5B79A

Crystal structure of dpf2 double phd finger
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
SNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein ubi-d4
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b79A00
2K1JA 2OXQC 4N3WA 5H9MA 2LGGA 2YHNA 2F6JA 2QJ0A 2KWJA 2KWNA 1FP0A 1JOCA 5KH3A 5KH9A 3T6RA 4PPEA 4V3LC 4I7DA 3N9QA 2CKLA 4YC9A 3HTKC 2FUIA 5C11A 2VNFA 5LKXA 2PNXA 3U5MA 3FL2A 3MHSA 3N9OA 1WESA 2E6SA 3PUQA 4QF3A 2KR4A 2YU4A 4I7BA 4WZ0A 2MD7B 5FEYA 3O7AA 5LCWB 2IDAA 5B75A 4YABA 1WEUA 4FK5A 5G05B 1WEWA 4CA1A 4ZDTA 5TABA 4CCGX 2VPEA 5FB1A 2VJEB 1Z6UA 4W4UA 1DVPA 5LKUA 3U5OA 2KGGA 4IC3A 3LQJA 4S3OC 2HYED 1RMDA 2AN6A 2PUYA 3N9PA 4ZUXU 3N9NA 3O70A 5B79A 2EGPA 3L1XA 5DKAA 2KYUA 3M63A 5G0FA 3O37A 4TKPB 4GNGA 4B86C 1U6GB 2EA6A 2JMIA 3U5PA 5I3LA 5FB0A 4YAXA 1VFYA 4L7XA 4ZQLA 2L43A 5D1MB 4PTBA 2MNYA 3SOXA 1WEQA 2RI7A 2YSJA 4Q6FA 4FJCA 2YSMA 4A4CA 2DX8A 3LRQA 4XI1A 2RSDA 4R8PK 1ZBDB 1WGMA 2D8SA 5B8DA 2CSZA 1WFKA 4WZ2A 4BHWA 2YW8A 2KIZA 2MNZA 2LDRA 3HCSA 1K2FA 3N9LA 3PHDA 5TDRA 1WEPA 5B76A 5D1LB 2JMJA 4AYCA 2VPDA 4GB0A 1WEOA 2CSYA 2M6MA 3L11A 2KREA 1LDJB 2UZGA 5KH7A 3RTRB 5H1VA 3ZPV1 4F52B 2VJEA 2VPGA 3ZVZB 4UP5A 2M1RA 2EODA 3M99A 3EB6A 2VP7A 3HCTA 2YHOA 2G6QA 5H1TA 2CKLB 1FBVA 2XEUA 2L0BA 3V43A 1X4UA 2H0DB 2C2VS 4P5OB 2G45A 2LN0A 4FIPA 4L58A 2KWOA 2Y1NA 3O33A 2C2LA 4YATA 5JG6A 2K4DA 2L80A 2Y43A 4O64A 2QICA 2CT2A 3SOWA 4UI9B 1WEEA 3EB5A 1F62A 2KGIA 2ECNA 4B7YC 4YBSA 2MT5A 3T7LA 2VJFA 5TDWA 4R2YA 4C9ZA 4YBMA 4A0CD 2ZETC 3HCUA 3DQVR 2YQMA 2F6NA 3ZYQA 5LKTA 5LKZA 3I2DA 5EYAF 5J3XA 3KQIA 4LADB 1WIMA 2JRJA 2YUCA 5G04B 4IC2A 2MD8C 1WENA 2KU3A 2LQ6A 2LGLA 2YT5A 4UP0A 1X4IA 3C6WA 2FUUA 1Z2QA 2M85A 2KFTA 2QIZA 5C13A 3O35A 4AP4A 1E4UA 4LJNA 1VYXA 3KNVA 3LQHA 1HYIA 2MA6A 4NN2A 5D1KB 2I50A 5TBNA 4WA6A 1WEMA 1JM7B 5DINA 2ECWA 4GNDA 2NAAA 3DPLR 3RPGC 2YREA 2LGVA 2ECTA 1WE9A 3PURA 3O36A 3SHBA 3VK6A 2H0DA 2JMDA 3C5KA 2LXHC 3MHHA 2XB1A 1X4JA 1XWHA 2ECGA 4QF2A 3ZVYA 4AVXA 4BBQA 4X3GA 4WZ3B 2KWKA 3ZTGA 3ZPVE 2ECVA 2ECJA 3RPGB 4AYCB 1MM2A 2L75A 4AUQB 2K17A 4A4BA 1G25A 3KV6A 4GNFA 4GNEA 3GV4A 4FO9A 1HYJA 2LRIC 3ZNIA 2M3HA 4V3KC 5AIUA 1WEVA 1CHCA 4YBTA 2MUMA 2LGKA 3ASLA 1V87A 4MSXA 2BAYA 2YQLA 1Z60A 2YURA 1VD4A 3O34A 2E6RA 4A49A 3SOUA 2K16A 2MIQA 2YYRA 2KE1A 3KV5A 5TRBA 2LXPC 1T1HA 2ECIA 3NG2A 4LLBA 3GL6A 3N9MA 3LQIA 3L1ZB 4N4FA 2HDPA 1BORA 5FERA 4R7EA 4I7CA 1N87A 4S3OB 5B78A 2VJFB 3M62A 2MA5A 2F42A 3U5NA 3IHPA 5B77A 2Y1MA 2VPBA 1MM3A 5AITA 1LDKC 1WILA 4LKAA 1JM7A 4LK9A 2G43A 4YADA 3QZVA 5H1UA 2LV9A 2FSAA 2L5UA 1IYMA 4MVTA
