1CHCA

Structure of the c3hc4 domain by 1h-nuclear magnetic resonance spectroscopy; a new structural class of zinc-finger
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
68
Chain Sequence
MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EQUINE HERPES VIRUS-1 RING DOMAIN
publication title Structure of the C3HC4 domain by 1H-nuclear magnetic resonance spectroscopy. A new structural class of zinc-finger.
pubmed doi rcsb
source organism Equid herpesvirus 1
molecule tags Viral protein
total genus 3
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 1994-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1chcA00
5DINA 4L7XA 2E6RA 4PPEA 3FL2A 2HYED 2LGKA 2VNFA 3N9LA 1DVPA 2KREA 3O70A 4IC2A 3ZVYA 5H1TA 2LN0A 2Y1NA 2LGLA 1WEQA 4Q6FA 3SOXA 3U5PA 2YHOA 4B86C 2KGGA 5FB1A 2MIQA 2YT5A 2MNZA 2Y43A 2YUCA 2KYUA 4N3WA 1X4UA 3SHBA 2K1JA 4ZDTA 1IYMA 3RPGC 2ECVA 1JOCA 2QJ0A 5D1KB 5KH9A 5JG6A 2K4DA 3LRQA 4CCGX 2CSYA 2YU4A 5DKAA 4V3LC 1X4IA 2KGIA 2XEUA 2PUYA 2ZETC 2ECGA 2L43A 4AVXA 4O64A 1MM3A 3I2DA 2JMJA 1FBVA 4B7YC 2LGGA 3O35A 3T7LA 3O7AA 4LJNA 5B77A 4YBMA 4TKPB 5AITA 4BBQA 3T6RA 4FJCA 4NN2A 5KH3A 1E4UA 3ZNIA 2F6JA 2YQLA 3L11A 1F62A 3KV5A 5TABA 5H1VA 1WEVA 5C11A 2L80A 3KV6A 2C2VS 5TDRA 2MD7B 2L0BA 1MM2A 3PHDA 1WEWA 3LQHA 2M85A 5LCWB 4R8PK 2KWOA 2H0DA 2AN6A 4FK5A 4IC3A 2M6MA 4GNDA 3N9NA 2H0DB 4S3OB 1LDJB 1FP0A 4WZ0A 2Y1MA 3DPLR 1WIMA 2MNYA 4A49A 1V87A 3C6WA 5G04B 3DQVR 2MD8C 2IDAA 5B75A 1VD4A 4WZ3B 1Z60A 3LQIA 2YREA 5FERA 2KR4A 2CSZA 4W4UA 3IHPA 2K17A 4A4BA 4BHWA 5LKZA 2YYRA 2L5UA 3KQIA 4YADA 1U6GB 2JMIA 4GNFA 5C13A 2LGVA 4P5OB 4LK9A 1WENA 3ZYQA 4C9ZA 2BAYA 5TDWA 3GV4A 4AYCA 3U5NA 2ECIA 2MA5A 4AYCB 4A4CA 1WILA 2VJEA 4LADB 4WZ2A 1WE9A 2VJEB 3C5KA 2M3HA 4MVTA 3N9QA 5J3XA 4S3OC 2FUUA 2LRIC 1XWHA 4LKAA 2C2LA 4L58A 2KWNA 1JM7A 2G6QA 2OXQC 5B8DA 4LLBA 2ECWA 2LQ6A 