1CHCA

Structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords EQUINE HERPES VIRUS-1 RING DOMAIN
publication title Structure of the C3HC4 domain by 1H-nuclear magnetic resonance spectroscopy. A new structural class of zinc-finger.
pubmed doi rcsb
source organism Equid herpesvirus 1
total genus 3
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1994-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1chcA00
2VJEB 4FO9A 4IC3A 3L1XA 1FBVA 1BORA 1V87A 1VYXA 1E4UA 5KH9A 3ASLA 5H1UA 3EB6A 5KH3A 1DVPA 2PUYA 2IDAA 2MT5A 1MM2A 4N3WA 3EB5A 2KWNA 2CSZA 2CKLA 2VPBA 4NN2A 4B86C 4BHWA 2LQ6A 2HYED 2LXHC 2ECGA 5B79A 2AN6A 3LQJA 2LN0A 3IHPA 1G25A 5TBNA 3N9MA 5G05B 5KH7A 3KNVA 2YQMA 3VK6A 2G45A 2M1RA 3RPGB 3HCTA 3QZVA 2JMIA 3O7AA 4F52B 2F6NA 1IYMA 2VPGA 4ZDTA 4PPEA 5D1KB 2MA5A 3T7LA 4BBQA 1WGMA 2YYRA 1HYIA 2ECWA 2C2LA 1WEWA 4V3LC 3DPLR 2YW8A 1HYJA 2F6JA 3I2DA 1XWHA 4YAXA 2K16A 2EODA 4GNEA 4ZUXU 2MD7B 2KWOA 2YSJA 4S3OB 2L43A 2K17A 2E6RA 4I7CA 4QF3A 2LV9A 1WFKA 3O70A 4R2YA 2DX8A 2RSDA 4Q6FA 1VFYA 3L1ZB 2QJ0A 2ECTA 2G43A 2MIQA 2G6QA 3O33A 5LKUA 4AVXA 4AYCA 2PNXA 3M62A 2K1JA 1RMDA 3U5NA 1X4UA 3ZVZB 4O64A 5G0FA 1JOCA 3RTRB 2F42A 3SOWA 4QF2A 5JG6A 3KV5A 4WA6A 3N9NA 2VJFA 5FB1A 2KE1A 1VD4A 2KR4A 3V43A 4AP4A 4FJCA 5EYAF 5B75A 3O36A 2E6SA 4FK5A 2LGKA 1WEEA 5J3XA 2L75A 3SOUA 2MUMA 4CA1A 2VPEA 2Y1NA 3HCUA 5TDWA 2QICA 2RI7A 2MNZA 3ZTGA 4WZ0A 1N87A 1WESA 2FUIA 2L0BA 3RPGC 1MM3A 4R7EA 2KWKA 3O34A 2ECIA 2JMDA 2FUUA 1JM7B 5B76A 2K4DA 4L58A 1F62A 3C5KA 2VJEA 5D1LB 2H0DA 3N9OA 5AITA 5FB0A 3HTKC 3PURA 5C11A 5FEYA 3GL6A 2YUCA 2YHNA 2LGGA 2JRJA 5TRBA 4AYCB 3LRQA 3LQHA 5AIUA 4TKPB 2M6MA 5B77A 4S3OC 4V3KC 4I7BA 2YHOA 2VP7A 3M63A 4ZQLA 2Y1MA 5LKXA 2VNFA 2KREA 2YREA 4CCGX 2M3HA 2MNYA 4PTBA 2I50A 2KWJA 3T6RA 3HCSA 2VJFB 2ZETC 4UI9B 2CSYA 2ECVA 5H1TA 2KYUA 2YURA 2YSMA 2KFTA 5H1VA 2VPDA 2HDPA 1T1HA 3MHSA 5TABA 5FERA 4P5OB 5DINA 3ZNIA 4R8PK 2CKLB 1LDJB 1LDKC 2MA6A 3PHDA 4A4CA 2EGPA 3ZPVE 3O37A 3DQVR 2LGLA 1X4JA 5DKAA 3FL2A 4LKAA 3NG2A 5G04B 4GNGA 4X3GA 4YADA 2KGGA 2KIZA 3U5OA 3LQIA 4WZ2A 3N9LA 4GNFA 3SHBA 2KGIA 2UZGA 1WIMA 2H0DB 2MD8C 2YQLA 1Z60A 3MHHA 3ZVYA 2LRIC 5B8DA 4AUQB 1WENA 3U5PA 2LDRA 4LK9A 4UP0A 5I3LA 1Z6UA 2L5UA 5LCWB 4A49A 2CT2A 3SOXA 4YABA 3KQIA 2D8SA 1WE9A 4MSXA 2L80A 4N4FA 5B78A 1WEUA 5D1MB 1WEOA 2OXQC 4YBSA 4FIPA 2ECNA 4LLBA 2C2VS 4A0CD 4YBMA 4WZ3B 4LADB 3ZYQA 2YU4A 4UP5A 3N9PA 1K2FA 5LKTA 4IC2A 2LXPC 3O35A 1WILA 1WEPA 1U6GB 4B7YC 2LGVA 2KU3A 1WEMA 4W4UA 3M99A 1CHCA 4GB0A 3L11A 2M85A 1JM7A 2XEUA 5C13A 2YT5A 4YATA 1WEQA 5TDRA 4YC9A 2JMJA 2NAAA 3N9QA 4C9ZA 1X4IA 4MVTA 4A4BA 2BAYA 4L7XA 5LKZA 1FP0A 3U5MA 1WEVA 4LJNA 2EA6A 1ZBDB 2ECJA 3PUQA 1Z2QA 3ZPV1 4XI1A 5H9MA 2XB1A 2Y43A 4I7DA 3KV6A 3C6WA 4YBTA 4GNDA 2QIZA 2FSAA 3GV4A
