5B79A

Crystal structure of dpf2 double phd finger
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
b'SNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein ubi-d4
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b79A00
3N9QA 3ASLA 5C11A 5LCWB 2YUCA 5B78A 3O34A 2KU3A 4LK9A 3SHBA 4WZ3B 4W4UA 2JRJA 2L5UA 4QF2A 3HCUA 3LQHA 4IC3A 2JMIA 2VPDA 3EB6A 2VJFB 2Y43A 2ECTA 3O35A 3U5OA 2F6NA 3L11A 5TBNA 1WFKA 5AIUA 3U5PA 2E6RA 3N9OA 2MA5A 4WZ0A 2XEUA 5G0FA 3LQIA 2F42A 2G45A 2YSJA 5H1VA 2Y1NA 4QF3A 4YATA 4WZ2A 2JMDA 5FB0A 5C13A 2Y1MA 1XWHA 4AVXA 1G25A 4L7XA 3O7AA 2M3HA 3T7LA 2G6QA 2LGLA 2KYUA 2LV9A 3C6WA 4N4FA 3HCTA 2E6SA 1WEOA 4N3WA 2VJFA 1X4IA 4V3KC 2MD7B 4C9ZA 3U5NA 2KWKA 3ZTGA 2YURA 4GNDA 2PUYA 2YW8A 1WILA 2YQLA 2QICA 5KH9A 1BORA 4V3LC 4WA6A 1WIMA 5H1TA 4FIPA 4A0CD 5D1LB 5H1UA 2KWOA 1VD4A 3IHPA 1K2FA 4YABA 1DVPA 2L80A 5DKAA 1IYMA 2ECWA 3VK6A 4YC9A 3KV6A 2QJ0A 4FK5A 4NN2A 3O37A 3SOXA 3M63A 1FP0A 4ZQLA 2M6MA 2M1RA 2L43A 3ZVZB 2YU4A 4GNFA 5FB1A 1X4UA 2CT2A 1WEUA 4FJCA 4S3OC 5J3XA 2L0BA 4BBQA 1CHCA 4ZDTA 1HYJA 4ZUXU 1RMDA 2JMJA 4LJNA 2ECIA 4AYCB 4R8PK 3N9NA 1Z6UA 2VPBA 2KWJA 3GL6A 2VPEA 2LGKA 2VPGA 5B77A 1F62A 3HTKC 3RPGB 3LQJA 2ECGA 2YSMA 2LDRA 2KIZA 1N87A 2VNFA 2KFTA 4R2YA 5KH3A 4CA1A 3KQIA 2MD8C 4PPEA 2LXPC 5D1MB 1MM3A 1WEWA 4LADB 3T6RA 1WGMA 4A49A 4GB0A 2LRIC 4X3GA 2K4DA 2UZGA 3KV5A 2KWNA 5EYAF 2FSAA 2XB1A 4A4BA 2ECNA 3O33A 4YBTA 4B86C 2EODA 4MVTA 2BAYA 5G05B 4AYCA 3PUQA 3KNVA 1T1HA 2ECVA 4AUQB 4UI9B 2KREA 2YT5A 1MM2A 4I7BA 2I50A 2IDAA 2KE1A 2LXHC 3L1XA 2C2VS 3O70A 1VFYA 1U6GB 1HYIA 2YYRA 2VP7A 2K17A 2LGVA 1WEEA 3O36A 5TDRA 2M85A 2MA6A 2EA6A 3I2DA 1X4JA 2K1JA 1JOCA 2MT5A 4R7EA 4YADA 2MNYA 3FL2A 3M62A 5B76A 3ZPV1 2CSZA 3MHHA 3LRQA 3DPLR 3SOWA 2PNXA 1ZBDB 4A4CA 5LKUA 2LN0A 5FEYA 4I7DA 2LQ6A 1Z60A 2HDPA 3N9PA 4F52B 2YQMA 4AP4A 4YBSA 2QIZA 3EB5A 4YAXA 5KH7A 2NAAA 1E4UA 1FBVA 3GV4A 2H0DB 4Q6FA 4XI1A 3HCSA 3V43A 1V87A 5TABA 5JG6A 1WEPA 3ZPVE 2CSYA 2EGPA 3QZVA 1VYXA 2MNZA 1JM7B 1Z2QA 2OXQC 4S3OB 5G04B 2VJEB 2DX8A 2FUIA 4TKPB 2YHNA 4UP0A 4GNEA 2C2LA 4L58A 3RTRB 3ZYQA 4MSXA 5FERA 5LKZA 4I7CA 2RSDA 3C5KA 2ECJA 5TDWA 1WESA 2MIQA 3DQVR 4GNGA 2CKLB 4UP5A 3ZVYA 2KGGA 5B79A 3SOUA 4YBMA 1WEMA 2K16A 1LDKC 5B8DA 3U5MA 5B75A 2H0DA 2RI7A 5TRBA 2LGGA 2L75A 2YHOA 4LKAA 4CCGX 2D8SA 5DINA 4B7YC 2YREA 3N9LA 2KR4A 2G43A 1JM7A 4IC2A 4LLBA 4BHWA 1WENA 2VJEA 3NG2A 1WE9A 2MUMA 1WEQA 4O64A 4P5OB 5LKXA 3PURA 5D1KB 5AITA 3N9MA 3M99A 2HYED 4PTBA 2KGIA 5I3LA 3L1ZB 2FUUA 3RPGC 1LDJB 5H9MA 3MHSA 2CKLA 3PHDA 2F6JA 3ZNIA 4FO9A 2ZETC 5LKTA 1WEVA 2AN6A
