUTA 2G45A 3JVJA 3IU5A 3LQIA 4O71A 2PUYA 5FB1A 3UVXA 2HDPA 3HMEA 3H7HA 2Y43A 5I7XA 4NR7A 4MVTA 5KTXA 4I7BA 2VPBA 5B76A 5FE7A 4Q6FA 4AYCB 1JM4B 1Z2QA 5CUGA 3RTRB 2N9GA 2RNXA 5A5QA 2OO1A 5DYUA 5CRZA 4YYGA 5FFYA 1JSPB 5CQ3A 3MQMA 3ZYUA 4YBSA 4QYLA 4ZC9A 3ERRA 3P5OA 4C67A 5K29A 3ZNIA 4A0CD 2XOCA 1VD4A 1WEQA 4YAXA 4BBQA 5L98A 4O70A 3SOUA 5IGNA 4OGIA 2CT2A 2ECWA 4CUSA 4LJNA 4NS5A 3RPGB 3EB6A 5ENIA 2H0DA 5E74A 2RO1A 2DATA 5CS8A 4F1PA 4LYIA 5B8DA 3IHPA 4QSPA 4L7XA 5II1A 5J3XA 2FSAA 4Z6IA 5E3GA 2R0SA 5DFCA 2JMDA 2CKLA 4C9ZA 4AKNA 5SVYA 5LCWB 5I3LA 5II2A 3ZVYA 4XY9A 3MUKA 2KGIA 4TS8A 4UP0A 2QICA 1WEVA 5HQ6A 3JVLA 1VYXA 5D3PA 2D8UA 4QF2A 3O47A 2VPEA 4MR4A 2ECNA 4O7AA 3U5PA 4UYGA 5DYCA 4QZSA 2JMIA 5EWDA 5AMFA 5JWMA 3PURA 2LAUA 5E9VA 5H9MA 2EXUA 4CA1A 3N9OA 4N4HA 4BW4A 2ECTA 4IR5A 4MEQA 4MEOA 2YEMA 3SVFA 2OWAA 2PNXA 2KE1A 2R0VA 5HFQA 2YW8A 1F62A 4PCIA 3IU6A 2F6JA 5EU1A 3HCSA 4A9JA 5D7XA 4AI6A 4NYVA 3SVGA 1DCQA 1N72A 5FH7A 2CSZA 5I29A 2WP2A 5I1QA 5F61A 3S92A 5CTLA 5D3LA 1WEEA 3L1XA 2YQMA 5ENCA 4QEUA 2IDAA 4PS5A 1Z6UA 5FE8A 4NUCA 5DBMA 3U5NA 1WFKA 5CQTA 3DAIA 4Z0RA 4NR6A 4IC2A 4C66A 5C7NA 4QUUA 5C4QA 2YUCA 3FJUB 3N9QA 3ZPVE 2I7KA 2L80A 3U5MA 3U5OA 4YATA 1Z60A 4O64A 5FG4A 2Y1MA 4UIXA 5CQ4A 4OGCA 2KIZA 4V3KC 5D25A 5CUCA 3O35A 5CU8A 5SVXA 5EPRA 2F6NA 4XUAA 3P1EA 4YY4A 2NAAA 3SHBA 3ZPV1 2ECVA 2LN0A 2LRIC 2VJEA 2D82A 2XB1A 3I2DA 4NQNA 5EV9A 2R0YA 4ZW1A 4XUBA 5JI8A 1WILA 4N4IA 4E96A 4NR9A 4O77A 4CUQA 2IQJA 2DKWA 4QY4A 3M99A 2L5UA 2ECGA 2LDRA 4ZQLA 4A9KA 3UV2A 2AN6A 2E6SA 5B77A 5D3TA 4O78A 4Z1SA 2MUMA 2KKXA 5TABA 5F60A 5FE1A 2LGGA 4YADA 2D8SA 5EICA 3HCTA 4A9FA 2YT5A 4YY6A 4WA6A 4WZ0A 3T7LA 4CFLA 3HMHA 1ZS5A 4CFKA 2YQLA 4TU6A 3HCUA 5EPSA 5SVIA 4O62A 4UYFA 4BW3A 4J0RA 5H1VA 4IORA 2LXHC 4UITA 5HRXA 5L8TA 5IGLA 2EA6A 5BT4A 1IYMA 3AADA 5LKZA 3SOXA 1WEMA 2E3KA 2RFJA 5DKDA 5DX4A 5EA1A 3ONIA 5H1UA 5I7YA 2CSVA 1N87A 5FEYA 3M63A 5LUUA 3LQJA 5FFVA 1WENA 2P57A 2VPGA 2MD8C 5CUBA 4Q0OA 1WIMA 1JM7A 4TZ8A 5A7CA 5LJ1A 1CHCA 3LQHA 4FLPA 3I3JA 4OGJA 5CZGA 2EJNA 5IGKA 4I7DA 2R10A 2YYNA 5EWVA 1WEUA 5ETBA 3M7KA 3AQAA 5G4SA 5C8GA 1RMDA 2RSDA 4A9HA 4IOQA 5DY7A 5ENBA 2XOZA 2K4DA 4Z0OA 4O7BA 5F63A 4NR5A 4O7FA 5LJ2A 4YC9A 3DPLR 4LDFA 3MB4A 5HEMA 3ZVZB 5FE5A 2YREA 2CONA 4YK0A 5HENA 5HLSA 2G6QA 1T1HA 2YYRA 4HXMA 4H9DA 1LDJB 4NRAA 4OUFA 5FERA 4F3IA 3VKGA 2DVSA 4O75A 5G05B 3MULA 2VJFA 2RS9B 4YYIA 5I80A 5FG5A 1LDKC 2F42A 3NXBA 4AUQB 3U5LA 4LK9A 2RR4A 5F1HA 3KQIA 2Y1NA 3P1FA 2DVRA 3G0JA 3MXFA 2E7NA 4NQMA 4O74A 4PY6A 5FE6A 5IGMA 5J0DA 4QQ4A 2WP1A 4ZUXU 2KFTA 5D0CA 4QUTA 5HFRA 4MR3A 1ZKRA 4QC3A 4YYJA 2BAYA 5CY9A 4ZDTA 3TLPA 5I83A 3L1ZB 5CQ6A 3KNVA 2LQ6A 5D1MB 5COIA 2H0DB 4GNDA 5EWHA 4WIVA 2E6RA 4NR4A 4A49A 5L8UA 5TBNA 4IR4A 4WZ2A 3ASLA 5FE2A 2KU3A 3JVKA 3ZYQA 4O7CA 5L97A 5EK9A 2XEUA 2ECJA 2YHOA 4BJXA 4J1PA 2L75A 4WZ3B 2CKLB 1XWHA 2KWKA 3DWDA 3M62A 5E9MA 5F3AA 4TT4A 5LVRA 1K2FA 3JUEA 2M3HA 4CCGX 2YSMA 1WEPA 5I88A 4FJCA 4A4CA 4TU4A 5HELA 4MEPA 5DINA 4Z93A 2LSPB 4UI9B 2DSMA 2YDWA 4J3IA 4XYAA 5D3NA 5CP5A 5DKAA 4W4UA 5EWWA 4ALHA 4LYWA 5DW1A 5AD3A 1JOCA 1MBMA 5ENGA 2KWJA 2DJAA 5CRMA 1FBVA 1WGMA 5CUDA 3FEHA 2JMJA 4R8PK 2M1RA 3DDTA 4IR3A 5I86A 2JRJA 2B0OE 2L84A 4UIVA 4YBMA 5EI4A 4HXLA 4HBXA
chains in the Genus database with same CATH topology
4S3OC 4YH3A 5KH9A 5E9YA 4HBYA 4QSQA 5G04B 4LLBA 3HMFA 5HRWA 4NXJA 4MR5A 5A85A 5L99A 5HRVA 1U6GB 5C11A 3UVYA 5B79A 5DFDA 5LJ0A 4GB0A 2RNYA 5DFBA 2KWOA 2G43A 5ACYA 4YABA 2RI7A 4GPJA 4YYKA 2M85A 5CGPA 3P1CA 4TKPB 2YEKA 5G4RA 1E4UA 5EPBA 4RVRA 4J0SA 3MHHA 5B78A 2I8NA 4WHWA 1DVPA 2VJEB 4HXPA 4QSUA 2VNFA 5TRBA 4NYXA 5H1TA 4HXKA 5HM0A 3C5KA 4Z6HA 4R2YA 2ZETC 2KR4A 4V3LC 2I50A 5FE0A 2KREA 5A5OA 2VPDA 2OSSA 4YH4A 5A82A 3MHSA 3LJWA 5BT3A 4N4FA 3LRQA 5DKCA 2K16A 2LGVA 1FP0A 3UV4A 4ALGA 3QZTA 4WHUA 3U5KA 4NUEA 4UYFB 2QJ0A 4KCXA 5CQ8A 4FO9A 5HQ5A 5EWCA 2MNZA 5AD2A 4FK5A 5C85A 3O7AA 4GNGA 2YW5A 5EQ1A 3U5JA 1MM2A 4O76A 3GV4A 4QBMA 4UIYA 4F52B 1WEOA 2L0BA 2OUOA 4LC2A 5D1LB 1X4IA 4LZRA 3O33A 3PUQA 5ENEA 4L58A 2E7OA 5KU3A 3KV6A 4A9OA 4A9LA 4GNFA 2LXPC 1X4JA 1JM7B 2L43A 1F68A 2LGKA 4QF3A 4O72A 1X4UA 5F1LA 4NN2A 4Y03A 2GRCA 5FBXA 4IR6A 3UW9A 5F2PA 2OXQC 4YYHA 4HXSA 4MSXA 4AYCA 2MJVB 3LXJA 3Q2EA 4QEWA 3Q2FA 5D3SA 3T6RA 3K2JA 5L96A 2YHNA 3L11A 5A83A 4CUPA 2M6MA 4P5OB 5C89A 4QSRA 4N4GA 5AMEA 3V43A 5CQAA 5A5PA 4X3GA 1WUMA 2YQDA 4NUDA 4Z1QA 5DLXA 2VJFB 5D1KB 5F5ZA 5ENJA 2YU4A 1WEWA 5D3RA 4KV4A 4N3WA 4X2IA 5CUEA 5FH6A 4QSWA 