1CHCA

Structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
b'MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EQUINE HERPES VIRUS-1 RING DOMAIN
publication title Structure of the C3HC4 domain by 1H-nuclear magnetic resonance spectroscopy. A new structural class of zinc-finger.
pubmed doi rcsb
source organism Equid herpesvirus 1
molecule tags Viral protein
total genus 3
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1994-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1chcA00
2CSYA 4N4FA 5H1VA 2KWNA 4GNDA 3L11A 2FSAA 3L1XA 4W4UA 4V3LC 2MIQA 4XI1A 4FK5A 3DPLR 2K4DA 4UI9B 2XEUA 2NAAA 5B79A 2ECJA 3SHBA 2LXPC 5DKAA 5TBNA 4ZDTA 1G25A 3NG2A 3C5KA 2ECTA 4WZ0A 5B75A 4S3OB 2KR4A 5KH3A 4A4BA 4YATA 4MSXA 4N3WA 2MD8C 4IC3A 3LQIA 5G0FA 2ZETC 2L43A 3U5NA 2XB1A 2KGGA 4GNGA 2KFTA 4GB0A 1X4UA 2MA6A 3ZPVE 1WILA 2Y43A 1WEWA 4I7BA 4LLBA 2KU3A 4WZ2A 2YQMA 3U5MA 2YT5A 2AN6A 3O37A 4GNEA 5TABA 3O35A 3HTKC 4IC2A 2LGKA 2ECVA 2JRJA 2YHOA 3O36A 2M1RA 5FB0A 2M85A 4R8PK 5TDRA 1X4IA 1WEMA 5D1MB 4GNFA 3M63A 4O64A 5FEYA 1X4JA 2MNZA 3N9PA 2VPBA 2L5UA 2EODA 1ZBDB 3LRQA 3PHDA 4I7CA 5TDWA 5TRBA 4CCGX 2ECWA 2H0DB 2G43A 1DVPA 1N87A 1IYMA 5J3XA 1CHCA 3N9MA 2L80A 2YURA 3VK6A 1T1HA 1MM3A 4A0CD 1MM2A 2BAYA 2C2LA 3ZPV1 4LK9A 3RPGC 2DX8A 1U6GB 2VJEB 3KV5A 4AYCB 2E6RA 1WE9A 2RSDA 2KWJA 3T6RA 3LQHA 4LJNA 4MVTA 2M3HA 1HYIA 3ZVYA 2UZGA 1JOCA 3SOUA 4R7EA 1FP0A 2JMIA 5LCWB 2QICA 5JG6A 5LKTA 4YABA 1Z6UA 2F42A 4PTBA 3O7AA 2VPGA 3EB6A 2LRIC 1WGMA 4WZ3B 1VD4A 3U5OA 4WA6A 5AITA 3ZYQA 1WEEA 4UP5A 2YSMA 4YC9A 5KH9A 3O70A 2MNYA 4I7DA 3KNVA 2LQ6A 4B86C 4BBQA 5LKUA 3MHSA 4F52B 3L1ZB 4BHWA 3M62A 1VFYA 2H0DA 3PURA 2YQLA 2C2VS 2LXHC 4QF2A 2FUUA 1JM7B 2CKLA 1WEUA 3I2DA 5G04B 1BORA 2YUCA 2M6MA 4YBSA 3GV4A 2VJFB 3KQIA 2CT2A 4R2YA 3ZVZB 4ZUXU 4YBTA 2KWOA 5C13A 2VJEA 2EA6A 2F6JA 4AYCA 2K1JA 2JMJA 1WIMA 4FJCA 1F62A 5H1UA 3SOXA 3N9NA 3GL6A 3IHPA 4AP4A 2KREA 3O33A 4S3OC 5D1LB 4C9ZA 3RTRB 1WESA 2Y1NA 2YW8A 1HYJA 2L0BA 4TKPB 2MA5A 2CKLB 3KV6A 5G05B 2YYRA 5H1TA 2Y1MA 3U5PA 2MD7B 1Z60A 3N9LA 3MHHA 3C6WA 4V3KC 3PUQA 1WEVA 2VNFA 5EYAF 2EGPA 1WEPA 2KYUA 5DINA 3QZVA 4A49A 2RI7A 3ASLA 2OXQC 4AVXA 4CA1A 2E6SA 4YAXA 2LGVA 2F6NA 5FB1A 1JM7A 2PNXA 2ECIA 3T7LA 3N9QA 4QF3A 2I50A 4Q6FA 4A4CA 2QJ0A 2VJFA 2ECGA 3HCSA 2ECNA 2VPEA 5LKXA 2LDRA 1LDKC 2LGLA 4NN2A 1WENA 4LKAA 3FL2A 2L75A 5B76A 5B78A 3HCUA 2K16A 4L58A 2JMDA 2K17A 2YU4A 5AIUA 2KIZA 