chains in the Genus database with same CATH superfamily
3N9QA 3ASLA 5C11A 5LCWB 2YUCA 2XOYA 5B78A 2XOZA 3O34A 2DSMA 3FEHA 2KU3A 4LK9A 1DCQA 3SHBA 4WZ3B 4W4UA 2JRJA 2L5UA 4QF2A 3HCUA 3LQHA 4IC3A 2JMIA 2VPDA 3EB6A 2VJFB 2Y43A 2ECTA 3O35A 3U5OA 2F6NA 3L11A 5TBNA 1WFKA 5AIUA 3U5PA 2E6RA 3N9OA 2MA5A 4WZ0A 2XEUA 5G0FA 3LQIA 2F42A 2G45A 2YSJA 5H1VA 2Y1NA 4QF3A 4YATA 4WZ2A 2JMDA 5FB0A 5C13A 2Y1MA 1XWHA 4AVXA 1G25A 4L7XA 3O7AA 2M3HA 3T7LA 2G6QA 2LGLA 2KYUA 2LV9A 3C6WA 4N4FA 3HCTA 4Z0OA 2E6SA 3FANA 1WEOA 2MKEA 4N3WA 2VJFA 1X4IA 2DJAA 4V3KC 2MD7B 4C9ZA 2P57A 3U5NA 2KWKA 3ZTGA 2YURA 4GNDA 2PUYA 2YW8A 1WILA 2YQLA 2QICA 5KH9A 1BORA 4V3LC 3FM8C 4WA6A 1WIMA 5H1TA 4FIPA 4A0CD 5D1LB 5H1UA 2M13A 2KWOA 1VD4A 3IHPA 1K2FA 4YABA 1DVPA 2CRRA 2L80A 5DKAA 1IYMA 2ECWA 3VK6A 4YC9A 3KV6A 2QJ0A 4FK5A 4NN2A 4Z0RA 3O37A 3SOXA 3M63A 1FP0A 4ZQLA 3LVQE 2M6MA 2M1RA 2L43A 4OGCA 2YU4A 3ZVZB 4GNFA 5FB1A 1X4UA 2CT2A 1WEUA 4FJCA 4S3OC 5J3XA 2L0BA 3T9KA 4BBQA 1CHCA 4ZDTA 1HYJA 4ZUXU 2CONA 1RMDA 2JMJA 2JUNA 2ECIA 4LJNA 4AYCB 4R8PK 3N9NA 1Z6UA 3H7HA 2VPBA 2KWJA 3GL6A 2VPEA 3DDTA 2LGKA 2VPGA 3KDEC 5B77A 1F62A 3M7KA 3HTKC 3RPGB 3LQJA 2ECGA 2YSMA 2LDRA 2KIZA 1N87A 2VNFA 2KFTA 4OGEA 4R2YA 5KH3A 4CA1A 3KQIA 2MD8C 4PPEA 2LXPC 5D1MB 2FFWA 1MM3A 1WEWA 4LADB 3T6RA 1WGMA 4A49A 4GB0A 2LRIC 2KKXA 4X3GA 2K4DA 2UZGA 3Q1DA 3KV5A 2KWNA 5EYAF 2FSAA 2XB1A 4A4BA 5SVIB 2ECNA 3O33A 2YVRA 4YBTA 4B86C 2EODA 1MBMA 4MVTA 2BAYA 4O62A 5G05B 4AYCA 3PUQA 3KNVA 1T1HA 2ECVA 4AUQB 3LDYA 4UI9B 2KREA 2YT5A 1MM2A 4I7BA 3DWDA 2I50A 2IDAA 2RR4A 2KE1A 2LXHC 3L1XA 2C2VS 3O70A 1U6GB 1VFYA 1HYIA 2YYRA 3LJUX 2B0OE 2VP7A 2K17A 2LGVA 1WEEA 3O36A 5TDRA 2M85A 2MA6A 2FD4A 2EA6A 3I2DA 1X4JA 2K1JA 1JOCA 2MT5A 4R7EA 4YADA 2MNYA 3FL2A 3M62A 5B76A 3ZPV1 3JUEA 5SVXA 2CSZA 3MHHA 3LRQA 3DPLR 3SOWA 2PNXA 1ZBDB 4A4CA 5LKUA 2LN0A 3FJUB 3LVRE 5FEYA 4I7DA 2LQ6A 1Z60A 3O47A 2HDPA 3N9PA 2EXUA 4F52B 2YQMA 4AP4A 4YBSA 2QIZA 3EB5A 4YAXA 2L7PA 5KH7A 2NAAA 1E4UA 1FBVA 3GV4A 3MDBC 2H0DB 4Q6FA 4XI1A 3HCSA 3V43A 2LAUA 1V87A 5TABA 5JG6A 1WEPA 3ZPVE 2CSYA 2EGPA 3QZVA 1VYXA 2MNZA 1JM7B 1Z2QA 2OXQC 4S3OB 5G04B 2VJEB 2DX8A 2FUIA 4TKPB 2YHNA 2JM3A 3PLWA 4UP0A 2CRWA 4GNEA 