chains in the Genus database with same CATH superfamily
2K1JA 2OXQC 4N3WA 5H9MA 2LGGA 2YHNA 2F6JA 2QJ0A 2KWJA 2KWNA 1FP0A 1JOCA 5KH3A 5KH9A 3T6RA 4PPEA 4V3LC 4I7DA 3N9QA 2CKLA 3LVQE 4YC9A 3FM8C 3HTKC 2FUIA 3M7KA 5C11A 3JUEA 2VNFA 5LKXA 2PNXA 3U5MA 3FL2A 3MHSA 3N9OA 1WESA 5K3QA 2E6SA 3PUQA 2XOCA 2KR4A 4QF3A 2YU4A 4I7BA 4WZ0A 2MD7B 5FEYA 3O7AA 5LCWB 2IDAA 5B75A 4YABA 1WEUA 4FK5A 5G05B 1WEWA 2CRRA 4CA1A 4ZDTA 5TABA 4CCGX 2VPEA 5FB1A 2VJEB 1Z6UA 4W4UA 1DVPA 5LKUA 3U5OA 2KGGA 2CONA 4IC3A 3LQJA 4S3OC 2HYED 1RMDA 3DDTA 5SVYA 2AN6A 2PUYA 3N9PA 4ZUXU 3N9NA 3O70A 5B79A 2EGPA 3L1XA 5DKAA 2KYUA 3M63A 5G0FA 3O37A 3DWDA 3FEHA 4GNGA 4TKPB 4B86C 1U6GB 2B0OE 2EA6A 2JMIA 3U5PA 5I3LA 5FB0A 2L7PA 4YAXA 1VFYA 4L7XA 4ZQLA 2L43A 4OGCA 2EXUA 5D1MB 3LVRE 4PTBA 2MNYA 3SOXA 1WEQA 2RI7A 2YSJA 4Q6FA 4FJCA 2YSMA 4A4CA 2DX8A 3LRQA 4XI1A 4Z0RA 2RSDA 4R8PK 1ZBDB 1WGMA 2EGMA 2D8SA 5B8DA 2CSZA 1WFKA 3T9KA 2LAUA 2OWAA 3LDYA 4WZ2A 4BHWA 3H7HA 2YW8A 2KIZA 2MNZA 2XOZA 2LDRA 3HCSA 1K2FA 3N9LA 3PHDA 5TDRA 1WEPA 5B76A 5D1LB 2JMJA 4AYCA 2VPDA 4GB0A 1WEOA 2CSYA 2M6MA 3L11A 2KREA 1LDJB 2UZGA 5KH7A 3RTRB 5H1VA 3ZPV1 4F52B 2VJEA 2VPGA 3ZVZB 4UP5A 2M1RA 2EODA 2JUNA 3M99A 3EB6A 2VP7A 3HCTA 2YHOA 2G6QA 5H1TA 3SUBA 2CKLB 1FBVA 2XEUA 2L0BA 3V43A 1X4UA 2H0DB 2C2VS 4P5OB 2G45A 2LN0A 4FIPA 4L58A 5SVIB 2IQJA 2KWOA 2Y1NA 3O33A 2D8UA 2C2LA 4YATA 5JG6A 2K4DA 2L80A 2Y43A 4O64A 2QICA 3Q1DA 2CT2A 3SOWA 4UI9B 1WEEA 3FANA 3FJUB 3EB5A 1F62A 2KGIA 2ECNA 4B7YC 4YBSA 2MT5A 3T7LA 2VJFA 5TDWA 4R2YA 4C9ZA 4YBMA 4A0CD 2ZETC 2XP0A 3HCUA 3DQVR 2YQMA 2F6NA 2DJAA 3ZYQA 2CRWA 3FAOA 5LKTA 5LKZA 3I2DA 2XOYA 5EYAF 5J3XA 3MDBC 3KQIA 4LADB 1WIMA 2JRJA 2YUCA 5G04B 4IC2A 2MD8C 1WENA 2KU3A 2LQ6A 2LGLA 2YT5A 4UP0A 1X4IA 3C6WA 2FUUA 1Z2QA 2M85A 2KFTA 2QIZA 2M13A 5C13A 3O35A 3LJUX 4AP4A 1E4UA 2E61A 4LJNA 1VYXA 3KNVA 3LQHA 1HYIA 2YVRA 2MA6A 4NN2A 5D1KB 4Z0OA 1MBMA 2I50A 5TBNA 2KKYA 4WA6A 1WEMA 1JM7B 5SVXA 5DINA 2ECWA 4GNDA 2NAAA 3DPLR 3RPGC 2YREA 2LGVA 2ECTA 1WE9A 3PURA 3O36A 3SHBA 3VK6A 2H0DA 2JMDA 3C5KA 5SVIA 4F1PA 2DSMA 2LXHC 3MHHA 2XB1A 1X4JA 4H9DA 1XWHA 2ECGA 4QF2A 3ZVYA 4AVXA 4BBQA 4X3GA 4WZ3B 2KWKA 3ZTGA 3ZPVE 2ECVA 2ECJA 3RPGB 4AYCB 1MM2A 2L75A 4AUQB 2K17A 