4PPEA 4YBMA 3M99A 5B8DA 2LN0A 5D1KB 4YADA 1RMDA 2YHNA 5LKZA 3RPGB 2HYED 5I3LA 1WEQA 1XWHA 3V43A 3SOWA 1WFKA 2VPDA 1Z2QA 5KH7A 2VP7A 3ZTGA 5C11A 1K2FA 2G45A 2KWKA 2HDPA 4X3GA 4LADB 1FBVA 2KGIA 1E4UA 2LV9A 2MT5A 1V87A 3EB5A 3O34A 2LGGA 5H9MA 2YREA 1VYXA 4ZQLA 2KE1A 4B7YC 3ZNIA 3DQVR 3LQJA 4FIPA 4P5OB 4L7XA 2FUIA 2MUMA 3N9OA 1WEOA 2PUYA 2G6QA 5B77A 2CSZA 3HCTA 4AUQB 2IDAA 1LDJB 2YSJA 2D8SA 4UP0A 2QIZA 4FO9A 5FERA
chains in the Genus database with same CATH superfamily
2CSYA 4N4FA 5H1VA 2FD4A 2KWNA 4GNDA 3L11A 2FSAA 3L1XA 4O62A 4W4UA 2M13A 4V3LC 4F1PA 2MIQA 4XI1A 4FK5A 3DPLR 2K4DA 4UI9B 1MBMA 3SUBA 4Z0OA 2XEUA 2NAAA 5B79A 2ECJA 3SHBA 2LXPC 5DKAA 5TBNA 4ZDTA 1G25A 2KKXA 3NG2A 3C5KA 2ECTA 4WZ0A 5B75A 4S3OB 2KR4A 3LVQE 5KH3A 4A4BA 4YATA 4MSXA 4N3WA 4Z0RA 2MD8C 4IC3A 3LQIA 5G0FA 2ZETC 2L43A 3U5NA 2XB1A 2KGGA 4GNGA 2KFTA 4GB0A 1X4UA 2MA6A 1DCQA 3ZPVE 1WILA 3PLWA 2Y43A 1WEWA 4I7BA 4LLBA 2D8UA 2KU3A 4WZ2A 2YQMA 3T9KA 3U5MA 2YT5A 2AN6A 3O37A 4GNEA 5TABA 3O35A 3HTKC 4IC2A 4OGCA 2LGKA 2RR4A 2IQJA 2ECVA 2JRJA 2YHOA 3O36A 2M1RA 5FB0A 2M85A 4R8PK 3LVRE 5TDRA 1X4IA 1WEMA 5D1MB 2EGMA 3DWDA 4GNFA 3M63A 2MKEA 4O64A 5FEYA 3KDEC 3O47A 3E2DA 3M7KA 1X4JA 2MNZA 3N9PA 2VPBA 2L5UA 2EODA 1ZBDB 2OWAA 3LRQA 3PHDA 4I7CA 5TDWA 5TRBA 4CCGX 2DJAA 2ECWA 2H0DB 2G43A 1DVPA 2KKYA 1N87A 1IYMA 5J3XA 1CHCA 3N9MA 2L80A 2YURA 3VK6A 1T1HA 1MM3A 4A0CD 1MM2A 2BAYA 2C2LA 3ZPV1 4LK9A 3RPGC 3FJUB 2DX8A 1U6GB 2VJEB 3KV5A 4AYCB 2E6RA 1WE9A 2RSDA 2KWJA 3T6RA 3LQHA 4LJNA 4MVTA 2M3HA 1HYIA 3ZVYA 2UZGA 1JOCA 3SOUA 4R7EA 1FP0A 2JMIA 5LCWB 2QICA 5JG6A 5LKTA 4YABA 1Z6UA 2F42A 4PTBA 3O7AA 2VPGA 3EB6A 2LRIC 1WGMA 4WZ3B 1VD4A 3FM8C 3U5OA 4WA6A 5AITA 3ZYQA 1WEEA 4UP5A 2YSMA 4YC9A 5KH9A 3O70A 2MNYA 4I7DA 3KNVA 2EXUA 2LQ6A 2XOCA 4B86C 4BBQA 2E61A 5LKUA 3MHSA 4F52B 3L1ZB 4BHWA 3M62A 1VFYA 2XP0A 2H0DA 3PURA 2YQLA 4H9DA 2C2VS 2LXHC 3FANA 4QF2A 2FUUA 2CRRA 1JM7B 2CKLA 1WEUA 3I2DA 2CSVA 5G04B 1BORA 2YUCA 2M6MA 4YBSA 3GV4A 2VJFB 3KQIA 2XOZA 2CT2A 4R2YA 3ZVZB 4ZUXU 2JM3A 4YBTA 2KWOA 5K3QA 5C13A 2VJEA 2EA6A 2F6JA 4AYCA 2K1JA 2JMJA 1WIMA 4FJCA 1F62A 5H1UA 3SOXA 4OGEA 3N9NA 3GL6A 3IHPA 4AP4A 2KREA 3O33A 4S3OC 5D1LB 4C9ZA 3RTRB 2YVRA 1WESA 2Y1NA 2YW8A 1HYJA 2L0BA 4TKPB 2MA5A 2CKLB 3KV6A 2B0OE 5G05B 2YYRA 3FEHA 5H1TA 2Y1MA 2XOYA 3U5PA 3H7HA 2MD7B 3Q1DA 1Z60A 3N9LA 3MHHA 3C6WA 5SVYA 4V3KC 3PUQA 1WEVA 2VNFA 5EYAF 2EGPA 2FFWA 1WEPA 2KYUA 2CONA 3DDTA 