4LZSA 4NRCA 5DKHA 5D3HA 2ECIA 4IC3A 3O37A 5CFWA 5EGUA 5ENFA 5LKTA 5ENHA 2MD7B 3O70A 5DYXA 5D24A 5TDRA 5EYAF 5FFWA 2RNWA 5ETDA 5FE4A 5LKXA 5HJCA 5FG6A 5E9KA 5CUAA 1VFYA 3SVHA 4XY8A 1BORA 3ZTGA 2YSJA 5TDWA 3S91A 1WUGA 4UIUA 4BW2A 4AVXA 2VP7A 4HXNA 4HXRA 5KHMA 4UYHA 5HQ7A 5DYAA 4A9NA 1V87A 2LV9A 5FE9A 4YYMA 3RPGC 2DX8A 3O36A 4S3OB 4TT2A 4TT6A 2KGGA 3D7CA 4QEVA 4QYDA 5A5SA 2QIZA 4QC1A 2NXBA 5C13A 1E6IA 5KH3A 2EGPA 3SOWA 5D3JA 4CL9A 2L5EA 3QZVA 2CSYA 4LRGA 3P1DA 4YBTA 3DWYA 4QR4A 2UZGA 4I7CA 5AIUA 4QB3A 3JVMA 3MB3A 4B7YC 3C6WA 4B86C 4UIZA 4DONA 4QNSA 2YURA 4Q0NA 2LGLA 4QSXA 3UV5A 5B75A 3N9MA 5A5RA 4YYNA 1EQFA 5I40A 5IBNA 5IG6A 5A5NA 2KWNA 4NRBA 5E9IA 3GL6A 4XI1A 4A9IA 4PCEA 4CUUA 4QSSA 3PHDA 4CURA 5E0RA 2MIQA 3KV5A 5HCLA 3NG2A 4FIPA 2FUIA 3EB5A 4QSTA 4KV1A 5E3DA 2DVQA 4LADB 4AP4A 4QR5A 2FUUA 3HTKC 4PPEA 5IIDA 2MA6A 5KH7A 5H85A 5CQ5A 5JG6A 3UVWA 3QZSA 2K1JA 5LKUA 4O7EA 5AITA 3VK6A 5I89A 5C87A 2DVVA 4HBVA 4PTBA 3N9NA 4LYSA 5EVAA 4NYWA 5F62A 5KO4A 4TTEA 1HYIA 4QR3A 4A4BA 5EP7A 5E7DA 4LZ2A 4QSVA 5EM3A 5F36A 3O34A 5D26A 5CQ7A 3FL2A 3UVDA 3GG3A 5FB0A 5E9LA 2H60A 4TYLA 3FKMX 4TQNA 2C2VS 2K17A 1MM3A 2G4AA 2C2LA 1ZBDB 4UYDA 5FE3A 1WE9A 2HYED 2D9EA 3G0LA 2L85A 4UP5A 5DW2A 5EISA 3N9PA 5CPEA 3RCWA 5FH8A 3N9LA 4UIWA 5LVQA 4BHWA 4BW1A 2DWWA 4R7EA 2MA5A 4YYDA 4MENA 5TB6A 5DLZA 1X0JA 4UYEA 5A81A 4HXOA 4A9EA 4TZ2A 2MNYA 3DQVR 1G25A 4MR6A 5F25A 1WESA 4CLBA 2YELA 5G0FA 4NR8A 4HBWA 1HYJA 2KYUA 4LR6A 5BT5A 5KTUA 2EODA 4PKLA 4IOOA 4A9MA 5E73A 5TCMA 4GNEA 5KTWA 2MT5A 2KTBB 4LKAA 5FDZA 4CUTA 2G45A 3JVJA 3IU5A 3LQIA 4O71A 2PUYA 5FB1A 3UVXA 2HDPA 3HMEA 2Y43A 5I7XA 4NR7A 4MVTA 5KTXA 4I7BA 2VPBA 5B76A 5FE7A 4Q6FA 4AYCB 1JM4B 1Z2QA 5CUGA 3RTRB 2N9GA 2RNXA 5A5QA 2OO1A 5DYUA 5CRZA 4YYGA 5FFYA 1JSPB 5CQ3A 3MQMA 3ZYUA 4YBSA 4QYLA 4ZC9A 3P5OA 4C67A 3ZNIA 5K29A 4A0CD 1VD4A 1WEQA 4YAXA 4BBQA 5L98A 4O70A 3SOUA 5IGNA 4OGIA 2CT2A 2ECWA 4CUSA 4LJNA 4NS5A 3RPGB 3EB6A 5ENIA 2H0DA 5E74A 2RO1A 2DATA 5CS8A 4LYIA 5B8DA 3IHPA 4QSPA 4L7XA 5II1A 5J3XA 2FSAA 4Z6IA 5E3GA 2R0SA 5DFCA 2JMDA 2CKLA 4C9ZA 4AKNA 5LCWB 5I3LA 5II2A 3ZVYA 4XY9A 3MUKA 2KGIA 4TS8A 4UP0A 2QICA 1WEVA 5HQ6A 3JVLA 1VYXA 5D3PA 4QF2A 2VPEA 4MR4A 2ECNA 4O7AA 3U5PA 4UYGA 5DYCA 4QZSA 2JMIA 5EWDA 5AMFA 5JWMA 3PURA 5E9VA 5H9MA 4CA1A 3N9OA 4N4HA 4BW4A 2ECTA 4IR5A 4MEQA 4MEOA 2YEMA 3SVFA 2PNXA 2KE1A 2R0VA 5HFQA 2YW8A 1F62A 4PCIA 3IU6A 2F6JA 5EU1A 3HCSA 4A9JA 5D7XA 4NYVA 3SVGA 1N72A 5FH7A 2CSZA 5I29A 2WP2A 5I1QA 5F61A 3S92A 5CTLA 5D3LA 1WEEA 3L1XA 2YQMA 5ENCA 4QEUA 2IDAA 4PS5A 1Z6UA 5FE8A 4NUCA 5DBMA 3U5NA 1WFKA 5CQTA 3DAIA 4NR6A 4IC2A 4C66A 5C7NA 4QUUA 5C4QA 2YUCA 3N9QA 3ZPVE 2I7KA 2L80A 3U5MA 3U5OA 4YATA 1Z60A 4O64A 5FG4A 2Y1MA 4UIXA 5CQ4A 2KIZA 4V3KC 5D25A 5CUCA 3O35A 5CU8A 5EPRA 2F6NA 4XUAA 3P1EA 4YY4A 2NAAA 3SHBA 3ZPV1 2ECVA 2LN0A 2LRIC 2VJEA 2D82A 2XB1A 3I2DA 4NQNA 5EV9A 2R0YA 4ZW1A 4XUBA 5JI8A 1WILA 4N4IA 4E96A 4NR9A 4O77A 4CUQA 2DKWA 4QY4A 3M99A 2L5UA 2ECGA 2LDRA 4ZQLA 4A9KA 3UV2A 2AN6A 2E6SA 5B77A 5D3TA 4O78A 4Z1SA 2MUMA 5TABA 5F60A 5FE1A 2LGGA 4YADA 2D8SA 5EICA 3HCTA 4A9FA 2YT5A 4YY6A 4WA6A 4WZ0A 3T7LA 4CFLA 3HMHA 1ZS5A 4CFKA 2YQLA 4TU6A 3HCUA 5EPSA 4UYFA 4BW3A 4J0RA 5H1VA 4IORA 2LXHC 4UITA 5HRXA 5L8TA 5IGLA 2EA6A 5BT4A 1IYMA 3AADA 5LKZA 3SOXA 1WEMA 2E3KA 2RFJA 5DKDA 5DX4A 5EA1A 3ONIA 5H1UA 5I7YA 5FEYA 1N87A 3M63A 5LUUA 3LQJA 5FFVA 1WENA 2VPGA 2MD8C 5CUBA 4Q0OA 1WIMA 1JM7A 4TZ8A 5A7CA 5LJ1A 1CHCA 3LQHA 4FLPA 3I3JA 4OGJA 5CZGA 5IGKA 4I7DA 2R10A 2YYNA 5EWVA 1WEUA 5ETBA 3AQAA 5G4SA 5C8GA 1RMDA 2RSDA 4A9HA 4IOQA 5DY7A 5ENBA 2K4DA 4O7BA 5F63A 4NR5A 4O7FA 5LJ2A 4YC9A 3DPLR 4LDFA 3MB4A 5HEMA 3ZVZB 5FE5A 2YREA 4YK0A 5HENA 5HLSA 2G6QA 1T1HA 2YYRA 4HXMA 1LDJB 4NRAA 4OUFA 5FERA 4F3IA 2DVSA 4O75A 5G05B 3MULA 2VJFA 2RS9B 4YYIA 5I80A 5FG5A 1LDKC 2F42A 3NXBA 4AUQB 3U5LA 4LK9A 5F1HA 3KQIA 2Y1NA 3P1FA 2DVRA 3G0JA 3MXFA 2E7NA 4NQMA 4O74A 4PY6A 5FE6A 5IGMA 5J0DA 2WP1A 4ZUXU 2KFTA 5D0CA 4QUTA 5HFRA 4MR3A 4QC3A 4YYJA 2BAYA 5CY9A 4ZDTA 3TLPA 5I83A 3L1ZB 5CQ6A 3KNVA 2LQ6A 5D1MB 5COIA 2H0DB 4GNDA 5EWHA 4WIVA 2E6RA 4NR4A 4A49A 5L8UA 5TBNA 4IR4A 4WZ2A 3ASLA 5FE2A 2KU3A 3JVKA 3ZYQA 4O7CA 5L97A 5EK9A 2XEUA 2ECJA 2YHOA 4BJXA 4J1PA 2L75A 4WZ3B 2CKLB 1XWHA 2KWKA 3M62A 5E9MA 5F3AA 4TT4A 5LVRA 1K2FA 2M3HA 4CCGX 2YSMA 1WEPA 5I88A 4FJCA 4A4CA 4TU4A 5HELA 4MEPA 5DINA 4Z93A 2LSPB 4UI9B 2YDWA 4J3IA 4XYAA 5D3NA 5CP5A 5DKAA 4W4UA 5EWWA 4ALHA 4LYWA 5DW1A 5AD3A 1JOCA 5ENGA 2KWJA 5CRMA 1FBVA 1WGMA 