chains in the Genus database with same CATH superfamily
2VJEB 4FO9A 3JUEA 4IC3A 3L1XA 1FBVA 1BORA 1V87A 1VYXA 1E4UA 3KDEC 3SUBA 5KH9A 3ASLA 5H1UA 3EB6A 5KH3A 1DVPA 2PUYA 2IDAA 2MT5A 4O62A 1MM2A 4N3WA 3EB5A 2KWNA 2CSZA 2CKLA 2VPBA 4NN2A 4B86C 4BHWA 2LQ6A 2HYED 2LXHC 2ECGA 5B79A 4H9DA 2AN6A 3LQJA 2LN0A 3IHPA 1G25A 5TBNA 3N9MA 5G05B 5KH7A 3KNVA 2YQMA 3FJUB 3VK6A 2G45A 2M1RA 3RPGB 3HCTA 2IQJA 3QZVA 2JMIA 3O7AA 4F52B 2F6NA 1IYMA 2VPGA 4ZDTA 4PPEA 5D1KB 2MA5A 3T7LA 4BBQA 1WGMA 2YYRA 1HYIA 2RR4A 2ECWA 2C2LA 5SVIB 1WEWA 4V3LC 3DPLR 2YW8A 4F1PA 1HYJA 2F6JA 3I2DA 1XWHA 4YAXA 2K16A 4Z0OA 2EODA 4GNEA 4ZUXU 2MD7B 2KWOA 2YSJA 4S3OB 5SVYA 2L43A 2K17A 3LDYA 2E6RA 3LVRE 4I7CA 4QF3A 2LV9A 1WFKA 3O70A 4R2YA 2DX8A 2RSDA 4Q6FA 2XOZA 1VFYA 3L1ZB 2QJ0A 2ECTA 2G43A 2MIQA 2G6QA 2KKYA 2L7PA 3DWDA 3O33A 5LKUA 4AVXA 4AYCA 2PNXA 3M62A 2K1JA 2MKEA 1RMDA 3U5NA 1X4UA 3ZVZB 4O64A 5G0FA 1JOCA 3RTRB 2F42A 3SOWA 4QF2A 4OGCA 5JG6A 3KV5A 2LAUA 4WA6A 3N9NA 2VJFA 5FB1A 2KE1A 1VD4A 2KR4A 3V43A 4AP4A 4FJCA 5EYAF 5B75A 2XOYA 3O36A 2E6SA 4FK5A 2LGKA 1WEEA 5J3XA 2L75A 3SOUA 2FD4A 2JM3A 2MUMA 4CA1A 2VPEA 3E2DA 2Y1NA 3HCUA 5TDWA 2QICA 2RI7A 2MNZA 3ZTGA 2FFWA 4WZ0A 1N87A 1WESA 2FUIA 2L0BA 3RPGC 1MM3A 4R7EA 2KWKA 3O34A 2ECIA 2JMDA 2XOCA 2FUUA 2XP0A 1JM7B 5B76A 2K4DA 4L58A 1F62A 3C5KA 2VJEA 3T9KA 5D1LB 2H0DA 3N9OA 5AITA 5FB0A 3HTKC 2DJAA 3PURA 5C11A 5FEYA 3GL6A 4Z0RA 2YUCA 3PLWA 3FEHA 2YHNA 2LGGA 2JRJA 5TRBA 4AYCB 3LRQA 3LQHA 5AIUA 4TKPB 2M6MA 5B77A 4S3OC 4V3KC 4I7BA 2M13A 2YHOA 1DCQA 2VP7A 3M63A 4ZQLA 2Y1MA 5LKXA 2VNFA 2KREA 2YREA 4CCGX 3FAOA 2M3HA 2MNYA 4PTBA 2I50A 2KWJA 3T6RA 3HCSA 2VJFB 2ZETC 4UI9B 2CSYA 2ECVA 2CONA 5H1TA 2KYUA 2YURA 2B0OE 2YSMA 5SVIA 2KFTA 5H1VA 2VPDA 2HDPA 1T1HA 3MHSA 5TABA 5FERA 4P5OB 5DINA 3ZNIA 4R8PK 2CKLB 1LDJB 1LDKC 2MA6A 3PHDA 4A4CA 2EGPA 3ZPVE 3O37A 3DQVR 2LGLA 1X4JA 5DKAA 3FL2A 4LKAA 3NG2A 5G04B 2JUNA 4GNGA 4X3GA 4YADA 2KGGA 3LJUX 2KIZA 5K3QA 3U5OA 3LQIA 4WZ2A 2CRWA 3N9LA 4GNFA 3SHBA 3M7KA 2KGIA 2UZGA 1WIMA 2H0DB 2MD8C 2YQLA 1Z60A 3H7HA 3FANA 