4F1PA 2C2LA 4L58A 3RTRB 3ZYQA 4MSXA 5FERA 5LKZA 3FAOA 2XOCA 4I7CA 3E2DA 2E61A 2RSDA 3C5KA 2ECJA 5TDWA 1WESA 2MIQA 3DQVR 4GNGA 2CKLB 4UP5A 3ZVYA 2XP0A 2KGGA 5B79A 3SOUA 4YBMA 1WEMA 2K16A 1LDKC 3SUBA 5B8DA 3U5MA 5B75A 2H0DA 2RI7A 5TRBA 2LGGA 2L75A 2YHOA 4LKAA 4CCGX 5SVYA 2D8SA 5DINA 4B7YC 2YREA 3N9LA 2KR4A 2G43A 1JM7A 4IC2A 4LLBA 2EGMA 4BHWA 1WENA 2VJEA 3NG2A 1WE9A 2MUMA 2CSVA 2IQJA 1WEQA 2D8UA 4O64A 4P5OB 5LKXA 3PURA 5D1KB 2KKYA 4QQ4A 5SVIA 5AITA 3N9MA 3M99A 2HYED 4PTBA 2KGIA 5I3LA 3L1ZB 2FUUA 5K3QA 3RPGC 1LDJB 2OWAA 5H9MA 3MHSA 2CKLA 3PHDA 2F6JA 3ZNIA 4FO9A 2ZETC 5LKTA 4H9DA 1WEVA 2AN6A
chains in the Genus database with same CATH topology
3N9QA 3ASLA 5C11A 5LCWB 2YUCA 5B78A 3O34A 2KU3A 4LK9A 3SHBA 4WZ3B 4W4UA 2JRJA 2L5UA 4QF2A 3HCUA 3LQHA 4IC3A 2JMIA 2VPDA 3EB6A 2VJFB 2Y43A 2ECTA 3O35A 3U5OA 2F6NA 3L11A 5TBNA 1WFKA 5AIUA 3U5PA 2E6RA 3N9OA 2MA5A 4WZ0A 2XEUA 5G0FA 3LQIA 2F42A 2G45A 2YSJA 5H1VA 2Y1NA 4QF3A 4YATA 4WZ2A 2JMDA 5FB0A 5C13A 2Y1MA 1XWHA 4AVXA 1G25A 4L7XA 3O7AA 2M3HA 3T7LA 2G6QA 2LGLA 2KYUA 2LV9A 3C6WA 4N4FA 3HCTA 2E6SA 1WEOA 4N3WA 2VJFA 1X4IA 4V3KC 2MD7B 4C9ZA 3U5NA 2KWKA 3ZTGA 2YURA 4GNDA 2PUYA 2YW8A 1WILA 2YQLA 2QICA 5KH9A 1BORA 4V3LC 4WA6A 1WIMA 5H1TA 4FIPA 4A0CD 5D1LB 5H1UA 2KWOA 1VD4A 3IHPA 1K2FA 4YABA 1DVPA 2L80A 5DKAA 1IYMA 2ECWA 3VK6A 4YC9A 3KV6A 2QJ0A 4FK5A 4NN2A 3O37A 3SOXA 3M63A 1FP0A 4ZQLA 2M6MA 2M1RA 2L43A 3ZVZB 2YU4A 4GNFA 5FB1A 1X4UA 2CT2A 1WEUA 4FJCA 4S3OC 5J3XA 2L0BA 4BBQA 1CHCA 4ZDTA 1HYJA 4ZUXU 1RMDA 2JMJA 4LJNA 2ECIA 4AYCB 4R8PK 3N9NA 1Z6UA 2VPBA 2KWJA 3GL6A 2VPEA 2LGKA 2VPGA 5B77A 1F62A 3HTKC 3RPGB 3LQJA 2ECGA 2YSMA 2LDRA 2KIZA 1N87A 2VNFA 2KFTA 4R2YA 5KH3A 4CA1A 3KQIA 2MD8C 4PPEA 2LXPC 5D1MB 1MM3A 1WEWA 4LADB 3T6RA 1WGMA 4A49A 4GB0A 2LRIC 4X3GA 2K4DA 2UZGA 3KV5A 2KWNA 5EYAF 2FSAA 2XB1A 4A4BA 2ECNA 3O33A 4YBTA 4B86C 2EODA 4MVTA 2BAYA 5G05B 4AYCA 3PUQA 3KNVA 1T1HA 2ECVA 4AUQB 4UI9B 2KREA 2YT5A 1MM2A 4I7BA 2I50A 2IDAA 2KE1A 2LXHC 3L1XA 2C2VS 3O70A 1VFYA 1U6GB 1HYIA 2YYRA 2VP7A 2K17A 2LGVA 1WEEA 3O36A 5TDRA 2M85A 2MA6A 2EA6A 3I2DA 1X4JA 2K1JA 1JOCA 2MT5A 4R7EA 4YADA 2MNYA 3FL2A 3M62A 5B76A 3ZPV1 2CSZA 3MHHA 3LRQA 3DPLR 3SOWA 2PNXA 1ZBDB 4A4CA 5LKUA 2LN0A 5FEYA 4I7DA 2LQ6A 1Z60A 2HDPA 3N9PA 4F52B 2YQMA 4AP4A 4YBSA 2QIZA 3EB5A 4YAXA 5KH7A 2NAAA 1E4UA 1FBVA 3GV4A 2H0DB 4Q6FA 4XI1A 3HCSA 3V43A 1V87A 5TABA 5JG6A 1WEPA 