5CUDA 2JMJA 4R8PK 2M1RA 4IR3A 5I86A 2JRJA 2L84A 4UIVA 4YBMA 5EI4A 4HXLA 4HBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3O C;  4YH3 A;  5KH9 A;  5E9Y A;  4HBY A;  4QSQ A;  5G04 B;  4LLB A;  3HMF A;  5HRW A;  4NXJ A;  4MR5 A;  5A85 A;  5L99 A;  5HRV A;  1U6G B;  5C11 A;  3UVY A;  5B79 A;  5DFD A;  5LJ0 A;  4GB0 A;  2RNY A;  5DFB A;  2KWO A;  2G43 A;  5ACY A;  4YAB A;  2RI7 A;  4GPJ A;  4YYK A;  2M85 A;  5CGP A;  3P1C A;  4TKP B;  2YEK A;  5G4R A;  1E4U A;  5EPB A;  4RVR A;  4J0S A;  3MHH A;  5B78 A;  2I8N A;  4WHW A;  1DVP A;  2VJE B;  4HXP A;  4QSU A;  2VNF A;  5TRB A;  4NYX A;  5H1T A;  4HXK A;  5HM0 A;  3C5K A;  4Z6H A;  4R2Y A;  2ZET C;  2KR4 A;  4V3L C;  2I50 A;  5FE0 A;  2KRE A;  5A5O A;  2VPD A;  2OSS A;  4YH4 A;  5A82 A;  3MHS A;  3LJW A;  5BT3 A;  4N4F A;  3LRQ A;  5DKC A;  2K16 A;  2LGV A;  1FP0 A;  3UV4 A;  4ALG A;  3QZT A;  4WHU A;  3U5K A;  4NUE A;  4UYF B;  2QJ0 A;  4KCX A;  5CQ8 A;  4FO9 A;  5HQ5 A;  5EWC A;  2MNZ A;  5AD2 A;  4FK5 A;  5C85 A;  3O7A A;  4GNG A;  2YW5 A;  5EQ1 A;  3U5J A;  1MM2 A;  4O76 A;  3GV4 A;  4QBM A;  4UIY A;  4F52 B;  1WEO A;  2L0B A;  2OUO A;  4LC2 A;  5D1L B;  1X4I A;  4LZR A;  3O33 A;  3PUQ A;  5ENE A;  4L58 A;  2E7O A;  5KU3 A;  3KV6 A;  4A9O A;  4A9L A;  4GNF A;  2LXP C;  1X4J A;  1JM7 B;  2L43 A;  1F68 A;  2LGK A;  4QF3 A;  4O72 A;  1X4U A;  5F1L A;  4NN2 A;  4Y03 A;  2GRC A;  5FBX A;  4IR6 A;  3UW9 A;  5F2P A;  2OXQ C;  4YYH A;  4HXS A;  4MSX A;  4AYC A;  2MJV B;  3LXJ A;  3Q2E A;  4QEW A;  3Q2F A;  5D3S A;  3T6R A;  3K2J A;  5L96 A;  2YHN A;  3L11 A;  5A83 A;  4CUP A;  2M6M A;  4P5O B;  5C89 A;  4QSR A;  4N4G A;  5AME A;  3V43 A;  5CQA A;  5A5P A;  4X3G A;  1WUM A;  2YQD A;  4NUD A;  4Z1Q A;  5DLX A;  2VJF B;  5D1K B;  5F5Z A;  5ENJ A;  2YU4 A;  1WEW A;  5D3R A;  4KV4 A;  4N3W A;  4X2I A;  5CUE A;  5FH6 A;  4QSW A;  4LZS A;  4NRC A;  5DKH A;  5D3H A;  2ECI A;  4IC3 A;  3O37 A;  5CFW A;  5EGU A;  5ENF A;  5LKT A;  5ENH A;  2MD7 B;  3O70 A;  5DYX A;  5D24 A;  5TDR A;  5EYA F;  5FFW A;  2RNW A;  5ETD A;  5FE4 A;  5LKX A;  5HJC A;  5FG6 A;  5E9K A;  5CUA A;  1VFY A;  3SVH A;  4XY8 A;  1BOR A;  3ZTG A;  2YSJ A;  5TDW A;  3S91 A;  1WUG A;  4UIU A;  4BW2 A;  4AVX A;  2VP7 A;  4HXN A;  4HXR A;  5KHM A;  4UYH A;  5HQ7 A;  5DYA A;  4A9N A;  1V87 A;  2LV9 A;  5FE9 A;  4YYM A;  3RPG C;  2DX8 A;  3O36 A;  4S3O B;  4TT2 A;  4TT6 A;  2KGG A;  3D7C A;  4QEV A;  4QYD A;  5A5S A;  2QIZ A;  4QC1 A;  2NXB A;  5C13 A;  1E6I A;  5KH3 A;  2EGP A;  3SOW A;  5D3J A;  4CL9 A;  2L5E A;  3QZV A;  2CSY A;  4LRG A;  3P1D A;  4YBT A;  3DWY A;  4QR4 A;  2UZG A;  4I7C A;  5AIU A;  4QB3 A;  3JVM A;  3MB3 A;  4B7Y C;  3C6W A;  4B86 C;  4UIZ A;  4DON A;  4QNS A;  2YUR A;  4Q0N A;  2LGL A;  4QSX A;  3UV5 A;  5B75 A;  3N9M A;  5A5R A;  4YYN A;  1EQF A;  5I40 A;  5IBN A;  5IG6 A;  5A5N A;  2KWN A;  4NRB A;  5E9I A;  3GL6 A;  4XI1 A;  4A9I A;  4PCE A;  4CUU A;  4QSS A;  3PHD A;  4CUR A;  5E0R A;  2MIQ A;  3KV5 A;  5HCL A;  3NG2 A;  4FIP A;  2FUI A;  3EB5 A;  4QST A;  4KV1 A;  5E3D A;  2DVQ A;  4LAD B;  4AP4 A;  4QR5 A;  2FUU A;  3HTK C;  4PPE A;  5IID A;  2MA6 A;  5KH7 A;  5H85 A;  5CQ5 A;  5JG6 A;  3UVW A;  3QZS A;  2K1J A;  5LKU A;  4O7E A;  5AIT A;  3VK6 A;  5I89 A;  5C87 A;  2DVV A;  4HBV A;  4PTB A;  3N9N A;  4LYS A;  5EVA A;  4NYW A;  5F62 A;  5KO4 A;  4TTE A;  1HYI A;  4QR3 A;  4A4B A;  5EP7 A;  5E7D A;  4LZ2 A;  4QSV A;  5EM3 A;  5F36 A;  3O34 A;  5D26 A;  5CQ7 A;  3FL2 A;  3UVD A;  3GG3 A;  5FB0 A;  5E9L A;  2H60 A;  4TYL A;  3FKM X;  4TQN A;  2C2V S;  2K17 A;  1MM3 A;  2G4A A;  2C2L A;  1ZBD B;  4UYD A;  5FE3 A;  1WE9 A;  2HYE D;  2D9E A;  3G0L A;  2L85 A;  4UP5 A;  5DW2 A;  5EIS A;  3N9P A;  5CPE A;  3RCW A;  5FH8 A;  3N9L A;  4UIW A;  5LVQ A;  4BHW A;  4BW1 A;  2DWW A;  4R7E A;  2MA5 A;  4YYD A;  4MEN A;  5TB6 A;  5DLZ A;  1X0J A;  4UYE A;  5A81 A;  4HXO A;  4A9E A;  4TZ2 A;  2MNY A;  3DQV R;  1G25 A;  4MR6 A;  5F25 A;  1WES A;  4CLB A;  2YEL A;  5G0F A;  4NR8 A;  4HBW A;  1HYJ A;  2KYU A;  4LR6 A;  5BT5 A;  5KTU A;  2EOD A;  4PKL A;  4IOO A;  4A9M A;  5E73 A;  5TCM A;  4GNE A;  5KTW A;  2MT5 A;  2KTB B;  4LKA A;  5FDZ A;  4CUT A;  2G45 A;  3JVJ A;  3IU5 A;  3LQI A;  4O71 A;  2PUY A;  5FB1 A;  3UVX A;  2HDP A;  3HME A;  2Y43 A;  5I7X A;  4NR7 A;  4MVT A;  5KTX A;  4I7B A;  2VPB A;  5B76 A;  5FE7 A;  4Q6F A;  4AYC B;  1JM4 B;  1Z2Q A;  5CUG