3MHHA 3ZVYA 2LRIC 5B8DA 4AUQB 1WENA 3U5PA 2LDRA 4LK9A 4OGEA 4UP0A 5I3LA 1Z6UA 2L5UA 5LCWB 4A49A 2CT2A 3SOXA 4YABA 3KQIA 3O47A 2OWAA 2D8SA 4MSXA 1WE9A 2L80A 4N4FA 5B78A 1WEUA 5D1MB 2EGMA 1WEOA 3FM8C 2OXQC 4YBSA 4FIPA 2ECNA 4LLBA 2YVRA 2C2VS 4A0CD 4YBMA 4WZ3B 4LADB 3ZYQA 2YU4A 4UP5A 3N9PA 1K2FA 5LKTA 4IC2A 5SVXA 2LXPC 3O35A 1WILA 1WEPA 1U6GB 2E61A 2LGVA 4B7YC 2EXUA 2KU3A 1WEMA 4W4UA 3M99A 2D8UA 3DDTA 1CHCA 4GB0A 2DSMA 3L11A 2M85A 1MBMA 1JM7A 3MDBC 3LVQE 2XEUA 5C13A 2YT5A 4YATA 1WEQA 5TDRA 4YC9A 2JMJA 2NAAA 3N9QA 4C9ZA 1X4IA 4MVTA 4A4BA 2BAYA 4L7XA 5LKZA 1FP0A 2KKXA 3U5MA 1WEVA 4LJNA 2EA6A 1ZBDB 2ECJA 3PUQA 1Z2QA 2CSVA 3ZPV1 4XI1A 4QQ4A 5H9MA 2P57A 2XB1A 2CRRA 2Y43A 3Q1DA 3KV6A 4I7DA 3C6WA 4YBTA 4GNDA 2QIZA 2FSAA 3GV4A
chains in the Genus database with same CATH topology
2VJEB 4FO9A 4IC3A 3L1XA 1FBVA 1BORA 1V87A 1VYXA 1E4UA 5KH9A 3ASLA 5H1UA 3EB6A 5KH3A 1DVPA 2PUYA 2IDAA 2MT5A 1MM2A 4N3WA 3EB5A 2KWNA 2CSZA 2CKLA 2VPBA 4NN2A 4B86C 4BHWA 2LQ6A 2HYED 2LXHC 2ECGA 5B79A 2AN6A 3LQJA 2LN0A 3IHPA 1G25A 5TBNA 3N9MA 5G05B 5KH7A 3KNVA 2YQMA 3VK6A 2G45A 2M1RA 3RPGB 3HCTA 3QZVA 2JMIA 3O7AA 4F52B 2F6NA 1IYMA 2VPGA 4ZDTA 4PPEA 5D1KB 2MA5A 3T7LA 4BBQA 1WGMA 2YYRA 1HYIA 2ECWA 2C2LA 1WEWA 4V3LC 3DPLR 2YW8A 1HYJA 2F6JA 3I2DA 1XWHA 4YAXA 2K16A 2EODA 4GNEA 4ZUXU 2MD7B 2KWOA 2YSJA 4S3OB 2L43A 2K17A 2E6RA 4I7CA 4QF3A 2LV9A 1WFKA 3O70A 4R2YA 2DX8A 2RSDA 4Q6FA 1VFYA 3L1ZB 2QJ0A 2ECTA 2G43A 2MIQA 2G6QA 3O33A 5LKUA 4AVXA 4AYCA 2PNXA 3M62A 2K1JA 1RMDA 3U5NA 1X4UA 3ZVZB 4O64A 5G0FA 1JOCA 3RTRB 2F42A 3SOWA 4QF2A 5JG6A 3KV5A 4WA6A 3N9NA 2VJFA 5FB1A 2KE1A 1VD4A 2KR4A 3V43A 4AP4A 4FJCA 5EYAF 5B75A 3O36A 2E6SA 4FK5A 2LGKA 1WEEA 5J3XA 2L75A 3SOUA 2MUMA 4CA1A 2VPEA 2Y1NA 3HCUA 5TDWA 2QICA 2RI7A 2MNZA 3ZTGA 4WZ0A 1N87A 1WESA 2FUIA 2L0BA 3RPGC 1MM3A 4R7EA 2KWKA 3O34A 2ECIA 2JMDA 2FUUA 1JM7B 5B76A 2K4DA 4L58A 1F62A 3C5KA 2VJEA 5D1LB 2H0DA 3N9OA 5AITA 5FB0A 3HTKC 3PURA 5C11A 5FEYA 3GL6A 2YUCA 2YHNA 2LGGA 2JRJA 5TRBA 4AYCB 3LRQA 3LQHA 5AIUA 4TKPB 2M6MA 5B77A 4S3OC 4V3KC 4I7BA 2YHOA 2VP7A 3M63A 4ZQLA 2Y1MA 5LKXA 2VNFA 2KREA 2YREA 4CCGX 2M3HA 2MNYA 4PTBA 2I50A 2KWJA 3T6RA 3HCSA 2VJFB 2ZETC 4UI9B 2CSYA 2ECVA 5H1TA 2KYUA 2YURA 2YSMA 2KFTA 5H1VA 2VPDA 2HDPA 1T1HA 3MHSA 5TABA 5FERA 4P5OB 5DINA 3ZNIA 4R8PK 2CKLB 1LDJB 1LDKC 2MA6A 3PHDA 4A4CA 2EGPA 3ZPVE 3O37A 3DQVR 2LGLA 1X4JA 5DKAA 3FL2A 4LKAA 3NG2A 5G04B 4GNGA 4X3GA 