3LJUX 5DINA 3QZVA 4A49A 2RI7A 3ASLA 2OXQC 4AVXA 4CA1A 2E6SA 4YAXA 2CRWA 2LGVA 3FAOA 2F6NA 5FB1A 1JM7A 2PNXA 2ECIA 3T7LA 3N9QA 4QF3A 2I50A 4Q6FA 4A4CA 2QJ0A 2DSMA 2VJFA 3LDYA 2ECGA 3HCSA 2ECNA 2VPEA 5LKXA 2LDRA 1LDKC 2LGLA 4NN2A 1WENA 4LKAA 3FL2A 2L75A 5B76A 5B78A 3HCUA 2K16A 4L58A 2LAUA 2JMDA 2K17A 2YU4A 5AIUA 2KIZA 4PPEA 4YBMA 3M99A 5B8DA 2LN0A 5D1KB 4YADA 1RMDA 2YHNA 5LKZA 3RPGB 2HYED 5I3LA 1WEQA 1XWHA 3V43A 3SOWA 1WFKA 2VPDA 1Z2QA 5KH7A 2VP7A 3ZTGA 5C11A 1K2FA 4QQ4A 2G45A 2KWKA 2HDPA 4X3GA 4LADB 1FBVA 2KGIA 1E4UA 2LV9A 2MT5A 1V87A 3EB5A 3O34A 5SVIA 2LGGA 5H9MA 2YREA 1VYXA 4ZQLA 2KE1A 4B7YC 2JUNA 3DQVR 3ZNIA 3LQJA 3MDBC 4FIPA 4P5OB 2P57A 4L7XA 2FUIA 2MUMA 3N9OA 3JUEA 1WEOA 2PUYA 5SVXA 2G6QA 2L7PA 5B77A 2CSZA 3HCTA 4AUQB 2IDAA 1LDJB 2YSJA 2D8SA 4UP0A 2QIZA 4FO9A 5FERA 5SVIB
chains in the Genus database with same CATH topology
2CSYA 4N4FA 5H1VA 2KWNA 4GNDA 3L11A 2FSAA 3L1XA 4W4UA 4V3LC 2MIQA 4XI1A 4FK5A 3DPLR 2K4DA 4UI9B 2XEUA 2NAAA 5B79A 2ECJA 3SHBA 2LXPC 5DKAA 5TBNA 4ZDTA 1G25A 3NG2A 3C5KA 2ECTA 4WZ0A 5B75A 4S3OB 2KR4A 5KH3A 4A4BA 4YATA 4MSXA 4N3WA 2MD8C 4IC3A 3LQIA 5G0FA 2ZETC 2L43A 3U5NA 2XB1A 2KGGA 4GNGA 2KFTA 4GB0A 1X4UA 2MA6A 3ZPVE 1WILA 2Y43A 1WEWA 4I7BA 4LLBA 2KU3A 4WZ2A 2YQMA 3U5MA 2YT5A 2AN6A 3O37A 4GNEA 5TABA 3O35A 3HTKC 4IC2A 2LGKA 2ECVA 2JRJA 2YHOA 3O36A 2M1RA 5FB0A 2M85A 4R8PK 5TDRA 1X4IA 1WEMA 5D1MB 4GNFA 3M63A 4O64A 5FEYA 1X4JA 2MNZA 3N9PA 2VPBA 2L5UA 2EODA 1ZBDB 3LRQA 3PHDA 4I7CA 5TDWA 5TRBA 4CCGX 2ECWA 2H0DB 2G43A 1DVPA 1N87A 1IYMA 5J3XA 1CHCA 3N9MA 2L80A 2YURA 3VK6A 1T1HA 1MM3A 4A0CD 1MM2A 2BAYA 2C2LA 3ZPV1 4LK9A 3RPGC 2DX8A 1U6GB 2VJEB 3KV5A 4AYCB 2E6RA 1WE9A 2RSDA 2KWJA 3T6RA 3LQHA 4LJNA 4MVTA 2M3HA 1HYIA 3ZVYA 2UZGA 1JOCA 3SOUA 4R7EA 1FP0A 2JMIA 5LCWB 2QICA 5JG6A 5LKTA 4YABA 1Z6UA 2F42A 4PTBA 3O7AA 2VPGA 3EB6A 2LRIC 1WGMA 4WZ3B 1VD4A 3U5OA 4WA6A 5AITA 3ZYQA 1WEEA 4UP5A 2YSMA 4YC9A 5KH9A 3O70A 2MNYA 4I7DA 3KNVA 2LQ6A 4B86C 4BBQA 5LKUA 3MHSA 4F52B 3L1ZB 4BHWA 3M62A 1VFYA 2H0DA 3PURA 2YQLA 2C2VS 2LXHC 4QF2A 2FUUA 1JM7B 2CKLA 1WEUA 3I2DA 5G04B 1BORA 2YUCA 2M6MA 4YBSA 3GV4A 2VJFB 3KQIA 2CT2A 4R2YA 3ZVZB 4ZUXU 4YBTA 2KWOA 5C13A 2VJEA 2EA6A 2F6JA 4AYCA 2K1JA 2JMJA 1WIMA 4FJCA 1F62A 5H1UA 3SOXA 3N9NA 3GL6A 3IHPA 4AP4A 2KREA 3O33A 4S3OC 5D1LB 4C9ZA 3RTRB 1WESA 2Y1NA 2YW8A 1HYJA 2L0BA 4TKPB 2MA5A 2CKLB 3KV6A 5G05B 2YYRA 5H1TA 2Y1MA 3U5PA 2MD7B 1Z60A 3N9LA 3MHHA 3C6WA 