1DCQA 4A4BA 1G25A 3KV6A 4GNFA 4GNEA 3GV4A 3KDEC 4FO9A 1HYJA 2LRIC 3ZNIA 2M3HA 4V3KC 2CSVA 5AIUA 1WEVA 1CHCA 4YBTA 2MUMA 2LGKA 3ASLA 1V87A 4MSXA 4O62A 2BAYA 4QQ4A 2MKEA 2YQLA 1Z60A 2YURA 1VD4A 3O34A 2E6RA 4A49A 3SOUA 2K16A 2MIQA 2YYRA 2KE1A 3KV5A 5TRBA 2FD4A 2LXPC 1T1HA 2ECIA 3NG2A 4LLBA 3GL6A 3N9MA 2KKXA 3LQIA 3L1ZB 4N4FA 2HDPA 3E2DA 1BORA 5FERA 4R7EA 4I7CA 1N87A 4S3OB 5B78A 2VJFB 3M62A 2MA5A 2F42A 3U5NA 3IHPA 5B77A 2Y1MA 2JM3A 2FFWA 2RR4A 2VPBA 1MM3A 3PLWA 3O47A 5AITA 1LDKC 1WILA 4LKAA 1JM7A 4LK9A 2G43A 4YADA 3QZVA 5H1UA 2LV9A 2P57A 2FSAA 2L5UA 1IYMA 4OGEA 4MVTA
chains in the Genus database with same CATH topology
2K1JA 2OXQC 4N3WA 5H9MA 2LGGA 2YHNA 2F6JA 2QJ0A 2KWJA 2KWNA 1FP0A 1JOCA 5KH3A 5KH9A 3T6RA 4PPEA 4V3LC 4I7DA 3N9QA 2CKLA 4YC9A 3HTKC 2FUIA 5C11A 2VNFA 5LKXA 2PNXA 3U5MA 3FL2A 3MHSA 3N9OA 1WESA 2E6SA 3PUQA 4QF3A 2KR4A 2YU4A 4I7BA 4WZ0A 2MD7B 5FEYA 3O7AA 5LCWB 2IDAA 5B75A 4YABA 1WEUA 4FK5A 5G05B 1WEWA 4CA1A 4ZDTA 5TABA 4CCGX 2VPEA 5FB1A 2VJEB 1Z6UA 4W4UA 1DVPA 5LKUA 3U5OA 2KGGA 4IC3A 3LQJA 4S3OC 2HYED 1RMDA 2AN6A 2PUYA 3N9PA 4ZUXU 3N9NA 3O70A 5B79A 2EGPA 3L1XA 5DKAA 2KYUA 3M63A 5G0FA 3O37A 4TKPB 4GNGA 4B86C 1U6GB 2EA6A 2JMIA 3U5PA 5I3LA 5FB0A 4YAXA 1VFYA 4L7XA 4ZQLA 2L43A 5D1MB 4PTBA 2MNYA 3SOXA 1WEQA 2RI7A 2YSJA 4Q6FA 4FJCA 2YSMA 4A4CA 2DX8A 3LRQA 4XI1A 2RSDA 4R8PK 1ZBDB 1WGMA 2D8SA 5B8DA 2CSZA 1WFKA 4WZ2A 4BHWA 2YW8A 2KIZA 2MNZA 2LDRA 3HCSA 1K2FA 3N9LA 3PHDA 5TDRA 1WEPA 5B76A 5D1LB 2JMJA 4AYCA 2VPDA 4GB0A 1WEOA 2CSYA 2M6MA 3L11A 2KREA 1LDJB 2UZGA 5KH7A 3RTRB 5H1VA 3ZPV1 4F52B 2VJEA 2VPGA 3ZVZB 4UP5A 2M1RA 2EODA 3M99A 3EB6A 2VP7A 3HCTA 2YHOA 2G6QA 5H1TA 2CKLB 1FBVA 2XEUA 2L0BA 3V43A 1X4UA 2H0DB 2C2VS 4P5OB 2G45A 2LN0A 4FIPA 4L58A 2KWOA 2Y1NA 3O33A 2C2LA 4YATA 5JG6A 2K4DA 2L80A 2Y43A 4O64A 2QICA 2CT2A 3SOWA 4UI9B 1WEEA 3EB5A 1F62A 2KGIA 2ECNA 4B7YC 4YBSA 2MT5A 3T7LA 2VJFA 5TDWA 4R2YA 4C9ZA 4YBMA 4A0CD 2ZETC 3HCUA 3DQVR 2YQMA 2F6NA 3ZYQA 5LKTA 5LKZA 3I2DA 5EYAF 5J3XA 3KQIA 4LADB 1WIMA 2JRJA 2YUCA 5G04B 4IC2A 2MD8C 1WENA 2KU3A 2LQ6A 2LGLA 2YT5A 4UP0A 1X4IA 3C6WA 2FUUA 1Z2QA 2M85A 2KFTA 2QIZA 5C13A 3O35A 4AP4A 1E4UA 4LJNA 1VYXA 3KNVA 3LQHA 1HYIA 2MA6A 4NN2A 5D1KB 2I50A 5TBNA 4WA6A 1WEMA 1JM7B 5DINA 2ECWA 4GNDA 2NAAA 3DPLR 3RPGC 2YREA 2LGVA 2ECTA 1WE9A 3PURA 3O36A 3SHBA 3VK6A 2H0DA 2JMDA 3C5KA 2LXHC 3MHHA 2XB1A 1X4JA 1XWHA 2ECGA 4QF2A 3ZVYA 