A;  3RTR B;  2N9G A;  2RNX A;  5A5Q A;  2OO1 A;  5DYU A;  5CRZ A;  4YYG A;  5FFY A;  1JSP B;  5CQ3 A;  3MQM A;  3ZYU A;  4YBS A;  4QYL A;  4ZC9 A;  3P5O A;  4C67 A;  3ZNI A;  5K29 A;  4A0C D;  1VD4 A;  1WEQ A;  4YAX A;  4BBQ A;  5L98 A;  4O70 A;  3SOU A;  5IGN A;  4OGI A;  2CT2 A;  2ECW A;  4CUS A;  4LJN A;  4NS5 A;  3RPG B;  3EB6 A;  5ENI A;  2H0D A;  5E74 A;  2RO1 A;  2DAT A;  5CS8 A;  4LYI A;  5B8D A;  3IHP A;  4QSP A;  4L7X A;  5II1 A;  5J3X A;  2FSA A;  4Z6I A;  5E3G A;  2R0S A;  5DFC A;  2JMD A;  2CKL A;  4C9Z A;  4AKN A;  5LCW B;  5I3L A;  5II2 A;  3ZVY A;  4XY9 A;  3MUK A;  2KGI A;  4TS8 A;  4UP0 A;  2QIC A;  1WEV A;  5HQ6 A;  3JVL A;  1VYX A;  5D3P A;  4QF2 A;  2VPE A;  4MR4 A;  2ECN A;  4O7A A;  3U5P A;  4UYG A;  5DYC A;  4QZS A;  2JMI A;  5EWD A;  5AMF A;  5JWM A;  3PUR A;  5E9V A;  5H9M A;  4CA1 A;  3N9O A;  4N4H A;  4BW4 A;  2ECT A;  4IR5 A;  4MEQ A;  4MEO A;  2YEM A;  3SVF A;  2PNX A;  2KE1 A;  2R0V A;  5HFQ A;  2YW8 A;  1F62 A;  4PCI A;  3IU6 A;  2F6J A;  5EU1 A;  3HCS A;  4A9J A;  5D7X A;  4NYV A;  3SVG A;  1N72 A;  5FH7 A;  2CSZ A;  5I29 A;  2WP2 A;  5I1Q A;  5F61 A;  3S92 A;  5CTL A;  5D3L A;  1WEE A;  3L1X A;  2YQM A;  5ENC A;  4QEU A;  2IDA A;  4PS5 A;  1Z6U A;  5FE8 A;  4NUC A;  5DBM A;  3U5N A;  1WFK A;  5CQT A;  3DAI A;  4NR6 A;  4IC2 A;  4C66 A;  5C7N A;  4QUU A;  5C4Q A;  2YUC A;  3N9Q A;  3ZPV E;  2I7K A;  2L80 A;  3U5M A;  3U5O A;  4YAT A;  1Z60 A;  4O64 A;  5FG4 A;  2Y1M A;  4UIX A;  5CQ4 A;  2KIZ A;  4V3K C;  5D25 A;  5CUC A;  3O35 A;  5CU8 A;  5EPR A;  2F6N A;  4XUA A;  3P1E A;  4YY4 A;  2NAA A;  3SHB A;  3ZPV 1;  2ECV A;  2LN0 A;  2LRI C;  2VJE A;  2D82 A;  2XB1 A;  3I2D A;  4NQN A;  5EV9 A;  2R0Y A;  4ZW1 A;  4XUB A;  5JI8 A;  1WIL A;  4N4I A;  4E96 A;  4NR9 A;  4O77 A;  4CUQ A;  2DKW A;  4QY4 A;  3M99 A;  2L5U A;  2ECG A;  2LDR A;  4ZQL A;  4A9K A;  3UV2 A;  2AN6 A;  2E6S A;  5B77 A;  5D3T A;  4O78 A;  4Z1S A;  2MUM A;  5TAB A;  5F60 A;  5FE1 A;  2LGG A;  4YAD A;  2D8S A;  5EIC A;  3HCT A;  4A9F A;  2YT5 A;  4YY6 A;  4WA6 A;  4WZ0 A;  3T7L A;  4CFL A;  3HMH A;  1ZS5 A;  4CFK A;  2YQL A;  4TU6 A;  3HCU A;  5EPS A;  4UYF A;  4BW3 A;  4J0R A;  5H1V A;  4IOR A;  2LXH C;  4UIT A;  5HRX A;  5L8T A;  5IGL A;  2EA6 A;  5BT4 A;  1IYM A;  3AAD A;  5LKZ A;  3SOX A;  1WEM A;  2E3K A;  2RFJ A;  5DKD A;  5DX4 A;  5EA1 A;  3ONI A;  5H1U A;  5I7Y A;  5FEY A;  1N87 A;  3M63 A;  5LUU A;  3LQJ A;  5FFV A;  1WEN A;  2VPG A;  2MD8 C;  5CUB A;  4Q0O A;  1WIM A;  1JM7 A;  4TZ8 A;  5A7C A;  5LJ1 A;  1CHC A;  3LQH A;  4FLP A;  3I3J A;  4OGJ A;  5CZG A;  5IGK A;  4I7D A;  2R10 A;  2YYN A;  5EWV A;  1WEU A;  5ETB A;  3AQA A;  5G4S A;  5C8G A;  1RMD A;  2RSD A;  4A9H A;  4IOQ A;  5DY7 A;  5ENB A;  2K4D A;  4O7B A;  5F63 A;  4NR5 A;  4O7F A;  5LJ2 A;  4YC9 A;  3DPL R;  4LDF A;  3MB4 A;  5HEM A;  3ZVZ B;  5FE5 A;  2YRE A;  4YK0 A;  5HEN A;  5HLS A;  2G6Q A;  1T1H A;  2YYR A;  4HXM A;  1LDJ B;  4NRA A;  4OUF A;  5FER A;  4F3I A;  2DVS A;  4O75 A;  5G05 B;  3MUL A;  2VJF A;  2RS9 B;  4YYI A;  5I80 A;  5FG5 A;  1LDK C;  2F42 A;  3NXB A;  4AUQ B;  3U5L A;  4LK9 A;  5F1H A;  3KQI A;  2Y1N A;  3P1F A;  2DVR A;  3G0J A;  3MXF A;  2E7N A;  4NQM A;  4O74 A;  4PY6 A;  5FE6 A;  5IGM A;  5J0D A;  2WP1 A;  4ZUX U;  2KFT A;  5D0C A;  4QUT A;  5HFR A;  4MR3 A;  4QC3 A;  4YYJ A;  2BAY A;  5CY9 A;  4ZDT A;  3TLP A;  5I83 A;  3L1Z B;  5CQ6 A;  3KNV A;  2LQ6 A;  5D1M B;  5COI A;  2H0D B;  4GND A;  5EWH A;  4WIV A;  2E6R A;  4NR4 A;  4A49 A;  5L8U A;  5TBN A;  4IR4 A;  4WZ2 A;  3ASL A;  5FE2 A;  2KU3 A;  3JVK A;  3ZYQ A;  4O7C A;  5L97 A;  5EK9 A;  2XEU A;  2ECJ A;  2YHO A;  4BJX A;  4J1P A;  2L75 A;  4WZ3 B;  2CKL B;  1XWH A;  2KWK A;  3M62 A;  5E9M A;  5F3A A;  4TT4 A;  5LVR A;  1K2F A;  2M3H A;  4CCG X;  2YSM A;  1WEP A;  5I88 A;  4FJC A;  4A4C A;  4TU4 A;  5HEL A;  4MEP A;  5DIN A;  4Z93 A;  2LSP B;  4UI9 B;  2YDW A;  4J3I A;  4XYA A;  5D3N A;  5CP5 A;  5DKA A;  4W4U A;  5EWW A;  4ALH A;  4LYW A;  5DW1 A;  5AD3 A;  1JOC A;  5ENG A;  2KWJ A;  5CRM A;  1FBV A;  1WGM A;  5CUD A;  2JMJ A;  4R8P K;  2M1R A;  4IR3 A;  5I86 A;  2JRJ A;  2L84 A;  4UIV A;  4YBM A;  5EI4 A;  4HXL A;  4HBX A; 
#chains in the Genus database with same CATH topology