4YADA 2KGGA 2KIZA 3U5OA 3LQIA 4WZ2A 3N9LA 4GNFA 3SHBA 2KGIA 2UZGA 1WIMA 2H0DB 2MD8C 2YQLA 1Z60A 3MHHA 3ZVYA 2LRIC 5B8DA 4AUQB 1WENA 3U5PA 2LDRA 4LK9A 4UP0A 5I3LA 1Z6UA 2L5UA 5LCWB 4A49A 2CT2A 3SOXA 4YABA 3KQIA 2D8SA 1WE9A 4MSXA 2L80A 4N4FA 5B78A 1WEUA 5D1MB 1WEOA 2OXQC 4YBSA 4FIPA 2ECNA 4LLBA 2C2VS 4A0CD 4YBMA 4WZ3B 4LADB 3ZYQA 2YU4A 4UP5A 3N9PA 1K2FA 5LKTA 4IC2A 2LXPC 3O35A 1WILA 1WEPA 1U6GB 4B7YC 2LGVA 2KU3A 1WEMA 4W4UA 3M99A 1CHCA 4GB0A 3L11A 2M85A 1JM7A 2XEUA 5C13A 2YT5A 4YATA 1WEQA 5TDRA 4YC9A 2JMJA 2NAAA 3N9QA 4C9ZA 1X4IA 4MVTA 4A4BA 2BAYA 4L7XA 5LKZA 1FP0A 3U5MA 1WEVA 4LJNA 2EA6A 1ZBDB 2ECJA 3PUQA 1Z2QA 3ZPV1 4XI1A 5H9MA 2XB1A 2Y43A 4I7DA 3KV6A 3C6WA 4YBTA 4GNDA 2QIZA 2FSAA 3GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJE B;  4FO9 A;  4IC3 A;  3L1X A;  1FBV A;  1BOR A;  1V87 A;  1VYX A;  1E4U A;  5KH9 A;  3ASL A;  5H1U A;  3EB6 A;  5KH3 A;  1DVP A;  2PUY A;  2IDA A;  2MT5 A;  1MM2 A;  4N3W A;  3EB5 A;  2KWN A;  2CSZ A;  2CKL A;  2VPB A;  4NN2 A;  4B86 C;  4BHW A;  2LQ6 A;  2HYE D;  2LXH C;  2ECG A;  5B79 A;  2AN6 A;  3LQJ A;  2LN0 A;  3IHP A;  1G25 A;  5TBN A;  3N9M A;  5G05 B;  5KH7 A;  3KNV A;  2YQM A;  3VK6 A;  2G45 A;  2M1R A;  3RPG B;  3HCT A;  3QZV A;  2JMI A;  3O7A A;  4F52 B;  2F6N A;  1IYM A;  2VPG A;  4ZDT A;  4PPE A;  5D1K B;  2MA5 A;  3T7L A;  4BBQ A;  1WGM A;  2YYR A;  1HYI A;  2ECW A;  2C2L A;  1WEW A;  4V3L C;  3DPL R;  2YW8 A;  1HYJ A;  2F6J A;  3I2D A;  1XWH A;  4YAX A;  2K16 A;  2EOD A;  4GNE A;  4ZUX U;  2MD7 B;  2KWO A;  2YSJ A;  4S3O B;  2L43 A;  2K17 A;  2E6R A;  4I7C A;  4QF3 A;  2LV9 A;  1WFK A;  3O70 A;  4R2Y A;  2DX8 A;  2RSD A;  4Q6F A;  1VFY A;  3L1Z B;  2QJ0 A;  2ECT A;  2G43 A;  2MIQ A;  2G6Q A;  3O33 A;  5LKU A;  4AVX A;  4AYC A;  2PNX A;  3M62 A;  2K1J A;  1RMD A;  3U5N A;  1X4U A;  3ZVZ B;  4O64 A;  5G0F A;  1JOC A;  3RTR B;  2F42 A;  3SOW A;  4QF2 A;  5JG6 A;  3KV5 A;  4WA6 A;  3N9N A;  2VJF A;  5FB1 A;  2KE1 A;  1VD4 A;  2KR4 A;  3V43 A;  4AP4 A;  4FJC A;  5EYA F;  5B75 A;  3O36 A;  2E6S A;  4FK5 A;  2LGK A;  1WEE A;  5J3X A;  2L75 A;  3SOU A;  2MUM A;  4CA1 A;  2VPE A;  2Y1N A;  3HCU A;  5TDW A;  2QIC A;  2RI7 A;  2MNZ A;  3ZTG A;  4WZ0 A;  1N87 A;  1WES A;  2FUI A;  2L0B A;  3RPG C;  1MM3 A;  4R7E A;  2KWK A;  3O34 A;  2ECI A;  2JMD A;  2FUU A;  1JM7 B;  5B76 A;  2K4D A;  4L58 A;  1F62 A;  3C5K A;  2VJE A;  