4AVXA 4BBQA 4X3GA 4WZ3B 2KWKA 3ZTGA 3ZPVE 2ECVA 2ECJA 3RPGB 4AYCB 1MM2A 2L75A 4AUQB 2K17A 4A4BA 1G25A 3KV6A 4GNFA 4GNEA 3GV4A 4FO9A 1HYJA 2LRIC 3ZNIA 2M3HA 4V3KC 5AIUA 1WEVA 1CHCA 4YBTA 2MUMA 2LGKA 3ASLA 1V87A 4MSXA 2BAYA 2YQLA 1Z60A 2YURA 1VD4A 3O34A 2E6RA 4A49A 3SOUA 2K16A 2MIQA 2YYRA 2KE1A 3KV5A 5TRBA 2LXPC 1T1HA 2ECIA 3NG2A 4LLBA 3GL6A 3N9MA 3LQIA 3L1ZB 4N4FA 2HDPA 1BORA 5FERA 4R7EA 4I7CA 1N87A 4S3OB 5B78A 2VJFB 3M62A 2MA5A 2F42A 3U5NA 3IHPA 5B77A 2Y1MA 2VPBA 1MM3A 5AITA 1LDKC 1WILA 4LKAA 1JM7A 4LK9A 2G43A 4YADA 3QZVA 5H1UA 2LV9A 2FSAA 2L5UA 1IYMA 4MVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1J A;  2OXQ C;  4N3W A;  5H9M A;  2LGG A;  2YHN A;  2F6J A;  2QJ0 A;  2KWJ A;  2KWN A;  1FP0 A;  1JOC A;  5KH3 A;  5KH9 A;  3T6R A;  4PPE A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  4YC9 A;  3HTK C;  2FUI A;  5C11 A;  2VNF A;  5LKX A;  2PNX A;  3U5M A;  3FL2 A;  3MHS A;  3N9O A;  1WES A;  2E6S A;  3PUQ A;  4QF3 A;  2KR4 A;  2YU4 A;  4I7B A;  4WZ0 A;  2MD7 B;  5FEY A;  3O7A A;  5LCW B;  2IDA A;  5B75 A;  4YAB A;  1WEU A;  4FK5 A;  5G05 B;  1WEW A;  4CA1 A;  4ZDT A;  5TAB A;  4CCG X;  2VPE A;  5FB1 A;  2VJE B;  1Z6U A;  4W4U A;  1DVP A;  5LKU A;  3U5O A;  2KGG A;  4IC3 A;  3LQJ A;  4S3O C;  2HYE D;  1RMD A;  2AN6 A;  2PUY A;  3N9P A;  4ZUX U;  3N9N A;  3O70 A;  5B79 A;  2EGP A;  3L1X A;  5DKA A;  2KYU A;  3M63 A;  5G0F A;  3O37 A;  4TKP B;  4GNG A;  4B86 C;  1U6G B;  2EA6 A;  2JMI A;  3U5P A;  5I3L A;  5FB0 A;  4YAX A;  1VFY A;  4L7X A;  4ZQL A;  2L43 A;  5D1M B;  4PTB A;  2MNY A;  3SOX A;  1WEQ A;  2RI7 A;  2YSJ A;  4Q6F A;  4FJC A;  2YSM A;  4A4C A;  2DX8 A;  3LRQ A;  4XI1 A;  2RSD A;  4R8P K;  1ZBD B;  1WGM A;  2D8S A;  5B8D A;  2CSZ A;  1WFK A;  4WZ2 A;  4BHW A;  2YW8 A;  2KIZ A;  2MNZ A;  2LDR A;  3HCS A;  1K2F A;  3N9L A;  3PHD A;  5TDR A;  1WEP A;  5B76 A;  5D1L B;  2JMJ A;  4AYC A;  2VPD A;  4GB0 A;  1WEO A;  2CSY A;  2M6M A;  3L11 A;  2KRE A;  1LDJ B;  2UZG A;  5KH7 A;  3RTR B;  5H1V A;  3ZPV 1;  4F52 B;  2VJE A;  2VPG A;  3ZVZ B;  4UP5 A;  2M1R A;  2EOD A;  3M99 A;  3EB6 A;  2VP7 A;  3HCT A;  2YHO A;  2G6Q A;  5H1T A;  2CKL B;  1FBV A;  2XEU A;  2L0B A;  3V43 A;  1X4U A;  2H0D B;  2C2V S;  4P5O B;  2G45 A;  2LN0 A;  4FIP A;  4L58 A;  2KWO A;  2Y1N A;  3O33 A;  2C2L A;  4YAT A;  5JG6 A;  2K4D A;  2L80 A;  2Y43 A;  4O64 A;  