 4S3O C;  4YH3 A;  5KH9 A;  5E9Y A;  4HBY A;  4QSQ A;  5G04 B;  3FAO A;  4LLB A;  3HMF A;  5HRW A;  4NXJ A;  4MR5 A;  5A85 A;  5L99 A;  5HRV A;  1U6G B;  5C11 A;  3UVY A;  5B79 A;  3FM8 C;  5DFD A;  5LJ0 A;  4GB0 A;  2RNY A;  5DFB A;  2KWO A;  2EGM A;  2G43 A;  5ACY A;  4YAB A;  2RI7 A;  4GPJ A;  4YYK A;  2M85 A;  5CGP A;  3P1C A;  4TKP B;  2YEK A;  3MDB C;  5G4R A;  1E4U A;  5EPB A;  4RVR A;  4J0S A;  3MHH A;  5B78 A;  2I8N A;  4WHW A;  1DVP A;  2VJE B;  4HXP A;  4QSU A;  2VNF A;  5TRB A;  4NYX A;  5H1T A;  4HXK A;  5HM0 A;  3C5K A;  4Z6H A;  4R2Y A;  2ZET C;  2KR4 A;  4V3L C;  2I50 A;  5FE0 A;  4AKI A;  2KRE A;  5A5O A;  2VPD A;  2OSS A;  4YH4 A;  5A82 A;  3MHS A;  3LJW A;  5K3Q A;  3Q1D A;  3SUB A;  5BT3 A;  4N4F A;  2MKE A;  3LRQ A;  5DKC A;  2K16 A;  2LGV A;  1FP0 A;  3UV4 A;  4ALG A;  3QZT A;  4WHU A;  5SVI B;  3U5K A;  4NUE A;  4UYF B;  2FD4 A;  4KCX A;  2QJ0 A;  5CQ8 A;  4FO9 A;  5HQ5 A;  5EWC A;  2MNZ A;  5AD2 A;  4FK5 A;  5C85 A;  3O7A A;  4GNG A;  2YW5 A;  5EQ1 A;  3U5J A;  1MM2 A;  4O76 A;  3GV4 A;  4QBM A;  4UIY A;  4F52 B;  1WEO A;  2L0B A;  2OUO A;  4LC2 A;  5D1L B;  1X4I A;  4LZR A;  3O33 A;  3PUQ A;  5ENE A;  4L58 A;  2E7O A;  5KU3 A;  3KV6 A;  4A9O A;  4A9L A;  4GNF A;  2LXP C;  1X4J A;  1JM7 B;  2L43 A;  1F68 A;  2LGK A;  4QF3 A;  4O72 A;  1X4U A;  5F1L A;  4NN2 A;  4Y03 A;  2GRC A;  5FBX A;  4IR6 A;  3UW9 A;  5F2P A;  2OXQ C;  3FAN A;  4YYH A;  4HXS A;  4MSX A;  2M13 A;  4AYC A;  2MJV B;  3LXJ A;  3Q2E A;  4QEW A;  3Q2F A;  5D3S A;  3T6R A;  3K2J A;  5L96 A;  2YHN A;  3L11 A;  2XOY A;  5A83 A;  4CUP A;  2M6M A;  4P5O B;  5C89 A;  3LVQ E;  4QSR A;  4N4G A;  5AME A;  3V43 A;  5CQA A;  5A5P A;  4X3G A;  1WUM A;  2YQD A;  4NUD A;  4Z1Q A;  5DLX A;  2VJF B;  5D1K B;  5F5Z A;  5ENJ A;  2YU4 A;  1WEW A;  5D3R A;  4KV4 A;  4N3W A;  4X2I A;  5CUE A;  5FH6 A;  4QSW A;  4LZS A;  4NRC A;  5DKH A;  5D3H A;  2ECI A;  4IC3 A;  3O37 A;  5CFW A;  5EGU A;  5ENF A;  5LKT A;  5ENH A;  2MD7 B;  3O70 A;  1PUO A;  5DYX A;  5D24 A;  5TDR A;  5EYA F;  5FFW A;  2RNW A;  5ETD A;  5FE4 A;  2E61 A;  5LKX A;  3KDE C;  5HJC A;  5FG6 A;  4AKG A;  4OGE A;  3D1D A;  5E9K A;  5CUA A;  1VFY A;  3SVH A;  4XY8 A;  1BOR A;  3ZTG A;  2YSJ A;  5TDW A;  3S91 A;  1WUG A;  4UIU A;  4BW2 A;  4AVX A;  2VP7 A;  4HXN A;  4HXR A;  2FFW A;  5KHM A;  4UYH A;  5HQ7 A;  5DYA A;  4A9N A;  3T9K A;  3LVR E;  1V87 A;  2CRR A;  2LV9 A;  5FE9 A;  4YYM A;  3RPG C;  2DX8 A;  3O36 A;  4S3O B;  4TT2 A;  4TT6 A;  2KGG A;  3D7C A;  4QEV A;  4QYD A;  5A5S A;  2QIZ A;  2XP0 A;  4QC1 A;  2NXB A;  5C13 A;  1E6I A;  5KH3 A;  2EGP A;  3SOW A;  5D3J A;  3LDY A;  4CL9 A;  2L5E A;  3QZV A;  2CSY A;  4LRG A;  3P1D A;  3PLW A;  4YBT A;  3LJU X;  3DWY A;  4QR4 A;  2UZG A;  2JUN A;  4I7C A;  5AIU A;  4QB3 A;  3JVM A;  3MB3 A;  4B7Y C;  3C6W A;  4B86 C;  4UIZ A;  4DON A;  4QNS A;  2YUR A;  4Q0N A;  2LGL A;  4QSX A;  3UV5 A;  5B75 A;  3N9M A;  5A5R A;  4YYN A;  1EQF A;  5I40 A;  2CRW A;  5IBN A;  5IG6 A;  5A5N A;  2KWN A;  4NRB A;  5E9I A;  3GL6 A;  4XI1 A;  4A9I A;  4PCE A;  4CUU A;  2JM3 A;  4QSS A;  3PHD A;  4CUR A;  5E0R A;  2MIQ A;  3KV5 A;  5HCL A;  3NG2 A;  4FIP A;  2FUI A;  3EB5 A;  4QST A;  4KV1 A;  5E3D A;  2DVQ A;  4LAD B;  4AP4 A;  4QR5 A;  2FUU A;  3HTK C;  4PPE A;  5IID A;  2MA6 A;  5KH7 A;  5H85 A;  5CQ5 A;  5JG6 A;  3UVW A;  3QZS A;  2K1J A;  3D1B A;  4O7E A;  5LKU A;  5AIT A;  3VK6 A;  2L7P A;  5I89 A;  5C87 A;  2DVV A;  4HBV A;  4PTB A;  3E2D A;  3N9N A;  4LYS A;  5EVA A;  4NYW A;  5F62 A;  5KO4 A;  4TTE A;  1HYI A;  4QR3 A;  4A4B A;  5EP7 A;  5E7D A;  3VKH A;  4LZ2 A;  4QSV A;  5EM3 A;  5F36 A;  3O34 A;  5D26 A;  5CQ7 A;  3FL2 A;  3UVD A;  3GG3 A;  5FB0 A;  5E9L A;  2H60 A;  4TYL A;  3FKM X;  4TQN A;  2C2V S;  2K17 A;  2YVR A;  1MM3 A;  2G4A A;  2C2L A;  1ZBD B;  4UYD A;  5FE3 A;  1WE9 A;  2HYE D;  2D9E A;  3G0L A;  2L85 A;  4AKH A;  5DW2 A;  4UP5 A;  5EIS A;  3N9P A;  5CPE A;  3RCW A;  5FH8 A;  3N9L A;  4UIW A;  5LVQ A;  4BHW A;  4BW1 A;  2DWW A;  4R7E A;  2MA5 A;  4YYD A;  4MEN A;  5TB6 A;  5DLZ A;  1X0J A;  4UYE A;  5A81 A;  4HXO A;  4A9E A;  4TZ2 A;  2MNY A;  3DQV R;  1G25 A;  4MR6 A;  5F25 A;  1WES A;  4CLB A;  2YEL A;  5G0F A;  4NR8 A;  4HBW A;  1HYJ A;  2KYU A;  4LR6 A;  5BT5 A;  5KTU A;  2EOD A;  2KKY A;  4PKL A;  4IOO A;  4A9M A;  5E73 A;  5TCM A;  4GNE A;  5KTW A;  2MT5 A;  2KTB B;  4LKA A;  5FDZ A;  4CUT A;  2G45 A;  3JVJ A;  3IU5 A;  3LQI A;  4O71 A;  2PUY A;  5FB1 A;  3UVX A;  2HDP A;  3HME A;  3H7H A;  2Y43 A;  5I7X A;  4NR7 A;  4MVT A;  5KTX