5D1L B;  2H0D A;  3N9O A;  5AIT A;  5FB0 A;  3HTK C;  3PUR A;  5C11 A;  5FEY A;  3GL6 A;  2YUC A;  2YHN A;  2LGG A;  2JRJ A;  5TRB A;  4AYC B;  3LRQ A;  3LQH A;  5AIU A;  4TKP B;  2M6M A;  5B77 A;  4S3O C;  4V3K C;  4I7B A;  2YHO A;  2VP7 A;  3M63 A;  4ZQL A;  2Y1M A;  5LKX A;  2VNF A;  2KRE A;  2YRE A;  4CCG X;  2M3H A;  2MNY A;  4PTB A;  2I50 A;  2KWJ A;  3T6R A;  3HCS A;  2VJF B;  2ZET C;  4UI9 B;  2CSY A;  2ECV A;  5H1T A;  2KYU A;  2YUR A;  2YSM A;  2KFT A;  5H1V A;  2VPD A;  2HDP A;  1T1H A;  3MHS A;  5TAB A;  5FER A;  4P5O B;  5DIN A;  3ZNI A;  4R8P K;  2CKL B;  1LDJ B;  1LDK C;  2MA6 A;  3PHD A;  4A4C A;  2EGP A;  3ZPV E;  3O37 A;  3DQV R;  2LGL A;  1X4J A;  5DKA A;  3FL2 A;  4LKA A;  3NG2 A;  5G04 B;  4GNG A;  4X3G A;  4YAD A;  2KGG A;  2KIZ A;  3U5O A;  3LQI A;  4WZ2 A;  3N9L A;  4GNF A;  3SHB A;  2KGI A;  2UZG A;  1WIM A;  2H0D B;  2MD8 C;  2YQL A;  1Z60 A;  3MHH A;  3ZVY A;  2LRI C;  5B8D A;  4AUQ B;  1WEN A;  3U5P A;  2LDR A;  4LK9 A;  4UP0 A;  5I3L A;  1Z6U A;  2L5U A;  5LCW B;  4A49 A;  2CT2 A;  3SOX A;  4YAB A;  3KQI A;  2D8S A;  1WE9 A;  4MSX A;  2L80 A;  4N4F A;  5B78 A;  1WEU A;  5D1M B;  1WEO A;  2OXQ C;  4YBS A;  4FIP A;  2ECN A;  4LLB A;  2C2V S;  4A0C D;  4YBM A;  4WZ3 B;  4LAD B;  3ZYQ A;  2YU4 A;  4UP5 A;  3N9P A;  1K2F A;  5LKT A;  4IC2 A;  2LXP C;  3O35 A;  1WIL A;  1WEP A;  1U6G B;  4B7Y C;  2LGV A;  2KU3 A;  1WEM A;  4W4U A;  3M99 A;  1CHC A;  4GB0 A;  3L11 A;  2M85 A;  1JM7 A;  2XEU A;  5C13 A;  2YT5 A;  4YAT A;  1WEQ A;  5TDR A;  4YC9 A;  2JMJ A;  2NAA A;  3N9Q A;  4C9Z A;  1X4I A;  4MVT A;  4A4B A;  2BAY A;  4L7X A;  5LKZ A;  1FP0 A;  3U5M A;  1WEV A;  4LJN A;  2EA6 A;  1ZBD B;  2ECJ A;  3PUQ A;  1Z2Q A;  3ZPV 1;  4XI1 A;  5H9M A;  2XB1 A;  2Y43 A;  4I7D A;  3KV6 A;  3C6W A;  4YBT A;  4GND A;  2QIZ A;  2FSA A;  3GV4 A; 
#chains in the Genus database with same CATH topology
 2VJE B;  4FO9 A;  3JUE A;  4IC3 A;  3L1X A;  1FBV A;  1BOR A;  1V87 A;  1VYX A;  1E4U A;  3KDE C;  3SUB A;  5KH9 A;  3ASL A;  5H1U A;  3EB6 A;  5KH3 A;  1DVP A;  2PUY A;  2IDA A;  2MT5 A;  4O62 A;  1MM2 A;  4N3W A;  3EB5 A;  2KWN A;  2CSZ A;  2CKL A;  2VPB A;  4NN2 A;  4B86 C;  4BHW A;  2LQ6 A;  2HYE D;  2LXH C;  2ECG A;  5B79 A;  4H9D A;  2AN6 A;  3LQJ A;  2LN0 A;  3IHP A;  1G25 A;  5TBN A;  3N9M A;  5G05 B;  5KH7 A;  3KNV A;  2YQM A;  3FJU B;  3VK6 A;  2G45 A;  