4V3KC 3PUQA 1WEVA 2VNFA 5EYAF 2EGPA 1WEPA 2KYUA 5DINA 3QZVA 4A49A 2RI7A 3ASLA 2OXQC 4AVXA 4CA1A 2E6SA 4YAXA 2LGVA 2F6NA 5FB1A 1JM7A 2PNXA 2ECIA 3T7LA 3N9QA 4QF3A 2I50A 4Q6FA 4A4CA 2QJ0A 2VJFA 2ECGA 3HCSA 2ECNA 2VPEA 5LKXA 2LDRA 1LDKC 2LGLA 4NN2A 1WENA 4LKAA 3FL2A 2L75A 5B76A 5B78A 3HCUA 2K16A 4L58A 2JMDA 2K17A 2YU4A 5AIUA 2KIZA 4PPEA 4YBMA 3M99A 5B8DA 2LN0A 5D1KB 4YADA 1RMDA 2YHNA 5LKZA 3RPGB 2HYED 5I3LA 1WEQA 1XWHA 3V43A 3SOWA 1WFKA 2VPDA 1Z2QA 5KH7A 2VP7A 3ZTGA 5C11A 1K2FA 2G45A 2KWKA 2HDPA 4X3GA 4LADB 1FBVA 2KGIA 1E4UA 2LV9A 2MT5A 1V87A 3EB5A 3O34A 2LGGA 5H9MA 2YREA 1VYXA 4ZQLA 2KE1A 4B7YC 3ZNIA 3DQVR 3LQJA 4FIPA 4P5OB 4L7XA 2FUIA 2MUMA 3N9OA 1WEOA 2PUYA 2G6QA 5B77A 2CSZA 3HCTA 4AUQB 2IDAA 1LDJB 2YSJA 2D8SA 4UP0A 2QIZA 4FO9A 5FERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSY A;  4N4F A;  5H1V A;  2KWN A;  4GND A;  3L11 A;  2FSA A;  3L1X A;  4W4U A;  4V3L C;  2MIQ A;  4XI1 A;  4FK5 A;  3DPL R;  2K4D A;  4UI9 B;  2XEU A;  2NAA A;  5B79 A;  2ECJ A;  3SHB A;  2LXP C;  5DKA A;  5TBN A;  4ZDT A;  1G25 A;  3NG2 A;  3C5K A;  2ECT A;  4WZ0 A;  5B75 A;  4S3O B;  2KR4 A;  5KH3 A;  4A4B A;  4YAT A;  4MSX A;  4N3W A;  2MD8 C;  4IC3 A;  3LQI A;  5G0F A;  2ZET C;  2L43 A;  3U5N A;  2XB1 A;  2KGG A;  4GNG A;  2KFT A;  4GB0 A;  1X4U A;  2MA6 A;  3ZPV E;  1WIL A;  2Y43 A;  1WEW A;  4I7B A;  4LLB A;  2KU3 A;  4WZ2 A;  2YQM A;  3U5M A;  2YT5 A;  2AN6 A;  3O37 A;  4GNE A;  5TAB A;  3O35 A;  3HTK C;  4IC2 A;  2LGK A;  2ECV A;  2JRJ A;  2YHO A;  3O36 A;  2M1R A;  5FB0 A;  2M85 A;  4R8P K;  5TDR A;  1X4I A;  1WEM A;  5D1M B;  4GNF A;  3M63 A;  4O64 A;  5FEY A;  1X4J A;  2MNZ A;  3N9P A;  2VPB A;  2L5U A;  2EOD A;  1ZBD B;  3LRQ A;  3PHD A;  4I7C A;  5TDW A;  5TRB A;  4CCG X;  2ECW A;  2H0D B;  2G43 A;  1DVP A;  1N87 A;  1IYM A;  5J3X A;  1CHC A;  3N9M A;  2L80 A;  2YUR A;  3VK6 A;  1T1H A;  1MM3 A;  4A0C D;  1MM2 A;  2BAY A;  2C2L A;  3ZPV 1;  4LK9 A;  3RPG C;  2DX8 A;  1U6G B;  2VJE B;  3KV5 A;  4AYC B;  2E6R A;  1WE9 A;  2RSD A;  2KWJ A;  3T6R A;  3LQH A;  4LJN A;  4MVT A;  2M3H A;  1HYI A;  3ZVY A;  2UZG A;  1JOC A;  3SOU A;  4R7E A;  1FP0 A;  2JMI A;  5LCW B;  2QIC A;  5JG6 A;  5LKT A;  4YAB A;  1Z6U A;  2F42 A;  4PTB A;  3O7A A;  2VPG A;  3EB6 A;  2LRI C;  1WGM A;  4WZ3 B;  1VD4 A;  3U5O A;  4WA6 A;  5AIT A;  3ZYQ A;  1WEE A;  4UP5 A;  2YSM A;  4YC9 A;  5KH9 A;  3O70 A;  2MNY A;  