A;  4I7B A;  2VPB A;  5B76 A;  5FE7 A;  4Q6F A;  4AYC B;  1JM4 B;  1Z2Q A;  5CUG A;  3RTR B;  2N9G A;  2RNX A;  5A5Q A;  2OO1 A;  5DYU A;  5CRZ A;  4YYG A;  5FFY A;  1JSP B;  5CQ3 A;  3MQM A;  3ZYU A;  4YBS A;  4QYL A;  4ZC9 A;  3ERR A;  3P5O A;  4C67 A;  5K29 A;  3ZNI A;  4A0C D;  2XOC A;  1VD4 A;  1WEQ A;  4YAX A;  4BBQ A;  5L98 A;  4O70 A;  3SOU A;  5IGN A;  4OGI A;  2CT2 A;  2ECW A;  4CUS A;  4LJN A;  4NS5 A;  3RPG B;  3EB6 A;  5ENI A;  2H0D A;  5E74 A;  2RO1 A;  2DAT A;  5CS8 A;  4F1P A;  4LYI A;  5B8D A;  3IHP A;  4QSP A;  4L7X A;  5II1 A;  5J3X A;  2FSA A;  4Z6I A;  5E3G A;  2R0S A;  5DFC A;  2JMD A;  2CKL A;  4C9Z A;  4AKN A;  5SVY A;  5LCW B;  5I3L A;  5II2 A;  3ZVY A;  4XY9 A;  3MUK A;  2KGI A;  4TS8 A;  4UP0 A;  2QIC A;  1WEV A;  5HQ6 A;  3JVL A;  1VYX A;  5D3P A;  2D8U A;  4QF2 A;  3O47 A;  2VPE A;  4MR4 A;  2ECN A;  4O7A A;  3U5P A;  4UYG A;  5DYC A;  4QZS A;  2JMI A;  5EWD A;  5AMF A;  5JWM A;  3PUR A;  2LAU A;  5E9V A;  5H9M A;  2EXU A;  4CA1 A;  3N9O A;  4N4H A;  4BW4 A;  2ECT A;  4IR5 A;  4MEQ A;  4MEO A;  2YEM A;  3SVF A;  2OWA A;  2PNX A;  2KE1 A;  2R0V A;  5HFQ A;  2YW8 A;  1F62 A;  4PCI A;  3IU6 A;  2F6J A;  5EU1 A;  3HCS A;  4A9J A;  5D7X A;  4AI6 A;  4NYV A;  3SVG A;  1DCQ A;  1N72 A;  5FH7 A;  2CSZ A;  5I29 A;  2WP2 A;  5I1Q A;  5F61 A;  3S92 A;  5CTL A;  5D3L A;  1WEE A;  3L1X A;  2YQM A;  5ENC A;  4QEU A;  2IDA A;  4PS5 A;  1Z6U A;  5FE8 A;  4NUC A;  5DBM A;  3U5N A;  1WFK A;  5CQT A;  3DAI A;  4Z0R A;  4NR6 A;  4IC2 A;  4C66 A;  5C7N A;  4QUU A;  5C4Q A;  2YUC A;  3FJU B;  3N9Q A;  3ZPV E;  2I7K A;  2L80 A;  3U5M A;  3U5O A;  4YAT A;  1Z60 A;  4O64 A;  5FG4 A;  2Y1M A;  4UIX A;  5CQ4 A;  4OGC A;  2KIZ A;  4V3K C;  5D25 A;  5CUC A;  3O35 A;  5CU8 A;  5SVX A;  5EPR A;  2F6N A;  4XUA A;  3P1E A;  4YY4 A;  2NAA A;  3SHB A;  3ZPV 1;  2ECV A;  2LN0 A;  2LRI C;  2VJE A;  2D82 A;  2XB1 A;  3I2D A;  4NQN A;  5EV9 A;  2R0Y A;  4ZW1 A;  4XUB A;  5JI8 A;  1WIL A;  4N4I A;  4E96 A;  4NR9 A;  4O77 A;  4CUQ A;  2IQJ A;  2DKW A;  4QY4 A;  3M99 A;  2L5U A;  2ECG A;  2LDR A;  4ZQL A;  4A9K A;  3UV2 A;  2AN6 A;  2E6S A;  5B77 A;  5D3T A;  4O78 A;  4Z1S A;  2MUM A;  2KKX A;  5TAB A;  5F60 A;  5FE1 A;  2LGG A;  4YAD A;  2D8S A;  5EIC A;  3HCT A;  4A9F A;  2YT5 A;  4YY6 A;  4WA6 A;  4WZ0 A;  3T7L A;  4CFL A;  3HMH A;  1ZS5 A;  4CFK A;  2YQL A;  4TU6 A;  3HCU A;  5EPS A;  5SVI A;  4O62 A;  4UYF A;  4BW3 A;  4J0R A;  5H1V A;  4IOR A;  2LXH C;  4UIT A;  5HRX A;  5L8T A;  5IGL A;  2EA6 A;  5BT4 A;  1IYM A;  3AAD A;  5LKZ A;  3SOX A;  1WEM A;  2E3K A;  2RFJ A;  5DKD A;  5DX4 A;  5EA1 A;  3ONI A;  5H1U A;  5I7Y A;  2CSV A;  1N87 A;  5FEY A;  3M63 A;  5LUU A;  3LQJ A;  5FFV A;  1WEN A;  2P57 A;  2VPG A;  2MD8 C;  5CUB A;  4Q0O A;  1WIM A;  1JM7 A;  4TZ8 A;  5A7C A;  5LJ1 A;  1CHC A;  3LQH A;  4FLP A;  3I3J A;  4OGJ A;  5CZG A;  2EJN A;  5IGK A;  4I7D A;  2R10 A;  2YYN A;  5EWV A;  1WEU A;  5ETB A;  3M7K A;  3AQA A;  5G4S A;  5C8G A;  1RMD A;  2RSD A;  4A9H A;  4IOQ A;  5DY7 A;  5ENB A;  2XOZ A;  2K4D A;  4Z0O A;  4O7B A;  5F63 A;  4NR5 A;  4O7F A;  5LJ2 A;  4YC9 A;  3DPL R;  4LDF A;  3MB4 A;  5HEM A;  3ZVZ B;  5FE5 A;  2YRE A;  2CON A;  4YK0 A;  5HEN A;  5HLS A;  2G6Q A;  1T1H A;  2YYR A;  4HXM A;  4H9D A;  1LDJ B;  4NRA A;  4OUF A;  5FER A;  4F3I A;  3VKG A;  2DVS A;  4O75 A;  5G05 B;  3MUL A;  2VJF A;  2RS9 B;  4YYI A;  5I80 A;  5FG5 A;  1LDK C;  2F42 A;  3NXB A;  4AUQ B;  3U5L A;  4LK9 A;  2RR4 A;  5F1H A;  3KQI A;  2Y1N A;  3P1F A;  2DVR A;  3G0J A;  3MXF A;  2E7N A;  4NQM A;  4O74 A;  4PY6 A;  5FE6 A;  5IGM A;  5J0D A;  4QQ4 A;  2WP1 A;  4ZUX U;  2KFT A;  5D0C A;  4QUT A;  5HFR A;  4MR3 A;  1ZKR A;  4QC3 A;  4YYJ A;  2BAY A;  5CY9 A;  4ZDT A;  3TLP A;  5I83 A;  3L1Z B;  5CQ6 A;  3KNV A;  2LQ6 A;  5D1M B;  5COI A;  2H0D B;  4GND A;  5EWH A;  4WIV A;  2E6R A;  4NR4 A;  4A49 A;  5L8U A;  5TBN A;  4IR4 A;  4WZ2 A;  3ASL A;  5FE2 A;  2KU3 A;  3JVK A;  3ZYQ A;  4O7C A;  5L97 A;  5EK9 A;  2XEU A;  2ECJ A;  2YHO A;  4BJX A;  4J1P A;  2L75 A;  4WZ3 B;  2CKL B;  1XWH A;  2KWK A;  3DWD A;  3M62 A;  5E9M A;  5F3A A;  4TT4 A;  5LVR A;  1K2F A;  3JUE A;  2M3H A;  4CCG X;  2YSM A;  1WEP A;  5I88 A;  4FJC A;  4A4C A;  4TU4 A;  5HEL A;  4MEP A;  5DIN A;  4Z93 A;  2LSP B;  4UI9 B;  2DSM A;  2YDW A;  4J3I A;  4XYA A;  5D3N A;  5CP5 A;  5DKA A;  4W4U A;  5EWW A;  4ALH A;  4LYW A;  5DW1 A;  5AD3 A;  1JOC A;  1MBM A;  5ENG A;  2KWJ A;  2DJA A;  5CRM A;  1FBV A;  1WGM A;  5CUD A;  3FEH A;  2JMJ A;  4R8P K;  2M1R A;  3DDT A;  4IR3 A;  5I86 A;  2JRJ A;  2B0O E;  2L84 A;  4UIV A;  4YBM A;  5EI4 A;  4HXL A;  4HBX A; 