3ZPVE 2CSYA 2EGPA 3QZVA 1VYXA 2MNZA 1JM7B 1Z2QA 2OXQC 4S3OB 5G04B 2VJEB 2DX8A 2FUIA 4TKPB 2YHNA 4UP0A 4GNEA 2C2LA 4L58A 3RTRB 3ZYQA 4MSXA 5FERA 5LKZA 4I7CA 2RSDA 3C5KA 2ECJA 5TDWA 1WESA 2MIQA 3DQVR 4GNGA 2CKLB 4UP5A 3ZVYA 2KGGA 5B79A 3SOUA 4YBMA 1WEMA 2K16A 1LDKC 5B8DA 3U5MA 5B75A 2H0DA 2RI7A 5TRBA 2LGGA 2L75A 2YHOA 4LKAA 4CCGX 2D8SA 5DINA 4B7YC 2YREA 3N9LA 2KR4A 2G43A 1JM7A 4IC2A 4LLBA 4BHWA 1WENA 2VJEA 3NG2A 1WE9A 2MUMA 1WEQA 4O64A 4P5OB 5LKXA 3PURA 5D1KB 5AITA 3N9MA 3M99A 2HYED 4PTBA 2KGIA 5I3LA 3L1ZB 2FUUA 3RPGC 1LDJB 5H9MA 3MHSA 2CKLA 3PHDA 2F6JA 3ZNIA 4FO9A 2ZETC 5LKTA 1WEVA 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9Q A;  3ASL A;  5C11 A;  5LCW B;  2YUC A;  5B78 A;  3O34 A;  2KU3 A;  4LK9 A;  3SHB A;  4WZ3 B;  4W4U A;  2JRJ A;  2L5U A;  4QF2 A;  3HCU A;  3LQH A;  4IC3 A;  2JMI A;  2VPD A;  3EB6 A;  2VJF B;  2Y43 A;  2ECT A;  3O35 A;  3U5O A;  2F6N A;  3L11 A;  5TBN A;  1WFK A;  5AIU A;  3U5P A;  2E6R A;  3N9O A;  2MA5 A;  4WZ0 A;  2XEU A;  5G0F A;  3LQI A;  2F42 A;  2G45 A;  2YSJ A;  5H1V A;  2Y1N A;  4QF3 A;  4YAT A;  4WZ2 A;  2JMD A;  5FB0 A;  5C13 A;  2Y1M A;  1XWH A;  4AVX A;  1G25 A;  4L7X A;  3O7A A;  2M3H A;  3T7L A;  2G6Q A;  2LGL A;  2KYU A;  2LV9 A;  3C6W A;  4N4F A;  3HCT A;  2E6S A;  1WEO A;  4N3W A;  2VJF A;  1X4I A;  4V3K C;  2MD7 B;  4C9Z A;  3U5N A;  2KWK A;  3ZTG A;  2YUR A;  4GND A;  2PUY A;  2YW8 A;  1WIL A;  2YQL A;  2QIC A;  5KH9 A;  1BOR A;  4V3L C;  4WA6 A;  1WIM A;  5H1T A;  4FIP A;  4A0C D;  5D1L B;  5H1U A;  2KWO A;  1VD4 A;  3IHP A;  1K2F A;  4YAB A;  1DVP A;  2L80 A;  5DKA A;  1IYM A;  2ECW A;  3VK6 A;  4YC9 A;  3KV6 A;  2QJ0 A;  4FK5 A;  4NN2 A;  3O37 A;  3SOX A;  3M63 A;  1FP0 A;  4ZQL A;  2M6M A;  2M1R A;  2L43 A;  3ZVZ B;  2YU4 A;  4GNF A;  5FB1 A;  1X4U A;  2CT2 A;  1WEU A;  4FJC A;  4S3O C;  5J3X A;  2L0B A;  4BBQ A;  1CHC A;  4ZDT A;  1HYJ A;  4ZUX U;  1RMD A;  2JMJ A;  4LJN A;  2ECI A;  4AYC B;  4R8P K;  3N9N A;  1Z6U A;  2VPB A;  2KWJ A;  3GL6 A;  2VPE A;  2LGK A;  2VPG A;  5B77 A;  1F62 A;  3HTK C;  3RPG B;  3LQJ A;  2ECG A;  2YSM A;  2LDR A;  2KIZ A;  1N87 A;  2VNF A;  2KFT A;  4R2Y A;  5KH3 A;  4CA1 A;  3KQI A;  2MD8 C;  4PPE A;  2LXP C;  5D1M B;  1MM3 A;  1WEW A;  4LAD B;  3T6R A;  1WGM A;  4A49 A;  4GB0 A;  2LRI C;  4X3G A;  2K4D A;  2UZG A;  3KV5 A;  2KWN A;  5EYA F;  2FSA A;  