4I7D A;  3KNV A;  2LQ6 A;  4B86 C;  4BBQ A;  5LKU A;  3MHS A;  4F52 B;  3L1Z B;  4BHW A;  3M62 A;  1VFY A;  2H0D A;  3PUR A;  2YQL A;  2C2V S;  2LXH C;  4QF2 A;  2FUU A;  1JM7 B;  2CKL A;  1WEU A;  3I2D A;  5G04 B;  1BOR A;  2YUC A;  2M6M A;  4YBS A;  3GV4 A;  2VJF B;  3KQI A;  2CT2 A;  4R2Y A;  3ZVZ B;  4ZUX U;  4YBT A;  2KWO A;  5C13 A;  2VJE A;  2EA6 A;  2F6J A;  4AYC A;  2K1J A;  2JMJ A;  1WIM A;  4FJC A;  1F62 A;  5H1U A;  3SOX A;  3N9N A;  3GL6 A;  3IHP A;  4AP4 A;  2KRE A;  3O33 A;  4S3O C;  5D1L B;  4C9Z A;  3RTR B;  1WES A;  2Y1N A;  2YW8 A;  1HYJ A;  2L0B A;  4TKP B;  2MA5 A;  2CKL B;  3KV6 A;  5G05 B;  2YYR A;  5H1T A;  2Y1M A;  3U5P A;  2MD7 B;  1Z60 A;  3N9L A;  3MHH A;  3C6W A;  4V3K C;  3PUQ A;  1WEV A;  2VNF A;  5EYA F;  2EGP A;  1WEP A;  2KYU A;  5DIN A;  3QZV A;  4A49 A;  2RI7 A;  3ASL A;  2OXQ C;  4AVX A;  4CA1 A;  2E6S A;  4YAX A;  2LGV A;  2F6N A;  5FB1 A;  1JM7 A;  2PNX A;  2ECI A;  3T7L A;  3N9Q A;  4QF3 A;  2I50 A;  4Q6F A;  4A4C A;  2QJ0 A;  2VJF A;  2ECG A;  3HCS A;  2ECN A;  2VPE A;  5LKX A;  2LDR A;  1LDK C;  2LGL A;  4NN2 A;  1WEN A;  4LKA A;  3FL2 A;  2L75 A;  5B76 A;  5B78 A;  3HCU A;  2K16 A;  4L58 A;  2JMD A;  2K17 A;  2YU4 A;  5AIU A;  2KIZ A;  4PPE A;  4YBM A;  3M99 A;  5B8D A;  2LN0 A;  5D1K B;  4YAD A;  1RMD A;  2YHN A;  5LKZ A;  3RPG B;  2HYE D;  5I3L A;  1WEQ A;  1XWH A;  3V43 A;  3SOW A;  1WFK A;  2VPD A;  1Z2Q A;  5KH7 A;  2VP7 A;  3ZTG A;  5C11 A;  1K2F A;  2G45 A;  2KWK A;  2HDP A;  4X3G A;  4LAD B;  1FBV A;  2KGI A;  1E4U A;  2LV9 A;  2MT5 A;  1V87 A;  3EB5 A;  3O34 A;  2LGG A;  5H9M A;  2YRE A;  1VYX A;  4ZQL A;  2KE1 A;  4B7Y C;  3ZNI A;  3DQV R;  3LQJ A;  4FIP A;  4P5O B;  4L7X A;  2FUI A;  2MUM A;  3N9O A;  1WEO A;  2PUY A;  2G6Q A;  5B77 A;  2CSZ A;  3HCT A;  4AUQ B;  2IDA A;  1LDJ B;  2YSJ A;  2D8S A;  4UP0 A;  2QIZ A;  4FO9 A;  5FER A; 
#chains in the Genus database with same CATH topology
 2CSY A;  4N4F A;  5H1V A;  2FD4 A;  2KWN A;  4GND A;  3L11 A;  2FSA A;  3L1X A;  4O62 A;  4W4U A;  2M13 A;  4V3L C;  4F1P A;  2MIQ A;  4XI1 A;  4FK5 A;  3DPL R;  2K4D A;  4UI9 B;  1MBM A;  3SUB A;  4Z0O A;  2XEU A;  2NAA A;  5B79 A;  2ECJ A;  3SHB A;  2LXP C;  5DKA A;  5TBN A;  4ZDT A;  1G25 A;  2KKX A;  3NG2 A;  3C5K A;  2ECT A;  4WZ0 A;  5B75 A;  4S3O B;  2KR4 A;  3LVQ E;  5KH3 A;  4A4B A;  4YAT A;  4MSX A;  4N3W A;  4Z0R A;  2MD8 C;  