2QIC A;  2CT2 A;  3SOW A;  4UI9 B;  1WEE A;  3EB5 A;  1F62 A;  2KGI A;  2ECN A;  4B7Y C;  4YBS A;  2MT5 A;  3T7L A;  2VJF A;  5TDW A;  4R2Y A;  4C9Z A;  4YBM A;  4A0C D;  2ZET C;  3HCU A;  3DQV R;  2YQM A;  2F6N A;  3ZYQ A;  5LKT A;  5LKZ A;  3I2D A;  5EYA F;  5J3X A;  3KQI A;  4LAD B;  1WIM A;  2JRJ A;  2YUC A;  5G04 B;  4IC2 A;  2MD8 C;  1WEN A;  2KU3 A;  2LQ6 A;  2LGL A;  2YT5 A;  4UP0 A;  1X4I A;  3C6W A;  2FUU A;  1Z2Q A;  2M85 A;  2KFT A;  2QIZ A;  5C13 A;  3O35 A;  4AP4 A;  1E4U A;  4LJN A;  1VYX A;  3KNV A;  3LQH A;  1HYI A;  2MA6 A;  4NN2 A;  5D1K B;  2I50 A;  5TBN A;  4WA6 A;  1WEM A;  1JM7 B;  5DIN A;  2ECW A;  4GND A;  2NAA A;  3DPL R;  3RPG C;  2YRE A;  2LGV A;  2ECT A;  1WE9 A;  3PUR A;  3O36 A;  3SHB A;  3VK6 A;  2H0D A;  2JMD A;  3C5K A;  2LXH C;  3MHH A;  2XB1 A;  1X4J A;  1XWH A;  2ECG A;  4QF2 A;  3ZVY A;  4AVX A;  4BBQ A;  4X3G A;  4WZ3 B;  2KWK A;  3ZTG A;  3ZPV E;  2ECV A;  2ECJ A;  3RPG B;  4AYC B;  1MM2 A;  2L75 A;  4AUQ B;  2K17 A;  4A4B A;  1G25 A;  3KV6 A;  4GNF A;  4GNE A;  3GV4 A;  4FO9 A;  1HYJ A;  2LRI C;  3ZNI A;  2M3H A;  4V3K C;  5AIU A;  1WEV A;  1CHC A;  4YBT A;  2MUM A;  2LGK A;  3ASL A;  1V87 A;  4MSX A;  2BAY A;  2YQL A;  1Z60 A;  2YUR A;  1VD4 A;  3O34 A;  2E6R A;  4A49 A;  3SOU A;  2K16 A;  2MIQ A;  2YYR A;  2KE1 A;  3KV5 A;  5TRB A;  2LXP C;  1T1H A;  2ECI A;  3NG2 A;  4LLB A;  3GL6 A;  3N9M A;  3LQI A;  3L1Z B;  4N4F A;  2HDP A;  1BOR A;  5FER A;  4R7E A;  4I7C A;  1N87 A;  4S3O B;  5B78 A;  2VJF B;  3M62 A;  2MA5 A;  2F42 A;  3U5N A;  3IHP A;  5B77 A;  2Y1M A;  2VPB A;  1MM3 A;  5AIT A;  1LDK C;  1WIL A;  4LKA A;  1JM7 A;  4LK9 A;  2G43 A;  4YAD A;  3QZV A;  5H1U A;  2LV9 A;  2FSA A;  2L5U A;  1IYM A;  4MVT A; 
#chains in the Genus database with same CATH topology
 2K1J A;  2OXQ C;  4N3W A;  5H9M A;  2LGG A;  2YHN A;  2F6J A;  2QJ0 A;  2KWJ A;  2KWN A;  1FP0 A;  1JOC A;  5KH3 A;  5KH9 A;  3T6R A;  4PPE A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  3LVQ E;  4YC9 A;  3FM8 C;  3HTK C;  2FUI A;  3M7K A;  5C11 A;  3JUE A;  2VNF A;  5LKX A;  2PNX A;  3U5M A;  3FL2 A;  3MHS A;  3N9O A;  1WES A;  5K3Q A;  2E6S A;  3PUQ A;  2XOC A;  2KR4 A;  4QF3 A;  2YU4 A;  4I7B A;  4WZ0 A;  2MD7 B;  5FEY A;  3O7A A;  5LCW B;  2IDA A;  5B75 A;  4YAB A;  1WEU A;  4FK5 A;  5G05 B;  1WEW A;  2CRR A;  4CA1 A;  4ZDT A;  