2M1R A;  3RPG B;  3HCT A;  2IQJ A;  3QZV A;  2JMI A;  3O7A A;  4F52 B;  2F6N A;  1IYM A;  2VPG A;  4ZDT A;  4PPE A;  5D1K B;  2MA5 A;  3T7L A;  4BBQ A;  1WGM A;  2YYR A;  1HYI A;  2RR4 A;  2ECW A;  2C2L A;  5SVI B;  1WEW A;  4V3L C;  3DPL R;  2YW8 A;  4F1P A;  1HYJ A;  2F6J A;  3I2D A;  1XWH A;  4YAX A;  2K16 A;  4Z0O A;  2EOD A;  4GNE A;  4ZUX U;  2MD7 B;  2KWO A;  2YSJ A;  4S3O B;  5SVY A;  2L43 A;  2K17 A;  3LDY A;  2E6R A;  3LVR E;  4I7C A;  4QF3 A;  2LV9 A;  1WFK A;  3O70 A;  4R2Y A;  2DX8 A;  2RSD A;  4Q6F A;  2XOZ A;  1VFY A;  3L1Z B;  2QJ0 A;  2ECT A;  2G43 A;  2MIQ A;  2G6Q A;  2KKY A;  2L7P A;  3DWD A;  3O33 A;  5LKU A;  4AVX A;  4AYC A;  2PNX A;  3M62 A;  2K1J A;  2MKE A;  1RMD A;  3U5N A;  1X4U A;  3ZVZ B;  4O64 A;  5G0F A;  1JOC A;  3RTR B;  2F42 A;  3SOW A;  4QF2 A;  4OGC A;  5JG6 A;  3KV5 A;  2LAU A;  4WA6 A;  3N9N A;  2VJF A;  5FB1 A;  2KE1 A;  1VD4 A;  2KR4 A;  3V43 A;  4AP4 A;  4FJC A;  5EYA F;  5B75 A;  2XOY A;  3O36 A;  2E6S A;  4FK5 A;  2LGK A;  1WEE A;  5J3X A;  2L75 A;  3SOU A;  2FD4 A;  2JM3 A;  2MUM A;  4CA1 A;  2VPE A;  3E2D A;  2Y1N A;  3HCU A;  5TDW A;  2QIC A;  2RI7 A;  2MNZ A;  3ZTG A;  2FFW A;  4WZ0 A;  1N87 A;  1WES A;  2FUI A;  2L0B A;  3RPG C;  1MM3 A;  4R7E A;  2KWK A;  3O34 A;  2ECI A;  2JMD A;  2XOC A;  2FUU A;  2XP0 A;  1JM7 B;  5B76 A;  2K4D A;  4L58 A;  1F62 A;  3C5K A;  2VJE A;  3T9K A;  5D1L B;  2H0D A;  3N9O A;  5AIT A;  5FB0 A;  3HTK C;  2DJA A;  3PUR A;  5C11 A;  5FEY A;  3GL6 A;  4Z0R A;  2YUC A;  3PLW A;  3FEH A;  2YHN A;  2LGG A;  2JRJ A;  5TRB A;  4AYC B;  3LRQ A;  3LQH A;  5AIU A;  4TKP B;  2M6M A;  5B77 A;  4S3O C;  4V3K C;  4I7B A;  2M13 A;  2YHO A;  1DCQ A;  2VP7 A;  3M63 A;  4ZQL A;  2Y1M A;  5LKX A;  2VNF A;  2KRE A;  2YRE A;  4CCG X;  3FAO A;  2M3H A;  2MNY A;  4PTB A;  2I50 A;  2KWJ A;  3T6R A;  3HCS A;  2VJF B;  2ZET C;  4UI9 B;  2CSY A;  2ECV A;  2CON A;  5H1T A;  2KYU A;  2YUR A;  2B0O E;  2YSM A;  5SVI A;  2KFT A;  5H1V A;  2VPD A;  2HDP A;  1T1H A;  3MHS A;  5TAB A;  5FER A;  4P5O B;  5DIN A;  3ZNI A;  4R8P K;  2CKL B;  1LDJ B;  1LDK C;  2MA6 A;  3PHD A;  4A4C A;  2EGP A;  3ZPV E;  3O37 A;  3DQV R;  2LGL A;  1X4J A;  5DKA A;  3FL2 A;  4LKA A;  3NG2 A;  5G04 B;  2JUN A;  4GNG A;  4X3G A;  4YAD A;  2KGG A;  3LJU X;  2KIZ A;  5K3Q A;  3U5O A;  3LQI A;  4WZ2 A;  2CRW A;  3N9L A;  4GNF A;  3SHB A;  3M7K A;  2KGI