4IC3 A;  3LQI A;  5G0F A;  2ZET C;  2L43 A;  3U5N A;  2XB1 A;  2KGG A;  4GNG A;  2KFT A;  4GB0 A;  1X4U A;  2MA6 A;  1DCQ A;  3ZPV E;  1WIL A;  3PLW A;  2Y43 A;  1WEW A;  4I7B A;  4LLB A;  2D8U A;  2KU3 A;  4WZ2 A;  2YQM A;  3T9K A;  3U5M A;  2YT5 A;  2AN6 A;  3O37 A;  4GNE A;  5TAB A;  3O35 A;  3HTK C;  4IC2 A;  4OGC A;  2LGK A;  2RR4 A;  2IQJ A;  2ECV A;  2JRJ A;  2YHO A;  3O36 A;  2M1R A;  5FB0 A;  2M85 A;  4R8P K;  3LVR E;  5TDR A;  1X4I A;  1WEM A;  5D1M B;  2EGM A;  3DWD A;  4GNF A;  3M63 A;  2MKE A;  4O64 A;  5FEY A;  3KDE C;  3O47 A;  3E2D A;  3M7K A;  1X4J A;  2MNZ A;  3N9P A;  2VPB A;  2L5U A;  2EOD A;  1ZBD B;  2OWA A;  3LRQ A;  3PHD A;  4I7C A;  5TDW A;  5TRB A;  4CCG X;  2DJA A;  2ECW A;  2H0D B;  2G43 A;  1DVP A;  2KKY A;  1N87 A;  1IYM A;  5J3X A;  1CHC A;  3N9M A;  2L80 A;  2YUR A;  3VK6 A;  1T1H A;  1MM3 A;  4A0C D;  1MM2 A;  2BAY A;  2C2L A;  3ZPV 1;  4LK9 A;  3RPG C;  3FJU B;  2DX8 A;  1U6G B;  2VJE B;  3KV5 A;  4AYC B;  2E6R A;  1WE9 A;  2RSD A;  2KWJ A;  3T6R A;  3LQH A;  4LJN A;  4MVT A;  2M3H A;  1HYI A;  3ZVY A;  2UZG A;  1JOC A;  3SOU A;  4R7E A;  1FP0 A;  2JMI A;  5LCW B;  2QIC A;  5JG6 A;  5LKT A;  4YAB A;  1Z6U A;  2F42 A;  4PTB A;  3O7A A;  2VPG A;  3EB6 A;  2LRI C;  1WGM A;  4WZ3 B;  1VD4 A;  3FM8 C;  3U5O A;  4WA6 A;  5AIT A;  3ZYQ A;  1WEE A;  4UP5 A;  2YSM A;  4YC9 A;  5KH9 A;  3O70 A;  2MNY A;  4I7D A;  3KNV A;  2EXU A;  2LQ6 A;  2XOC A;  4B86 C;  4BBQ A;  2E61 A;  5LKU A;  3MHS A;  4F52 B;  3L1Z B;  4BHW A;  3M62 A;  1VFY A;  2XP0 A;  2H0D A;  3PUR A;  2YQL A;  4H9D A;  2C2V S;  2LXH C;  3FAN A;  4QF2 A;  2FUU A;  2CRR A;  1JM7 B;  2CKL A;  1WEU A;  3I2D A;  2CSV A;  5G04 B;  1BOR A;  2YUC A;  2M6M A;  4YBS A;  3GV4 A;  2VJF B;  3KQI A;  2XOZ A;  2CT2 A;  4R2Y A;  3ZVZ B;  4ZUX U;  2JM3 A;  4YBT A;  2KWO A;  5K3Q A;  5C13 A;  2VJE A;  2EA6 A;  2F6J A;  4AYC A;  2K1J A;  2JMJ A;  1WIM A;  4FJC A;  1F62 A;  5H1U A;  3SOX A;  4OGE A;  3N9N A;  3GL6 A;  3IHP A;  4AP4 A;  2KRE A;  3O33 A;  4S3O C;  5D1L B;  4C9Z A;  3RTR B;  2YVR A;  1WES A;  2Y1N A;  2YW8 A;  1HYJ A;  2L0B A;  4TKP B;  2MA5 A;  2CKL B;  3KV6 A;  2B0O E;  5G05 B;  2YYR A;  3FEH A;  5H1T A;  2Y1M A;  2XOY A;  3U5P A;  3H7H A;  2MD7 B;  3Q1D A;  1Z60 A;  3N9L A;  3MHH A;  3C6W A;  5SVY A;  4V3K C;  3PUQ A;  1WEV A;  2VNF A;  5EYA F;  2EGP A;  2FFW A;  1WEP A;  2KYU A;  2CON A;  3DDT A;  3LJU X;  5DIN A;  3QZV A;  4A49 A;  2RI7 A;  3ASL A;  2OXQ C;  4AVX A;  4CA1 A;  2E6S A;  4YAX A;  2CRW A;  2LGV A;  3FAO A;  2F6N A;  5FB1 A;  1JM7 A;  2PNX A;  2ECI A;  3T7L A;  3N9Q A;  4QF3 A;  2I50 A;  4Q6F A;  4A4C A;  2QJ0 A;  2DSM A;  2VJF A;  3LDY A;  2ECG A;  3HCS A;  2ECN A;  2VPE A;  5LKX A;  2LDR A;  1LDK C;  2LGL A;  4NN2 A;  1WEN A;  4LKA A;  3FL2 A;  2L75 A;  5B76 A;  5B78 A;  3HCU A;  2K16 A;  4L58 A;  2LAU A;  2JMD A;  2K17 A;  2YU4 A;  5AIU A;  2KIZ A;  4PPE A;  4YBM A;  3M99 A;  5B8D A;  2LN0 A;  5D1K B;  4YAD A;  1RMD A;  2YHN A;  5LKZ A;  3RPG B;  2HYE D;  5I3L A;  1WEQ A;  1XWH A;  3V43 A;  3SOW A;  1WFK A;  2VPD A;  1Z2Q A;  5KH7 A;  2VP7 A;  3ZTG A;  5C11 A;  1K2F A;  4QQ4 A;  2G45 A;  2KWK A;  2HDP A;  4X3G A;  4LAD B;  1FBV A;  2KGI A;  1E4U A;  2LV9 A;  2MT5 A;  1V87 A;  3EB5 A;  3O34 A;  5SVI A;  2LGG A;  5H9M A;  2YRE A;  1VYX A;  4ZQL A;  2KE1 A;  4B7Y C;  2JUN A;  3DQV R;  3ZNI A;  3LQJ A;  3MDB C;  4FIP A;  4P5O B;  2P57 A;  4L7X A;  2FUI A;  2MUM A;  3N9O A;  3JUE A;  1WEO A;  2PUY A;  5SVX A;  2G6Q A;  2L7P A;  5B77 A;  2CSZ A;  3HCT A;  4AUQ B;  2IDA A;  1LDJ B;  2YSJ A;  2D8S A;  4UP0 A;  2QIZ A;  4FO9 A;  5FER A;  5SVI B; 
#chains in the Genus database with same CATH homology
 2CSY A;  4N4F A;  5H1V A;  2KWN A;  4GND A;  3L11 A;  2FSA A;  3L1X A;  4W4U A;  4V3L C;  2MIQ A;  4XI1 A;  4FK5 A;  3DPL R;  2K4D A;  4UI9 B;  2XEU A;  2NAA A;  5B79 A;  2ECJ A;  3SHB A;  2LXP C;  5DKA A;  5TBN A;  4ZDT A;  1G25 A;  3NG2 A;  3C5K A;  2ECT A;  4WZ0 A;  5B75 A;  4S3O B;  2KR4 A;  5KH3 A;  4A4B A;  4YAT A;  4MSX A;  4N3W A;  2MD8 C;  4IC3 A;  3LQI A;  5G0F A;  2ZET C;  2L43 A;  3U5N A;  2XB1 A;  2KGG A;  4GNG A;  2KFT A;  4GB0 A;  1X4U A;  2MA6 A;  3ZPV E;  1WIL A;  2Y43 A;  1WEW A;  4I7B A;  4LLB A;  2KU3 A;  4WZ2 A;  2YQM A;  3U5M A;  2YT5 A;  2AN6 A;  3O37 A;  4GNE A;  5TAB A;  3O35 A;  3HTK C;  4IC2 A;  2LGK A;  2ECV A;  2JRJ A;  2YHO A;  3O36 A;  2M1R A;  5FB0 A;  2M85 A;  4R8P K;  5TDR A;  1X4I A;  1WEM A;  5D1M B;  4GNF A;  3M63 A;  4O64 A;  5FEY A;  1X4J A;  2MNZ A;  3N9P A;  2VPB A;  2L5U A;  2EOD A;  1ZBD B;  3LRQ A;  3PHD A;  4I7C A;  5TDW A;  5TRB A;  4CCG X;  2ECW A;  2H0D B;  2G43 A;  1DVP A;  1N87 A;  1IYM A;  5J3X A;  1CHC A;  3N9M A;  2L80 A;  2YUR A;  3VK6 A;  1T1H A;  1MM3 A;  4A0C D;  1MM2 A;  2BAY A;  2C2L A;  3ZPV 1;  4LK9 