5TAB A;  4CCG X;  2VPE A;  5FB1 A;  2VJE B;  1Z6U A;  4W4U A;  1DVP A;  5LKU A;  3U5O A;  2KGG A;  2CON A;  4IC3 A;  3LQJ A;  4S3O C;  2HYE D;  1RMD A;  3DDT A;  5SVY A;  2AN6 A;  2PUY A;  3N9P A;  4ZUX U;  3N9N A;  3O70 A;  5B79 A;  2EGP A;  3L1X A;  5DKA A;  2KYU A;  3M63 A;  5G0F A;  3O37 A;  3DWD A;  3FEH A;  4GNG A;  4TKP B;  4B86 C;  1U6G B;  2B0O E;  2EA6 A;  2JMI A;  3U5P A;  5I3L A;  5FB0 A;  2L7P A;  4YAX A;  1VFY A;  4L7X A;  4ZQL A;  2L43 A;  4OGC A;  2EXU A;  5D1M B;  3LVR E;  4PTB A;  2MNY A;  3SOX A;  1WEQ A;  2RI7 A;  2YSJ A;  4Q6F A;  4FJC A;  2YSM A;  4A4C A;  2DX8 A;  3LRQ A;  4XI1 A;  4Z0R A;  2RSD A;  4R8P K;  1ZBD B;  1WGM A;  2EGM A;  2D8S A;  5B8D A;  2CSZ A;  1WFK A;  3T9K A;  2LAU A;  2OWA A;  3LDY A;  4WZ2 A;  4BHW A;  3H7H A;  2YW8 A;  2KIZ A;  2MNZ A;  2XOZ A;  2LDR A;  3HCS A;  1K2F A;  3N9L A;  3PHD A;  5TDR A;  1WEP A;  5B76 A;  5D1L B;  2JMJ A;  4AYC A;  2VPD A;  4GB0 A;  1WEO A;  2CSY A;  2M6M A;  3L11 A;  2KRE A;  1LDJ B;  2UZG A;  5KH7 A;  3RTR B;  5H1V A;  3ZPV 1;  4F52 B;  2VJE A;  2VPG A;  3ZVZ B;  4UP5 A;  2M1R A;  2EOD A;  2JUN A;  3M99 A;  3EB6 A;  2VP7 A;  3HCT A;  2YHO A;  2G6Q A;  5H1T A;  3SUB A;  2CKL B;  1FBV A;  2XEU A;  2L0B A;  3V43 A;  1X4U A;  2H0D B;  2C2V S;  4P5O B;  2G45 A;  2LN0 A;  4FIP A;  4L58 A;  5SVI B;  2IQJ A;  2KWO A;  2Y1N A;  3O33 A;  2D8U A;  2C2L A;  4YAT A;  5JG6 A;  2K4D A;  2L80 A;  2Y43 A;  4O64 A;  2QIC A;  3Q1D A;  2CT2 A;  3SOW A;  4UI9 B;  1WEE A;  3FAN A;  3FJU B;  3EB5 A;  1F62 A;  2KGI A;  2ECN A;  4B7Y C;  4YBS A;  2MT5 A;  3T7L A;  2VJF A;  5TDW A;  4R2Y A;  4C9Z A;  4YBM A;  4A0C D;  2ZET C;  2XP0 A;  3HCU A;  3DQV R;  2YQM A;  2F6N A;  2DJA A;  3ZYQ A;  2CRW A;  3FAO A;  5LKT A;  5LKZ A;  3I2D A;  2XOY A;  5EYA F;  5J3X A;  3MDB C;  3KQI A;  4LAD B;  1WIM A;  2JRJ A;  2YUC A;  5G04 B;  4IC2 A;  2MD8 C;  1WEN A;  2KU3 A;  2LQ6 A;  2LGL A;  2YT5 A;  4UP0 A;  1X4I A;  3C6W A;  2FUU A;  1Z2Q A;  2M85 A;  2KFT A;  2QIZ A;  2M13 A;  5C13 A;  3O35 A;  3LJU X;  4AP4 A;  1E4U A;  2E61 A;  4LJN A;  1VYX A;  3KNV A;  3LQH A;  1HYI A;  2YVR A;  2MA6 A;  4NN2 A;  5D1K B;  4Z0O A;  1MBM A;  2I50 A;  5TBN A;  2KKY A;  4WA6 A;  1WEM A;  1JM7 B;  5SVX A;  5DIN A;  2ECW A;  4GND A;  2NAA A;  3DPL R;  3RPG C;  2YRE A;  2LGV A;  2ECT A;  1WE9 A;  3PUR A;  3O36 A;  3SHB A;  3VK6 A;  