A;  2UZG A;  1WIM A;  2H0D B;  2MD8 C;  2YQL A;  1Z60 A;  3H7H A;  3FAN A;  3MHH A;  3ZVY A;  2LRI C;  5B8D A;  4AUQ B;  1WEN A;  3U5P A;  2LDR A;  4LK9 A;  4OGE A;  4UP0 A;  5I3L A;  1Z6U A;  2L5U A;  5LCW B;  4A49 A;  2CT2 A;  3SOX A;  4YAB A;  3KQI A;  3O47 A;  2OWA A;  2D8S A;  4MSX A;  1WE9 A;  2L80 A;  4N4F A;  5B78 A;  1WEU A;  5D1M B;  2EGM A;  1WEO A;  3FM8 C;  2OXQ C;  4YBS A;  4FIP A;  2ECN A;  4LLB A;  2YVR A;  2C2V S;  4A0C D;  4YBM A;  4WZ3 B;  4LAD B;  3ZYQ A;  2YU4 A;  4UP5 A;  3N9P A;  1K2F A;  5LKT A;  4IC2 A;  5SVX A;  2LXP C;  3O35 A;  1WIL A;  1WEP A;  1U6G B;  2E61 A;  2LGV A;  4B7Y C;  2EXU A;  2KU3 A;  1WEM A;  4W4U A;  3M99 A;  2D8U A;  3DDT A;  1CHC A;  4GB0 A;  2DSM A;  3L11 A;  2M85 A;  1MBM A;  1JM7 A;  3MDB C;  3LVQ E;  2XEU A;  5C13 A;  2YT5 A;  4YAT A;  1WEQ A;  5TDR A;  4YC9 A;  2JMJ A;  2NAA A;  3N9Q A;  4C9Z A;  1X4I A;  4MVT A;  4A4B A;  2BAY A;  4L7X A;  5LKZ A;  1FP0 A;  2KKX A;  3U5M A;  1WEV A;  4LJN A;  2EA6 A;  1ZBD B;  2ECJ A;  3PUQ A;  1Z2Q A;  2CSV A;  3ZPV 1;  4XI1 A;  4QQ4 A;  5H9M A;  2P57 A;  2XB1 A;  2CRR A;  2Y43 A;  3Q1D A;  3KV6 A;  4I7D A;  3C6W A;  4YBT A;  4GND A;  2QIZ A;  2FSA A;  3GV4 A; 
#chains in the Genus database with same CATH homology
 2VJE B;  4FO9 A;  4IC3 A;  3L1X A;  1FBV A;  1BOR A;  1V87 A;  1VYX A;  1E4U A;  5KH9 A;  3ASL A;  5H1U A;  3EB6 A;  5KH3 A;  1DVP A;  2PUY A;  2IDA A;  2MT5 A;  1MM2 A;  4N3W A;  3EB5 A;  2KWN A;  2CSZ A;  2CKL A;  2VPB A;  4NN2 A;  4B86 C;  4BHW A;  2LQ6 A;  2HYE D;  2LXH C;  2ECG A;  5B79 A;  2AN6 A;  3LQJ A;  2LN0 A;  3IHP A;  1G25 A;  5TBN A;  3N9M A;  5G05 B;  5KH7 A;  3KNV A;  2YQM A;  3VK6 A;  2G45 A;  2M1R A;  3RPG B;  3HCT A;  3QZV A;  2JMI A;  3O7A A;  4F52 B;  2F6N A;  1IYM A;  2VPG A;  4ZDT A;  4PPE A;  5D1K B;  2MA5 A;  3T7L A;  4BBQ A;  1WGM A;  2YYR A;  1HYI A;  2ECW A;  2C2L A;  1WEW A;  4V3L C;  3DPL R;  2YW8 A;  1HYJ A;  2F6J A;  3I2D A;  1XWH A;  4YAX A;  2K16 A;  2EOD A;  4GNE A;  4ZUX U;  2MD7 B;  2KWO A;  2YSJ A;  4S3O B;  2L43 A;  2K17 A;  2E6R A;  4I7C A;  4QF3 A;  2LV9 A;  1WFK A;  3O70 A;  4R2Y A;  2DX8 A;  2RSD A;  4Q6F A;  1VFY A;  3L1Z B;  2QJ0 A;  2ECT A;  2G43 A;  2MIQ A;  2G6Q A;  3O33 A;  5LKU A;  4AVX A;  4AYC A;  2PNX A;  3M62 A;  2K1J A;  1RMD A;  3U5N A;  1X4U A;  3ZVZ B;  4O64 A;  5G0F A;  1JOC A;  3RTR B;  2F42 A;  3SOW A;  4QF2 