2XB1 A;  4A4B A;  2ECN A;  3O33 A;  4YBT A;  4B86 C;  2EOD A;  4MVT A;  2BAY A;  5G05 B;  4AYC A;  3PUQ A;  3KNV A;  1T1H A;  2ECV A;  4AUQ B;  4UI9 B;  2KRE A;  2YT5 A;  1MM2 A;  4I7B A;  2I50 A;  2IDA A;  2KE1 A;  2LXH C;  3L1X A;  2C2V S;  3O70 A;  1VFY A;  1U6G B;  1HYI A;  2YYR A;  2VP7 A;  2K17 A;  2LGV A;  1WEE A;  3O36 A;  5TDR A;  2M85 A;  2MA6 A;  2EA6 A;  3I2D A;  1X4J A;  2K1J A;  1JOC A;  2MT5 A;  4R7E A;  4YAD A;  2MNY A;  3FL2 A;  3M62 A;  5B76 A;  3ZPV 1;  2CSZ A;  3MHH A;  3LRQ A;  3DPL R;  3SOW A;  2PNX A;  1ZBD B;  4A4C A;  5LKU A;  2LN0 A;  5FEY A;  4I7D A;  2LQ6 A;  1Z60 A;  2HDP A;  3N9P A;  4F52 B;  2YQM A;  4AP4 A;  4YBS A;  2QIZ A;  3EB5 A;  4YAX A;  5KH7 A;  2NAA A;  1E4U A;  1FBV A;  3GV4 A;  2H0D B;  4Q6F A;  4XI1 A;  3HCS A;  3V43 A;  1V87 A;  5TAB A;  5JG6 A;  1WEP A;  3ZPV E;  2CSY A;  2EGP A;  3QZV A;  1VYX A;  2MNZ A;  1JM7 B;  1Z2Q A;  2OXQ C;  4S3O B;  5G04 B;  2VJE B;  2DX8 A;  2FUI A;  4TKP B;  2YHN A;  4UP0 A;  4GNE A;  2C2L A;  4L58 A;  3RTR B;  3ZYQ A;  4MSX A;  5FER A;  5LKZ A;  4I7C A;  2RSD A;  3C5K A;  2ECJ A;  5TDW A;  1WES A;  2MIQ A;  3DQV R;  4GNG A;  2CKL B;  4UP5 A;  3ZVY A;  2KGG A;  5B79 A;  3SOU A;  4YBM A;  1WEM A;  2K16 A;  1LDK C;  5B8D A;  3U5M A;  5B75 A;  2H0D A;  2RI7 A;  5TRB A;  2LGG A;  2L75 A;  2YHO A;  4LKA A;  4CCG X;  2D8S A;  5DIN A;  4B7Y C;  2YRE A;  3N9L A;  2KR4 A;  2G43 A;  1JM7 A;  4IC2 A;  4LLB A;  4BHW A;  1WEN A;  2VJE A;  3NG2 A;  1WE9 A;  2MUM A;  1WEQ A;  4O64 A;  4P5O B;  5LKX A;  3PUR A;  5D1K B;  5AIT A;  3N9M A;  3M99 A;  2HYE D;  4PTB A;  2KGI A;  5I3L A;  3L1Z B;  2FUU A;  3RPG C;  1LDJ B;  5H9M A;  3MHS A;  2CKL A;  3PHD A;  2F6J A;  3ZNI A;  4FO9 A;  2ZET C;  5LKT A;  1WEV A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  3ASL A;  5C11 A;  5LCW B;  2YUC A;  2XOY A;  5B78 A;  2XOZ A;  3O34 A;  2DSM A;  3FEH A;  2KU3 A;  4LK9 A;  1DCQ A;  3SHB A;  4WZ3 B;  4W4U A;  2JRJ A;  2L5U A;  4QF2 A;  3HCU A;  3LQH A;  4IC3 A;  2JMI A;  2VPD A;  3EB6 A;  2VJF B;  2Y43 A;  2ECT A;  3O35 A;  3U5O A;  2F6N A;  3L11 A;  5TBN A;  1WFK A;  5AIU A;  3U5P A;  2E6R A;  3N9O A;  2MA5 A;  4WZ0 A;  2XEU A;  5G0F A;  3LQI A;  2F42 A;  2G45 A;  2YSJ A;  5H1V A;  2Y1N A;  4QF3 A;  4YAT A;  4WZ2 A;  2JMD A;  5FB0 A;  5C13 A;  2Y1M A;  1XWH A;  4AVX A;  1G25 A;  4L7X A;  