1JM7B 2FSAA 4GNGA 4I7DA 3MHSA 4GNEA 3GL6A 3HCSA 2UZGA 3ASLA 2LXPC 5FEYA 3O34A 3QZVA 4FO9A 1Z6UA 2CKLA 3EB5A 4R7EA 2LV9A 2YSMA 4YBSA 2CKLB 1ZBDB 2KWJA 2ECTA 2L75A 4I7BA 1WEMA 2VJFA 5TRBA 2ECJA 3PUQA 2KE1A 2VJFB 1WEOA 3HTKC 5G0FA 5LKTA 2FUIA 2RI7A 3NG2A 2NAAA 5TBNA 3ZVZB 3SOUA 1HYJA 1BORA 2RSDA 2CT2A 3U5OA 4MSXA 3LQJA 4GB0A 2VPGA 5EYAF 2KU3A 4AUQB 4YABA 4QF3A 3O37A 1WESA 2DX8A 3O36A 1HYIA 3M62A 3HCTA 2D8SA 1LDKC 4ZUXU 2KWKA 4FIPA 5FB0A 4YAXA 2HDPA 5D1LB 1VYXA 5LKUA 3RTRB 4UI9B 2I50A 4YC9A 2G45A 1RMDA 2XB1A 1WFKA 1K2FA 2F42A 4N4FA 3PURA 3ZTGA 4YATA 2E6SA 2LDRA 4XI1A 2YW8A 2VPEA 5B76A 4X3GA 3ZPV1 1N87A 3M99A 2EODA 1WGMA 1WEUA 4V3KC 5KH7A 4R2YA 2QIZA 5D1MB 4I7CA 3N9OA 5H1UA 2LXHC 2M1RA 5AIUA 4UP5A 4WA6A 2MA6A 2VPBA 1G25A 3ZPVE 4AP4A 3VK6A 3L1ZB 3HCUA 5LKXA 3U5MA 3EB6A 3V43A 1CHCA 2MT5A 2QICA 1T1HA 2YQMA 5G05B 2PNXA 2MUMA 3RPGB 2F6NA 2ECNA 2YURA 1X4JA 5B79A 2JMDA 5I3LA 2YHNA 3L1XA 5B78A 2VP7A 1WEEA 2EA6A 3M63A 3MHHA 3N9MA 3O33A 4QF2A 4F52B 2JRJA 2K16A 2G43A 4PTBA 1Z2QA 2VPDA 2KIZA 3KNVA 2YSJA 5H9MA 2EGPA 2KFTA 4YBTA 1WEPA 1VFYA 4A0CD 3N9PA 4CA1A 4UP0A 4ZQLA 3SOWA
chains in the Genus database with same CATH superfamily
5DINA 5SVIB 4L7XA 2E6RA 4PPEA 3FL2A 2HYED 2LGKA 2VNFA 3N9LA 1DVPA 2KREA 3O70A 2KKYA 5K3QA 4IC2A 3ZVYA 5H1TA 2LN0A 2Y1NA 2JUNA 2LGLA 3JUEA 1WEQA 4Q6FA 3SOXA 3U5PA 2YHOA 4B86C 2KGGA 5FB1A 2MIQA 2YT5A 2MNZA 2Y43A 2YUCA 2KYUA 3DWDA 2XOYA 4N3WA 1X4UA 3SHBA 2K1JA 4ZDTA 1IYMA 3FM8C 2ECVA 3RPGC 1JOCA 2QJ0A 5D1KB 5KH9A 5JG6A 2K4DA 3LRQA 4CCGX 2CSYA 2YU4A 5DKAA 4V3LC 1X4IA 2KGIA 2XEUA 2PUYA 2ZETC 2ECGA 2EGMA 2L43A 4AVXA 4O64A 1MM3A 2JM3A 3I2DA 2JMJA 1FBVA 4B7YC 2LGGA 3O35A 3T7LA 3O7AA 4LJNA 5B77A 3LDYA 4YBMA 2CSVA 4TKPB 5AITA 4BBQA 3T6RA 3Q1DA 4FJCA 4NN2A 5KH3A 1E4UA 3ZNIA 2F6JA 2YQLA 3L11A 1F62A 3KV5A 2CRRA 5TABA 2OWAA 2RR4A 2LAUA 4QQ4A 5H1VA 1WEVA 