A;  5JG6 A;  3KV5 A;  4WA6 A;  3N9N A;  2VJF A;  5FB1 A;  2KE1 A;  1VD4 A;  2KR4 A;  3V43 A;  4AP4 A;  4FJC A;  5EYA F;  5B75 A;  3O36 A;  2E6S A;  4FK5 A;  2LGK A;  1WEE A;  5J3X A;  2L75 A;  3SOU A;  2MUM A;  4CA1 A;  2VPE A;  2Y1N A;  3HCU A;  5TDW A;  2QIC A;  2RI7 A;  2MNZ A;  3ZTG A;  4WZ0 A;  1N87 A;  1WES A;  2FUI A;  2L0B A;  3RPG C;  1MM3 A;  4R7E A;  2KWK A;  3O34 A;  2ECI A;  2JMD A;  2FUU A;  1JM7 B;  5B76 A;  2K4D A;  4L58 A;  1F62 A;  3C5K A;  2VJE A;  5D1L B;  2H0D A;  3N9O A;  5AIT A;  5FB0 A;  3HTK C;  3PUR A;  5C11 A;  5FEY A;  3GL6 A;  2YUC A;  2YHN A;  2LGG A;  2JRJ A;  5TRB A;  4AYC B;  3LRQ A;  3LQH A;  5AIU A;  4TKP B;  2M6M A;  5B77 A;  4S3O C;  4V3K C;  4I7B A;  2YHO A;  2VP7 A;  3M63 A;  4ZQL A;  2Y1M A;  5LKX A;  2VNF A;  2KRE A;  2YRE A;  4CCG X;  2M3H A;  2MNY A;  4PTB A;  2I50 A;  2KWJ A;  3T6R A;  3HCS A;  2VJF B;  2ZET C;  4UI9 B;  2CSY A;  2ECV A;  5H1T A;  2KYU A;  2YUR A;  2YSM A;  2KFT A;  5H1V A;  2VPD A;  2HDP A;  1T1H A;  3MHS A;  5TAB A;  5FER A;  4P5O B;  5DIN A;  3ZNI A;  4R8P K;  2CKL B;  1LDJ B;  1LDK C;  2MA6 A;  3PHD A;  4A4C A;  2EGP A;  3ZPV E;  3O37 A;  3DQV R;  2LGL A;  1X4J A;  5DKA A;  3FL2 A;  4LKA A;  3NG2 A;  5G04 B;  4GNG A;  4X3G A;  4YAD A;  2KGG A;  2KIZ A;  3U5O A;  3LQI A;  4WZ2 A;  3N9L A;  4GNF A;  3SHB A;  2KGI A;  2UZG A;  1WIM A;  2H0D B;  2MD8 C;  2YQL A;  1Z60 A;  3MHH A;  3ZVY A;  2LRI C;  5B8D A;  4AUQ B;  1WEN A;  3U5P A;  2LDR A;  4LK9 A;  4UP0 A;  5I3L A;  1Z6U A;  2L5U A;  5LCW B;  4A49 A;  2CT2 A;  3SOX A;  4YAB A;  3KQI A;  2D8S A;  1WE9 A;  4MSX A;  2L80 A;  4N4F A;  5B78 A;  1WEU A;  5D1M B;  1WEO A;  2OXQ C;  4YBS A;  4FIP A;  2ECN A;  4LLB A;  2C2V S;  4A0C D;  4YBM A;  4WZ3 B;  4LAD B;  3ZYQ A;  2YU4 A;  4UP5 A;  3N9P A;  1K2F A;  5LKT A;  4IC2 A;  2LXP C;  3O35 A;  1WIL A;  1WEP A;  1U6G B;  4B7Y C;  2LGV A;  2KU3 A;  1WEM A;  4W4U A;  3M99 A;  1CHC A;  4GB0 A;  3L11 A;  2M85 A;  1JM7 A;  2XEU A;  5C13 A;  2YT5 A;  4YAT A;  1WEQ A;  5TDR A;  4YC9 A;  2JMJ A;  2NAA A;  3N9Q A;  4C9Z A;  1X4I A;  4MVT A;  4A4B A;  2BAY A;  4L7X A;  5LKZ A;  1FP0 A;  3U5M A;  1WEV A;  4LJN A;  2EA6 A;  1ZBD B;  2ECJ A;  3PUQ A;  1Z2Q A;  3ZPV 1;  4XI1 A;  5H9M A;  2XB1 A;  2Y43 A;  4I7D A;  3KV6 A;  3C6W A;  4YBT A;  4GND A;  2QIZ A;  2FSA A;  3GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...