#chains in the Genus database with same CATH homology
 4S3O C;  4YH3 A;  5KH9 A;  5E9Y A;  4HBY A;  4QSQ A;  5G04 B;  4LLB A;  3HMF A;  5HRW A;  4NXJ A;  4MR5 A;  5A85 A;  5L99 A;  5HRV A;  1U6G B;  5C11 A;  3UVY A;  5B79 A;  5DFD A;  5LJ0 A;  4GB0 A;  2RNY A;  5DFB A;  2KWO A;  2G43 A;  5ACY A;  4YAB A;  2RI7 A;  4GPJ A;  4YYK A;  2M85 A;  5CGP A;  3P1C A;  4TKP B;  2YEK A;  5G4R A;  1E4U A;  5EPB A;  4RVR A;  4J0S A;  3MHH A;  5B78 A;  2I8N A;  4WHW A;  1DVP A;  2VJE B;  4HXP A;  4QSU A;  2VNF A;  5TRB A;  4NYX A;  5H1T A;  4HXK A;  5HM0 A;  3C5K A;  4Z6H A;  4R2Y A;  2ZET C;  2KR4 A;  4V3L C;  2I50 A;  5FE0 A;  2KRE A;  5A5O A;  2VPD A;  2OSS A;  4YH4 A;  5A82 A;  3MHS A;  3LJW A;  5BT3 A;  4N4F A;  3LRQ A;  5DKC A;  2K16 A;  2LGV A;  1FP0 A;  3UV4 A;  4ALG A;  3QZT A;  4WHU A;  3U5K A;  4NUE A;  4UYF B;  2QJ0 A;  4KCX A;  5CQ8 A;  4FO9 A;  5HQ5 A;  5EWC A;  2MNZ A;  5AD2 A;  4FK5 A;  5C85 A;  3O7A A;  4GNG A;  2YW5 A;  5EQ1 A;  3U5J A;  1MM2 A;  4O76 A;  3GV4 A;  4QBM A;  4UIY A;  4F52 B;  1WEO A;  2L0B A;  2OUO A;  4LC2 A;  5D1L B;  1X4I A;  4LZR A;  3O33 A;  3PUQ A;  5ENE A;  4L58 A;  2E7O A;  5KU3 A;  3KV6 A;  4A9O A;  4A9L A;  4GNF A;  2LXP C;  1X4J A;  1JM7 B;  2L43 A;  1F68 A;  2LGK A;  4QF3 A;  4O72 A;  1X4U A;  5F1L A;  4NN2 A;  4Y03 A;  2GRC A;  5FBX A;  4IR6 A;  3UW9 A;  5F2P A;  2OXQ C;  4YYH A;  4HXS A;  4MSX A;  4AYC A;  2MJV B;  3LXJ A;  3Q2E A;  4QEW A;  3Q2F A;  5D3S A;  3T6R A;  3K2J A;  5L96 A;  2YHN A;  3L11 A;  5A83 A;  4CUP A;  2M6M A;  4P5O B;  5C89 A;  4QSR A;  4N4G A;  5AME A;  3V43 A;  5CQA A;  5A5P A;  4X3G A;  1WUM A;  2YQD A;  4NUD A;  4Z1Q A;  5DLX A;  2VJF B;  5D1K B;  5F5Z A;  5ENJ A;  2YU4 A;  1WEW A;  5D3R A;  4KV4 A;  4N3W A;  4X2I A;  5CUE A;  5FH6 A;  4QSW A;  4LZS A;  4NRC A;  5DKH A;  5D3H A;  2ECI A;  4IC3 A;  3O37 A;  5CFW A;  5EGU A;  5ENF A;  5LKT A;  5ENH A;  2MD7 B;  3O70 A;  5DYX A;  5D24 A;  5TDR A;  5EYA F;  5FFW A;  2RNW A;  5ETD A;  5FE4 A;  5LKX A;  5HJC A;  5FG6 A;  5E9K A;  5CUA A;  1VFY A;  3SVH A;  4XY8 A;  1BOR A;  3ZTG A;  2YSJ A;  5TDW A;  3S91 A;  1WUG A;  4UIU A;  4BW2 A;  4AVX A;  2VP7 A;  4HXN A;  4HXR A;  5KHM A;  4UYH A;  5HQ7 A;  5DYA A;  4A9N A;  1V87 A;  2LV9 A;  5FE9 A;  4YYM A;  3RPG C;  2DX8 A;  3O36 A;  4S3O B;  4TT2 A;  4TT6 A;  2KGG A;  3D7C A;  4QEV A;  4QYD A;  5A5S A;  2QIZ A;  4QC1 A;  2NXB A;  5C13 A;  1E6I A;  5KH3 A;  2EGP A;  3SOW A;  5D3J A;  4CL9 A;  2L5E A;  3QZV A;  2CSY A;  4LRG A;  3P1D A;  4YBT A;  3DWY A;  4QR4 A;  2UZG A;  4I7C A;  5AIU A;  4QB3 A;  3JVM A;  3MB3 A;  4B7Y C;  3C6W A;  4B86 C;  4UIZ A;  4DON A;  4QNS A;  2YUR A;  4Q0N A;  2LGL A;  4QSX A;  3UV5 A;  5B75 A;  3N9M A;  5A5R A;  4YYN A;  1EQF A;  5I40 A;  5IBN A;  5IG6 A;  5A5N A;  2KWN A;  4NRB A;  5E9I A;  3GL6 A;  4XI1 A;  4A9I A;  4PCE A;  4CUU A;  4QSS A;  3PHD A;  4CUR A;  5E0R A;  2MIQ A;  3KV5 A;  5HCL A;  3NG2 A;  4FIP A;  2FUI A;  3EB5 A;  4QST A;  4KV1 A;  5E3D A;  2DVQ A;  4LAD B;  4AP4 A;  4QR5 A;  2FUU A;  3HTK C;  4PPE A;  5IID A;  2MA6 A;  5KH7 A;  5H85 A;  5CQ5 A;  5JG6 A;  3UVW A;  3QZS A;  2K1J A;  5LKU A;  4O7E A;  5AIT A;  3VK6 A;  5I89 A;  5C87 A;  2DVV A;  4HBV A;  4PTB A;  3N9N A;  4LYS A;  5EVA A;  4NYW A;  5F62 A;  5KO4 A;  4TTE A;  1HYI A;  4QR3 A;  4A4B A;  5EP7 A;  5E7D A;  4LZ2 A;  4QSV A;  5EM3 A;  5F36 A;  3O34 A;  5D26 A;  5CQ7 A;  3FL2 A;  3UVD A;  3GG3 A;  5FB0 A;  5E9L A;  2H60 A;  4TYL A;  3FKM X;  4TQN A;  2C2V S;  2K17 A;  1MM3 A;  2G4A A;  2C2L A;  1ZBD B;  4UYD A;  5FE3 A;  1WE9 A;  2HYE D;  2D9E A;  3G0L A;  2L85 A;  4UP5 A;  5DW2 A;  5EIS A;  3N9P A;  5CPE A;  3RCW A;  5FH8 A;  3N9L A;  4UIW A;  5LVQ A;  4BHW A;  4BW1 A;  2DWW A;  4R7E A;  2MA5 A;  4YYD A;  4MEN A;  5TB6 A;  5DLZ A;  1X0J A;  4UYE A;  5A81 A;  4HXO A;  4A9E A;  4TZ2 A;  2MNY A;  3DQV R;  1G25 A;  4MR6 A;  5F25 A;  1WES A;  4CLB A;  2YEL A;  5G0F A;  4NR8 A;  4HBW A;  1HYJ A;  2KYU A;  4LR6 A;  5BT5 A;  5KTU A;  2EOD A;  4PKL A;  4IOO A;  4A9M A;  5E73 A;  5TCM A;  4GNE A;  5KTW A;  2MT5 A;  2KTB B;  4LKA A;  5FDZ A;  4CUT A;  2G45 A;  3JVJ A;  3IU5 A;  3LQI A;  4O71 A;  2PUY A;  5FB1 