A;  3RPG C;  2DX8 A;  1U6G B;  2VJE B;  3KV5 A;  4AYC B;  2E6R A;  1WE9 A;  2RSD A;  2KWJ A;  3T6R A;  3LQH A;  4LJN A;  4MVT A;  2M3H A;  1HYI A;  3ZVY A;  2UZG A;  1JOC A;  3SOU A;  4R7E A;  1FP0 A;  2JMI A;  5LCW B;  2QIC A;  5JG6 A;  5LKT A;  4YAB A;  1Z6U A;  2F42 A;  4PTB A;  3O7A A;  2VPG A;  3EB6 A;  2LRI C;  1WGM A;  4WZ3 B;  1VD4 A;  3U5O A;  4WA6 A;  5AIT A;  3ZYQ A;  1WEE A;  4UP5 A;  2YSM A;  4YC9 A;  5KH9 A;  3O70 A;  2MNY A;  4I7D A;  3KNV A;  2LQ6 A;  4B86 C;  4BBQ A;  5LKU A;  3MHS A;  4F52 B;  3L1Z B;  4BHW A;  3M62 A;  1VFY A;  2H0D A;  3PUR A;  2YQL A;  2C2V S;  2LXH C;  4QF2 A;  2FUU A;  1JM7 B;  2CKL A;  1WEU A;  3I2D A;  5G04 B;  1BOR A;  2YUC A;  2M6M A;  4YBS A;  3GV4 A;  2VJF B;  3KQI A;  2CT2 A;  4R2Y A;  3ZVZ B;  4ZUX U;  4YBT A;  2KWO A;  5C13 A;  2VJE A;  2EA6 A;  2F6J A;  4AYC A;  2K1J A;  2JMJ A;  1WIM A;  4FJC A;  1F62 A;  5H1U A;  3SOX A;  3N9N A;  3GL6 A;  3IHP A;  4AP4 A;  2KRE A;  3O33 A;  4S3O C;  5D1L B;  4C9Z A;  3RTR B;  1WES A;  2Y1N A;  2YW8 A;  1HYJ A;  2L0B A;  4TKP B;  2MA5 A;  2CKL B;  3KV6 A;  5G05 B;  2YYR A;  5H1T A;  2Y1M A;  3U5P A;  2MD7 B;  1Z60 A;  3N9L A;  3MHH A;  3C6W A;  4V3K C;  3PUQ A;  1WEV A;  2VNF A;  5EYA F;  2EGP A;  1WEP A;  2KYU A;  5DIN A;  3QZV A;  4A49 A;  2RI7 A;  3ASL A;  2OXQ C;  4AVX A;  4CA1 A;  2E6S A;  4YAX A;  2LGV A;  2F6N A;  5FB1 A;  1JM7 A;  2PNX A;  2ECI A;  3T7L A;  3N9Q A;  4QF3 A;  2I50 A;  4Q6F A;  4A4C A;  2QJ0 A;  2VJF A;  2ECG A;  3HCS A;  2ECN A;  2VPE A;  5LKX A;  2LDR A;  1LDK C;  2LGL A;  4NN2 A;  1WEN A;  4LKA A;  3FL2 A;  2L75 A;  5B76 A;  5B78 A;  3HCU A;  2K16 A;  4L58 A;  2JMD A;  2K17 A;  2YU4 A;  5AIU A;  2KIZ A;  4PPE A;  4YBM A;  3M99 A;  5B8D A;  2LN0 A;  5D1K B;  4YAD A;  1RMD A;  2YHN A;  5LKZ A;  3RPG B;  2HYE D;  5I3L A;  1WEQ A;  1XWH A;  3V43 A;  3SOW A;  1WFK A;  2VPD A;  1Z2Q A;  5KH7 A;  2VP7 A;  3ZTG A;  5C11 A;  1K2F A;  2G45 A;  2KWK A;  2HDP A;  4X3G A;  4LAD B;  1FBV A;  2KGI A;  1E4U A;  2LV9 A;  2MT5 A;  1V87 A;  3EB5 A;  3O34 A;  2LGG A;  5H9M A;  2YRE A;  1VYX A;  4ZQL A;  2KE1 A;  4B7Y C;  3ZNI A;  3DQV R;  3LQJ A;  4FIP A;  4P5O B;  4L7X A;  2FUI A;  2MUM A;  3N9O A;  1WEO A;  2PUY A;  2G6Q A;  5B77 A;  2CSZ A;  3HCT A;  4AUQ B;  2IDA A;  1LDJ B;  2YSJ A;  2D8S A;  4UP0 A;  2QIZ A;  4FO9 A;  5FER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...