3O7A A;  2M3H A;  3T7L A;  2G6Q A;  2LGL A;  2KYU A;  2LV9 A;  3C6W A;  4N4F A;  3HCT A;  4Z0O A;  2E6S A;  3FAN A;  1WEO A;  2MKE A;  4N3W A;  2VJF A;  1X4I A;  2DJA A;  4V3K C;  2MD7 B;  4C9Z A;  2P57 A;  3U5N A;  2KWK A;  3ZTG A;  2YUR A;  4GND A;  2PUY A;  2YW8 A;  1WIL A;  2YQL A;  2QIC A;  5KH9 A;  1BOR A;  4V3L C;  3FM8 C;  4WA6 A;  1WIM A;  5H1T A;  4FIP A;  4A0C D;  5D1L B;  5H1U A;  2M13 A;  2KWO A;  1VD4 A;  3IHP A;  1K2F A;  4YAB A;  1DVP A;  2CRR A;  2L80 A;  5DKA A;  1IYM A;  2ECW A;  3VK6 A;  4YC9 A;  3KV6 A;  2QJ0 A;  4FK5 A;  4NN2 A;  4Z0R A;  3O37 A;  3SOX A;  3M63 A;  1FP0 A;  4ZQL A;  3LVQ E;  2M6M A;  2M1R A;  2L43 A;  4OGC A;  2YU4 A;  3ZVZ B;  4GNF A;  5FB1 A;  1X4U A;  2CT2 A;  1WEU A;  4FJC A;  4S3O C;  5J3X A;  2L0B A;  3T9K A;  4BBQ A;  1CHC A;  4ZDT A;  1HYJ A;  4ZUX U;  2CON A;  1RMD A;  2JMJ A;  2JUN A;  2ECI A;  4LJN A;  4AYC B;  4R8P K;  3N9N A;  1Z6U A;  3H7H A;  2VPB A;  2KWJ A;  3GL6 A;  2VPE A;  3DDT A;  2LGK A;  2VPG A;  3KDE C;  5B77 A;  1F62 A;  3M7K A;  3HTK C;  3RPG B;  3LQJ A;  2ECG A;  2YSM A;  2LDR A;  2KIZ A;  1N87 A;  2VNF A;  2KFT A;  4OGE A;  4R2Y A;  5KH3 A;  4CA1 A;  3KQI A;  2MD8 C;  4PPE A;  2LXP C;  5D1M B;  2FFW A;  1MM3 A;  1WEW A;  4LAD B;  3T6R A;  1WGM A;  4A49 A;  4GB0 A;  2LRI C;  2KKX A;  4X3G A;  2K4D A;  2UZG A;  3Q1D A;  3KV5 A;  2KWN A;  5EYA F;  2FSA A;  2XB1 A;  4A4B A;  5SVI B;  2ECN A;  3O33 A;  2YVR A;  4YBT A;  4B86 C;  2EOD A;  1MBM A;  4MVT A;  2BAY A;  4O62 A;  5G05 B;  4AYC A;  3PUQ A;  3KNV A;  1T1H A;  2ECV A;  4AUQ B;  3LDY A;  4UI9 B;  2KRE A;  2YT5 A;  1MM2 A;  4I7B A;  3DWD A;  2I50 A;  2IDA A;  2RR4 A;  2KE1 A;  2LXH C;  3L1X A;  2C2V S;  3O70 A;  1U6G B;  1VFY A;  1HYI A;  2YYR A;  3LJU X;  2B0O E;  2VP7 A;  2K17 A;  2LGV A;  1WEE A;  3O36 A;  5TDR A;  2M85 A;  2MA6 A;  2FD4 A;  2EA6 A;  3I2D A;  1X4J A;  2K1J A;  1JOC A;  2MT5 A;  4R7E A;  4YAD A;  2MNY A;  3FL2 A;  3M62 A;  5B76 A;  3ZPV 1;  3JUE A;  5SVX A;  2CSZ A;  3MHH A;  3LRQ A;  3DPL R;  3SOW A;  2PNX A;  1ZBD B;  4A4C A;  5LKU A;  2LN0 A;  3FJU B;  3LVR E;  5FEY A;  4I7D A;  2LQ6 A;  1Z60 A;  3O47 A;  2HDP A;  3N9P A;  2EXU A;  4F52 B;  2YQM A;  4AP4 A;  4YBS A;  2QIZ A;  3EB5 A;  4YAX A;  2L7P A;  5KH7 A;  2NAA A;  1E4U A;  1FBV A;  3GV4 A;  3MDB C;  2H0D B;  4Q6F A;  4XI1 A;  3HCS A;  3V43 A;  