5C11A 2L80A 3KV6A 2C2VS 2XP0A 3FJUB 5TDRA 2MD7B 2L0BA 1MM2A 3PHDA 1WEWA 3LQHA 3KDEC 3FEHA 2M85A 5LCWB 4R8PK 4O62A 2KWOA 2H0DA 2AN6A 4FK5A 4OGEA 4IC3A 2M6MA 4GNDA 3N9NA 2H0DB 4S3OB 1LDJB 1FP0A 4WZ0A 2Y1MA 3DPLR 1WIMA 2MNYA 4A49A 1V87A 3C6WA 2P57A 2EXUA 5G04B 3DQVR 2MD8C 2IDAA 5B75A 4H9DA 1VD4A 4WZ3B 1Z60A 3LQIA 2YREA 5FERA 2KR4A 2CSZA 4W4UA 3IHPA 2K17A 4A4BA 4BHWA 5LKZA 2YYRA 2L5UA 3KQIA 4YADA 1U6GB 2JMIA 4F1PA 4GNFA 5C13A 2LGVA 3FANA 4P5OB 4LK9A 4OGCA 2FD4A 2DJAA 2L7PA 1WENA 3ZYQA 4C9ZA 2BAYA 5TDWA 3GV4A 4AYCA 3U5NA 2ECIA 2MA5A 4AYCB 4A4CA 1WILA 2VJEA 4LADB 4WZ2A 1WE9A 2VJEB 3C5KA 2M3HA 4MVTA 3N9QA 5J3XA 3LVRE 4S3OC 3LVQE 2FUUA 2LRIC 3E2DA 1XWHA 4LKAA 2C2LA 4UP0A 4L58A 2KWNA 1JM7A 2G6QA 2OXQC 5B8DA 2YVRA 1DCQA 4LLBA 5SVYA 2ECWA 2LQ6A 1JM7B 2FSAA 4GNGA 3DDTA 4I7DA 3MHSA 2FFWA 4GNEA 3GL6A 3HCSA 2UZGA 2LXPC 3LJUX 5FEYA 3O34A 3QZVA 4FO9A 1Z6UA 2CKLA 3EB5A 4R7EA 2LV9A 2YSMA 4YBSA 2M13A 2CKLB 1ZBDB 2KWJA 2B0OE 2ECTA 2L75A 4I7BA 1WEMA 2VJFA 5TRBA 2ECJA 3PUQA 2KE1A 2KKXA 2VJFB 1WEOA 3HTKC 5G0FA 5LKTA 2FUIA 2RI7A 3NG2A 2NAAA 5TBNA 3ZVZB 3SOUA 1HYJA 1BORA 2RSDA 2CT2A 3U5OA 4MSXA 2XOZA 3LQJA 4GB0A 2VPGA 1MBMA 3SUBA 5EYAF 2KU3A 4AUQB 3PLWA 4YABA 4QF3A 3O37A 1WESA 2XOCA 3H7HA 2DX8A 3O36A 1HYIA 3M62A 3HCTA 2D8SA 1LDKC 4ZUXU 2KWKA 4FIPA 5FB0A 4YAXA 2CRWA 2D8UA 2E61A 2HDPA 5D1LB 1VYXA 5LKUA 3RTRB 4UI9B 2I50A 4YC9A 2G45A 1RMDA 2XB1A 1WFKA 1K2FA 2F42A 4N4FA 5SVXA 2MKEA 3PURA 3ZTGA 4YATA 2E6SA 2LDRA 2YW8A 4XI1A 2VPEA 5B76A 4Z0OA 4X3GA 3ZPV1 1N87A 3M99A 2EODA 1WGMA 1WEUA 4V3KC 5KH7A 4R2YA 2QIZA 3MDBC 5D1MB 4I7CA 3N9OA 5H1UA 2LXHC 2M1RA 5AIUA 4UP5A 4WA6A 2MA6A 2VPBA 1G25A 3ZPVE 4AP4A 3VK6A 3L1ZB 3HCUA 5LKXA 3U5MA 3EB6A 3V43A 1CHCA 2MT5A 2QICA 1T1HA 2YQMA 5G05B 2PNXA 2MUMA 3RPGB 3M7KA 2F6NA 2ECNA 2YURA 1X4JA 5B79A 2JMDA 5I3LA 3FAOA 2YHNA 3L1XA 5B78A 2VP7A 1WEEA 2EA6A 3M63A 3MHHA 3N9MA 3O33A 4QF2A 4F52B 2JRJA 3O47A 2K16A 2G43A 4PTBA 1Z2QA 2VPDA 2KIZA 3KNVA 2YSJA 4Z0RA 2CONA 3T9KA 5H9MA 2EGPA 2IQJA 2KFTA 4YBTA 1WEPA 5SVIA 2DSMA 1VFYA 4A0CD 3N9PA 4CA1A 3ASLA 4ZQLA 3SOWA