2H0D A;  2JMD A;  3C5K A;  5SVI A;  4F1P A;  2DSM A;  2LXH C;  3MHH A;  2XB1 A;  1X4J A;  4H9D A;  1XWH A;  2ECG A;  4QF2 A;  3ZVY A;  4AVX A;  4BBQ A;  4X3G A;  4WZ3 B;  2KWK A;  3ZTG A;  3ZPV E;  2ECV A;  2ECJ A;  3RPG B;  4AYC B;  1MM2 A;  2L75 A;  4AUQ B;  2K17 A;  1DCQ A;  4A4B A;  1G25 A;  3KV6 A;  4GNF A;  4GNE A;  3GV4 A;  3KDE C;  4FO9 A;  1HYJ A;  2LRI C;  3ZNI A;  2M3H A;  4V3K C;  2CSV A;  5AIU A;  1WEV A;  1CHC A;  4YBT A;  2MUM A;  2LGK A;  3ASL A;  1V87 A;  4MSX A;  4O62 A;  2BAY A;  4QQ4 A;  2MKE A;  2YQL A;  1Z60 A;  2YUR A;  1VD4 A;  3O34 A;  2E6R A;  4A49 A;  3SOU A;  2K16 A;  2MIQ A;  2YYR A;  2KE1 A;  3KV5 A;  5TRB A;  2FD4 A;  2LXP C;  1T1H A;  2ECI A;  3NG2 A;  4LLB A;  3GL6 A;  3N9M A;  2KKX A;  3LQI A;  3L1Z B;  4N4F A;  2HDP A;  3E2D A;  1BOR A;  5FER A;  4R7E A;  4I7C A;  1N87 A;  4S3O B;  5B78 A;  2VJF B;  3M62 A;  2MA5 A;  2F42 A;  3U5N A;  3IHP A;  5B77 A;  2Y1M A;  2JM3 A;  2FFW A;  2RR4 A;  2VPB A;  1MM3 A;  3PLW A;  3O47 A;  5AIT A;  1LDK C;  1WIL A;  4LKA A;  1JM7 A;  4LK9 A;  2G43 A;  4YAD A;  3QZV A;  5H1U A;  2LV9 A;  2P57 A;  2FSA A;  2L5U A;  1IYM A;  4OGE A;  4MVT A; 
#chains in the Genus database with same CATH homology
 2K1J A;  2OXQ C;  4N3W A;  5H9M A;  2LGG A;  2YHN A;  2F6J A;  2QJ0 A;  2KWJ A;  2KWN A;  1FP0 A;  1JOC A;  5KH3 A;  5KH9 A;  3T6R A;  4PPE A;  4V3L C;  4I7D A;  3N9Q A;  2CKL A;  4YC9 A;  3HTK C;  2FUI A;  5C11 A;  2VNF A;  5LKX A;  2PNX A;  3U5M A;  3FL2 A;  3MHS A;  3N9O A;  1WES A;  2E6S A;  3PUQ A;  4QF3 A;  2KR4 A;  2YU4 A;  4I7B A;  4WZ0 A;  2MD7 B;  5FEY A;  3O7A A;  5LCW B;  2IDA A;  5B75 A;  4YAB A;  1WEU A;  4FK5 A;  5G05 B;  1WEW A;  4CA1 A;  4ZDT A;  5TAB A;  4CCG X;  2VPE A;  5FB1 A;  2VJE B;  1Z6U A;  4W4U A;  1DVP A;  5LKU A;  3U5O A;  2KGG A;  4IC3 A;  3LQJ A;  4S3O C;  2HYE D;  1RMD A;  2AN6 A;  2PUY A;  3N9P A;  4ZUX U;  3N9N A;  3O70 A;  5B79 A;  2EGP A;  3L1X A;  5DKA A;  2KYU A;  3M63 A;  5G0F A;  3O37 A;  4TKP B;  4GNG A;  4B86 C;  1U6G B;  2EA6 A;  2JMI A;  3U5P A;  5I3L A;  5FB0 A;  4YAX A;  1VFY A;  4L7X A;  4ZQL A;  2L43 A;  5D1M B;  4PTB A;  2MNY A;  3SOX A;  1WEQ A;  2RI7 A;  2YSJ A;  4Q6F A;  4FJC A;  2YSM A;  4A4C A;  2DX8 A;  3LRQ A;  4XI1 A;  2RSD A;  4R8P K;  1ZBD B;  1WGM A;  2D8S A;  5B8D A;  2CSZ A;  1WFK A;  4WZ2 A;  4BHW A;  2YW8 A;  2KIZ A;  2MNZ A;  2LDR A;  3HCS A;  1K2F A;  3N9L A;  3PHD A;  5TDR A;  1WEP A;  5B76 A;  5D1L B;  2JMJ A;  4AYC A;  2VPD A;  4GB0 A;  1WEO A;  2CSY A;  2M6M A;  3L11 A;  2KRE A;  1LDJ B;  2UZG A;  5KH7 A;  3RTR B;  5H1V A;  3ZPV 1;  4F52 B;  2VJE A;  2VPG A;  3ZVZ B;  4UP5 A;  2M1R A;  2EOD A;  3M99 A;  3EB6 A;  2VP7 A;  3HCT A;  2YHO A;  2G6Q A;  5H1T A;  2CKL B;  1FBV A;  2XEU A;  2L0B A;  3V43 A;  1X4U A;  2H0D B;  2C2V S;  4P5O B;  2G45 A;  2LN0 A;  4FIP A;  4L58 A;  2KWO A;  2Y1N A;  3O33 A;  2C2L A;  4YAT A;  5JG6 A;  2K4D A;  2L80 A;  2Y43 A;  4O64 A;  2QIC A;  2CT2 A;  3SOW A;  4UI9 B;  1WEE A;  3EB5 A;  1F62 A;  2KGI A;  2ECN A;  4B7Y C;  4YBS A;  2MT5 A;  3T7L A;  2VJF A;  5TDW A;  4R2Y A;  4C9Z A;  4YBM A;  4A0C D;  2ZET C;  3HCU A;  3DQV R;  2YQM A;  2F6N A;  3ZYQ A;  5LKT A;  5LKZ A;  3I2D A;  5EYA F;  5J3X A;  3KQI A;  4LAD B;  1WIM A;  2JRJ A;  2YUC A;  5G04 B;  4IC2 A;  2MD8 C;  1WEN A;  2KU3 A;  2LQ6 A;  2LGL A;  2YT5 A;  4UP0 A;  1X4I A;  3C6W A;  2FUU A;  1Z2Q A;  2M85 A;  2KFT A;  2QIZ A;  5C13 A;  3O35 A;  4AP4 A;  1E4U A;  4LJN A;  1VYX A;  3KNV A;  3LQH A;  1HYI A;  2MA6 A;  4NN2 A;  5D1K B;  2I50 A;  5TBN A;  4WA6 A;  1WEM A;  1JM7 B;  5DIN A;  2ECW A;  4GND A;  2NAA A;  3DPL R;  3RPG C;  2YRE A;  2LGV A;  2ECT A;  1WE9 A;  3PUR A;  3O36 A;  3SHB A;  3VK6 A;  2H0D A;  2JMD A;  3C5K A;  2LXH C;  3MHH A;  2XB1 A;  1X4J A;  1XWH A;  2ECG A;  4QF2 A;  3ZVY A;  4AVX A;  4BBQ A;  4X3G A;  4WZ3 B;  2KWK A;  3ZTG A;  3ZPV E;  2ECV A;  2ECJ A;  3RPG B;  4AYC B;  1MM2 A;  2L75 A;  4AUQ B;  2K17 A;  4A4B A;  1G25 A;  3KV6 A;  4GNF A;  4GNE A;  3GV4 A;  4FO9 A;  1HYJ A;  2LRI C;  3ZNI A;  2M3H A;  4V3K C;  5AIU A;  1WEV A;  1CHC A;  4YBT A;  2MUM A;  2LGK A;  3ASL A;  1V87 A;  4MSX A;  2BAY A;  2YQL A;  1Z60 A;  2YUR A;  1VD4 A;  3O34 A;  2E6R A;  4A49 A;  3SOU A;  2K16 A;  2MIQ A;  2YYR A;  2KE1 A;  3KV5 A;  5TRB A;  2LXP C;  1T1H A;  2ECI A;  3NG2 A;  4LLB A;  3GL6 A;  3N9M A;  3LQI A;  3L1Z B;  4N4F A;  2HDP A;  1BOR A;  5FER A;  4R7E A;  4I7C A;  1N87 A;  4S3O B;  5B78 A;  2VJF B;  3M62 A;  2MA5 A;  2F42 A;  3U5N A;  3IHP A;  5B77 A;  2Y1M A;  2VPB A;  1MM3 A;  5AIT A;  1LDK C;  1WIL A;  4LKA A;  1JM7 A;  4LK9 A;  2G43 A;  4YAD A;  3QZV A;  5H1U A;  2LV9 A;  2FSA A;  2L5U A;  1IYM A;  4MVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...