2LAU A;  1V87 A;  5TAB A;  5JG6 A;  1WEP A;  3ZPV E;  2CSY A;  2EGP A;  3QZV A;  1VYX A;  2MNZ A;  1JM7 B;  1Z2Q A;  2OXQ C;  4S3O B;  5G04 B;  2VJE B;  2DX8 A;  2FUI A;  4TKP B;  2YHN A;  2JM3 A;  3PLW A;  4UP0 A;  2CRW A;  4GNE A;  4F1P A;  2C2L A;  4L58 A;  3RTR B;  3ZYQ A;  4MSX A;  5FER A;  5LKZ A;  3FAO A;  2XOC A;  4I7C A;  3E2D A;  2E61 A;  2RSD A;  3C5K A;  2ECJ A;  5TDW A;  1WES A;  2MIQ A;  3DQV R;  4GNG A;  2CKL B;  4UP5 A;  3ZVY A;  2XP0 A;  2KGG A;  5B79 A;  3SOU A;  4YBM A;  1WEM A;  2K16 A;  1LDK C;  3SUB A;  5B8D A;  3U5M A;  5B75 A;  2H0D A;  2RI7 A;  5TRB A;  2LGG A;  2L75 A;  2YHO A;  4LKA A;  4CCG X;  5SVY A;  2D8S A;  5DIN A;  4B7Y C;  2YRE A;  3N9L A;  2KR4 A;  2G43 A;  1JM7 A;  4IC2 A;  4LLB A;  2EGM A;  4BHW A;  1WEN A;  2VJE A;  3NG2 A;  1WE9 A;  2MUM A;  2CSV A;  2IQJ A;  1WEQ A;  2D8U A;  4O64 A;  4P5O B;  5LKX A;  3PUR A;  5D1K B;  2KKY A;  4QQ4 A;  5SVI A;  5AIT A;  3N9M A;  3M99 A;  2HYE D;  4PTB A;  2KGI A;  5I3L A;  3L1Z B;  2FUU A;  5K3Q A;  3RPG C;  1LDJ B;  2OWA A;  5H9M A;  3MHS A;  2CKL A;  3PHD A;  2F6J A;  3ZNI A;  4FO9 A;  2ZET C;  5LKT A;  4H9D A;  1WEV A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 3N9Q A;  3ASL A;  5C11 A;  5LCW B;  2YUC A;  5B78 A;  3O34 A;  2KU3 A;  4LK9 A;  3SHB A;  4WZ3 B;  4W4U A;  2JRJ A;  2L5U A;  4QF2 A;  3HCU A;  3LQH A;  4IC3 A;  2JMI A;  2VPD A;  3EB6 A;  2VJF B;  2Y43 A;  2ECT A;  3O35 A;  3U5O A;  2F6N A;  3L11 A;  5TBN A;  1WFK A;  5AIU A;  3U5P A;  2E6R A;  3N9O A;  2MA5 A;  4WZ0 A;  2XEU A;  5G0F A;  3LQI A;  2F42 A;  2G45 A;  2YSJ A;  5H1V A;  2Y1N A;  4QF3 A;  4YAT A;  4WZ2 A;  2JMD A;  5FB0 A;  5C13 A;  2Y1M A;  1XWH A;  4AVX A;  1G25 A;  4L7X A;  3O7A A;  2M3H A;  3T7L A;  2G6Q A;  2LGL A;  2KYU A;  2LV9 A;  3C6W A;  4N4F A;  3HCT A;  2E6S A;  1WEO A;  4N3W A;  2VJF A;  1X4I A;  4V3K C;  2MD7 B;  4C9Z A;  3U5N A;  2KWK A;  3ZTG A;  2YUR A;  4GND A;  2PUY A;  2YW8 A;  1WIL A;  2YQL A;  2QIC A;  5KH9 A;  1BOR A;  4V3L C;  4WA6 A;  1WIM A;  5H1T A;  4FIP A;  4A0C D;  5D1L B;  5H1U A;  2KWO A;  1VD4 A;  3IHP A;  1K2F A;  4YAB A;  1DVP A;  2L80 A;  5DKA A;  1IYM A;  2ECW A;  3VK6 A;  4YC9 A;  3KV6 A;  2QJ0 A;  4FK5 A;  4NN2 A;  3O37 A;  3SOX A;  3M63 A;  1FP0 A;  4ZQL A;  2M6M A;  2M1R A;  2L43 A;  3ZVZ B;  2YU4 A;  4GNF A;  5FB1 A;  1X4U A;  2CT2 A;  