A;  3UVX A;  2HDP A;  3HME A;  2Y43 A;  5I7X A;  4NR7 A;  4MVT A;  5KTX A;  4I7B A;  2VPB A;  5B76 A;  5FE7 A;  4Q6F A;  4AYC B;  1JM4 B;  1Z2Q A;  5CUG A;  3RTR B;  2N9G A;  2RNX A;  5A5Q A;  2OO1 A;  5DYU A;  5CRZ A;  4YYG A;  5FFY A;  1JSP B;  5CQ3 A;  3MQM A;  3ZYU A;  4YBS A;  4QYL A;  4ZC9 A;  3P5O A;  4C67 A;  3ZNI A;  5K29 A;  4A0C D;  1VD4 A;  1WEQ A;  4YAX A;  4BBQ A;  5L98 A;  4O70 A;  3SOU A;  5IGN A;  4OGI A;  2CT2 A;  2ECW A;  4CUS A;  4LJN A;  4NS5 A;  3RPG B;  3EB6 A;  5ENI A;  2H0D A;  5E74 A;  2RO1 A;  2DAT A;  5CS8 A;  4LYI A;  5B8D A;  3IHP A;  4QSP A;  4L7X A;  5II1 A;  5J3X A;  2FSA A;  4Z6I A;  5E3G A;  2R0S A;  5DFC A;  2JMD A;  2CKL A;  4C9Z A;  4AKN A;  5LCW B;  5I3L A;  5II2 A;  3ZVY A;  4XY9 A;  3MUK A;  2KGI A;  4TS8 A;  4UP0 A;  2QIC A;  1WEV A;  5HQ6 A;  3JVL A;  1VYX A;  5D3P A;  4QF2 A;  2VPE A;  4MR4 A;  2ECN A;  4O7A A;  3U5P A;  4UYG A;  5DYC A;  4QZS A;  2JMI A;  5EWD A;  5AMF A;  5JWM A;  3PUR A;  5E9V A;  5H9M A;  4CA1 A;  3N9O A;  4N4H A;  4BW4 A;  2ECT A;  4IR5 A;  4MEQ A;  4MEO A;  2YEM A;  3SVF A;  2PNX A;  2KE1 A;  2R0V A;  5HFQ A;  2YW8 A;  1F62 A;  4PCI A;  3IU6 A;  2F6J A;  5EU1 A;  3HCS A;  4A9J A;  5D7X A;  4NYV A;  3SVG A;  1N72 A;  5FH7 A;  2CSZ A;  5I29 A;  2WP2 A;  5I1Q A;  5F61 A;  3S92 A;  5CTL A;  5D3L A;  1WEE A;  3L1X A;  2YQM A;  5ENC A;  4QEU A;  2IDA A;  4PS5 A;  1Z6U A;  5FE8 A;  4NUC A;  5DBM A;  3U5N A;  1WFK A;  5CQT A;  3DAI A;  4NR6 A;  4IC2 A;  4C66 A;  5C7N A;  4QUU A;  5C4Q A;  2YUC A;  3N9Q A;  3ZPV E;  2I7K A;  2L80 A;  3U5M A;  3U5O A;  4YAT A;  1Z60 A;  4O64 A;  5FG4 A;  2Y1M A;  4UIX A;  5CQ4 A;  2KIZ A;  4V3K C;  5D25 A;  5CUC A;  3O35 A;  5CU8 A;  5EPR A;  2F6N A;  4XUA A;  3P1E A;  4YY4 A;  2NAA A;  3SHB A;  3ZPV 1;  2ECV A;  2LN0 A;  2LRI C;  2VJE A;  2D82 A;  2XB1 A;  3I2D A;  4NQN A;  5EV9 A;  2R0Y A;  4ZW1 A;  4XUB A;  5JI8 A;  1WIL A;  4N4I A;  4E96 A;  4NR9 A;  4O77 A;  4CUQ A;  2DKW A;  4QY4 A;  3M99 A;  2L5U A;  2ECG A;  2LDR A;  4ZQL A;  4A9K A;  3UV2 A;  2AN6 A;  2E6S A;  5B77 A;  5D3T A;  4O78 A;  4Z1S A;  2MUM A;  5TAB A;  5F60 A;  5FE1 A;  2LGG A;  4YAD A;  2D8S A;  5EIC A;  3HCT A;  4A9F A;  2YT5 A;  4YY6 A;  4WA6 A;  4WZ0 A;  3T7L A;  4CFL A;  3HMH A;  1ZS5 A;  4CFK A;  2YQL A;  4TU6 A;  3HCU A;  5EPS A;  4UYF A;  4BW3 A;  4J0R A;  5H1V A;  4IOR A;  2LXH C;  4UIT A;  5HRX A;  5L8T A;  5IGL A;  2EA6 A;  5BT4 A;  1IYM A;  3AAD A;  5LKZ A;  3SOX A;  1WEM A;  2E3K A;  2RFJ A;  5DKD A;  5DX4 A;  5EA1 A;  3ONI A;  5H1U A;  5I7Y A;  5FEY A;  1N87 A;  3M63 A;  5LUU A;  3LQJ A;  5FFV A;  1WEN A;  2VPG A;  2MD8 C;  5CUB A;  4Q0O A;  1WIM A;  1JM7 A;  4TZ8 A;  5A7C A;  5LJ1 A;  1CHC A;  3LQH A;  4FLP A;  3I3J A;  4OGJ A;  5CZG A;  5IGK A;  4I7D A;  2R10 A;  2YYN A;  5EWV A;  1WEU A;  5ETB A;  3AQA A;  5G4S A;  5C8G A;  1RMD A;  2RSD A;  4A9H A;  4IOQ A;  5DY7 A;  5ENB A;  2K4D A;  4O7B A;  5F63 A;  4NR5 A;  4O7F A;  5LJ2 A;  4YC9 A;  3DPL R;  4LDF A;  3MB4 A;  5HEM A;  3ZVZ B;  5FE5 A;  2YRE A;  4YK0 A;  5HEN A;  5HLS A;  2G6Q A;  1T1H A;  2YYR A;  4HXM A;  1LDJ B;  4NRA A;  4OUF A;  5FER A;  4F3I A;  2DVS A;  4O75 A;  5G05 B;  3MUL A;  2VJF A;  2RS9 B;  4YYI A;  5I80 A;  5FG5 A;  1LDK C;  2F42 A;  3NXB A;  4AUQ B;  3U5L A;  4LK9 A;  5F1H A;  3KQI A;  2Y1N A;  3P1F A;  2DVR A;  3G0J A;  3MXF A;  2E7N A;  4NQM A;  4O74 A;  4PY6 A;  5FE6 A;  5IGM A;  5J0D A;  2WP1 A;  4ZUX U;  2KFT A;  5D0C A;  4QUT A;  5HFR A;  4MR3 A;  4QC3 A;  4YYJ A;  2BAY A;  5CY9 A;  4ZDT A;  3TLP A;  5I83 A;  3L1Z B;  5CQ6 A;  3KNV A;  2LQ6 A;  5D1M B;  5COI A;  2H0D B;  4GND A;  5EWH A;  4WIV A;  2E6R A;  4NR4 A;  4A49 A;  5L8U A;  5TBN A;  4IR4 A;  4WZ2 A;  3ASL A;  5FE2 A;  2KU3 A;  3JVK A;  3ZYQ A;  4O7C A;  5L97 A;  5EK9 A;  2XEU A;  2ECJ A;  2YHO A;  4BJX A;  4J1P A;  2L75 A;  4WZ3 B;  2CKL B;  1XWH A;  2KWK A;  3M62 A;  5E9M A;  5F3A A;  4TT4 A;  5LVR A;  1K2F A;  2M3H A;  4CCG X;  2YSM A;  1WEP A;  5I88 A;  4FJC A;  4A4C A;  4TU4 A;  5HEL A;  4MEP A;  5DIN A;  4Z93 A;  2LSP B;  4UI9 B;  2YDW A;  4J3I A;  4XYA A;  5D3N A;  5CP5 A;  5DKA A;  4W4U A;  5EWW A;  4ALH A;  4LYW A;  5DW1 A;  5AD3 A;  1JOC A;  5ENG A;  2KWJ A;  5CRM A;  1FBV A;  1WGM A;  5CUD A;  2JMJ A;  4R8P K;  2M1R A;  4IR3 A;  5I86 A;  2JRJ A;  2L84 A;  4UIV A;  4YBM A;  5EI4 A;  4HXL A;  4HBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...