1WEU A;  4FJC A;  4S3O C;  5J3X A;  2L0B A;  4BBQ A;  1CHC A;  4ZDT A;  1HYJ A;  4ZUX U;  1RMD A;  2JMJ A;  4LJN A;  2ECI A;  4AYC B;  4R8P K;  3N9N A;  1Z6U A;  2VPB A;  2KWJ A;  3GL6 A;  2VPE A;  2LGK A;  2VPG A;  5B77 A;  1F62 A;  3HTK C;  3RPG B;  3LQJ A;  2ECG A;  2YSM A;  2LDR A;  2KIZ A;  1N87 A;  2VNF A;  2KFT A;  4R2Y A;  5KH3 A;  4CA1 A;  3KQI A;  2MD8 C;  4PPE A;  2LXP C;  5D1M B;  1MM3 A;  1WEW A;  4LAD B;  3T6R A;  1WGM A;  4A49 A;  4GB0 A;  2LRI C;  4X3G A;  2K4D A;  2UZG A;  3KV5 A;  2KWN A;  5EYA F;  2FSA A;  2XB1 A;  4A4B A;  2ECN A;  3O33 A;  4YBT A;  4B86 C;  2EOD A;  4MVT A;  2BAY A;  5G05 B;  4AYC A;  3PUQ A;  3KNV A;  1T1H A;  2ECV A;  4AUQ B;  4UI9 B;  2KRE A;  2YT5 A;  1MM2 A;  4I7B A;  2I50 A;  2IDA A;  2KE1 A;  2LXH C;  3L1X A;  2C2V S;  3O70 A;  1VFY A;  1U6G B;  1HYI A;  2YYR A;  2VP7 A;  2K17 A;  2LGV A;  1WEE A;  3O36 A;  5TDR A;  2M85 A;  2MA6 A;  2EA6 A;  3I2D A;  1X4J A;  2K1J A;  1JOC A;  2MT5 A;  4R7E A;  4YAD A;  2MNY A;  3FL2 A;  3M62 A;  5B76 A;  3ZPV 1;  2CSZ A;  3MHH A;  3LRQ A;  3DPL R;  3SOW A;  2PNX A;  1ZBD B;  4A4C A;  5LKU A;  2LN0 A;  5FEY A;  4I7D A;  2LQ6 A;  1Z60 A;  2HDP A;  3N9P A;  4F52 B;  2YQM A;  4AP4 A;  4YBS A;  2QIZ A;  3EB5 A;  4YAX A;  5KH7 A;  2NAA A;  1E4U A;  1FBV A;  3GV4 A;  2H0D B;  4Q6F A;  4XI1 A;  3HCS A;  3V43 A;  1V87 A;  5TAB A;  5JG6 A;  1WEP A;  3ZPV E;  2CSY A;  2EGP A;  3QZV A;  1VYX A;  2MNZ A;  1JM7 B;  1Z2Q A;  2OXQ C;  4S3O B;  5G04 B;  2VJE B;  2DX8 A;  2FUI A;  4TKP B;  2YHN A;  4UP0 A;  4GNE A;  2C2L A;  4L58 A;  3RTR B;  3ZYQ A;  4MSX A;  5FER A;  5LKZ A;  4I7C A;  2RSD A;  3C5K A;  2ECJ A;  5TDW A;  1WES A;  2MIQ A;  3DQV R;  4GNG A;  2CKL B;  4UP5 A;  3ZVY A;  2KGG A;  5B79 A;  3SOU A;  4YBM A;  1WEM A;  2K16 A;  1LDK C;  5B8D A;  3U5M A;  5B75 A;  2H0D A;  2RI7 A;  5TRB A;  2LGG A;  2L75 A;  2YHO A;  4LKA A;  4CCG X;  2D8S A;  5DIN A;  4B7Y C;  2YRE A;  3N9L A;  2KR4 A;  2G43 A;  1JM7 A;  4IC2 A;  4LLB A;  4BHW A;  1WEN A;  2VJE A;  3NG2 A;  1WE9 A;  2MUM A;  1WEQ A;  4O64 A;  4P5O B;  5LKX A;  3PUR A;  5D1K B;  5AIT A;  3N9M A;  3M99 A;  2HYE D;  4PTB A;  2KGI A;  5I3L A;  3L1Z B;  2FUU A;  3RPG C;  1LDJ B;  5H9M A;  3MHS A;  2CKL A;  3PHD A;  2F6J A;  3ZNI A;  4FO9 A;  2ZET C;  5LKT A;  1WEV A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...