chains in the Genus database with same CATH topology
5DINA 4L7XA 2E6RA 4PPEA 3FL2A 2HYED 2LGKA 2VNFA 3N9LA 1DVPA 2KREA 3O70A 4IC2A 3ZVYA 5H1TA 2LN0A 2Y1NA 2LGLA 1WEQA 4Q6FA 3SOXA 3U5PA 2YHOA 4B86C 2KGGA 5FB1A 2MIQA 2YT5A 2MNZA 2Y43A 2YUCA 2KYUA 4N3WA 1X4UA 3SHBA 2K1JA 4ZDTA 1IYMA 3RPGC 2ECVA 1JOCA 2QJ0A 5D1KB 5KH9A 5JG6A 2K4DA 3LRQA 4CCGX 2CSYA 2YU4A 5DKAA 4V3LC 1X4IA 2KGIA 2XEUA 2PUYA 2ZETC 2ECGA 2L43A 4AVXA 4O64A 1MM3A 3I2DA 2JMJA 1FBVA 4B7YC 2LGGA 3O35A 3T7LA 3O7AA 4LJNA 5B77A 4YBMA 4TKPB 5AITA 4BBQA 3T6RA 4FJCA 4NN2A 5KH3A 1E4UA 3ZNIA 2F6JA 2YQLA 3L11A 1F62A 3KV5A 5TABA 5H1VA 1WEVA 5C11A 2L80A 3KV6A 2C2VS 5TDRA 2MD7B 2L0BA 1MM2A 3PHDA 1WEWA 3LQHA 2M85A 5LCWB 4R8PK 2KWOA 2H0DA 2AN6A 4FK5A 4IC3A 2M6MA 4GNDA 3N9NA 2H0DB 4S3OB 1LDJB 1FP0A 4WZ0A 2Y1MA 3DPLR 1WIMA 2MNYA 4A49A 1V87A 3C6WA 5G04B 3DQVR 2MD8C 2IDAA 5B75A 1VD4A 4WZ3B 1Z60A 3LQIA 2YREA 5FERA 2KR4A 2CSZA 4W4UA 3IHPA 2K17A 4A4BA 4BHWA 5LKZA 2YYRA 2L5UA 3KQIA 4YADA 1U6GB 2JMIA 4GNFA 5C13A 2LGVA 4P5OB 4LK9A 1WENA 3ZYQA 4C9ZA 2BAYA 5TDWA 3GV4A 4AYCA 3U5NA 2ECIA 2MA5A 4AYCB 4A4CA 1WILA 2VJEA 4LADB 4WZ2A 1WE9A 2VJEB 3C5KA 2M3HA 4MVTA 3N9QA 5J3XA 4S3OC 2FUUA 2LRIC 1XWHA 4LKAA 2C2LA 4L58A 2KWNA 1JM7A 2G6QA 2OXQC 5B8DA 4LLBA 2ECWA 2LQ6A 1JM7B 2FSAA 4GNGA 4I7DA 3MHSA 4GNEA 3GL6A 3HCSA 2UZGA 3ASLA 2LXPC 5FEYA 3O34A 3QZVA 4FO9A 1Z6UA 2CKLA 3EB5A 4R7EA 2LV9A 2YSMA 4YBSA 2CKLB 1ZBDB 2KWJA 2ECTA 2L75A 4I7BA 1WEMA 2VJFA 5TRBA 2ECJA 3PUQA 2KE1A 2VJFB 1WEOA 3HTKC 5G0FA 5LKTA 2FUIA 2RI7A 3NG2A 2NAAA 5TBNA 3ZVZB 3SOUA 1HYJA 1BORA 2RSDA 2CT2A 3U5OA 4MSXA 3LQJA 4GB0A 2VPGA 5EYAF 2KU3A 4AUQB 4YABA 4QF3A 3O37A 1WESA 2DX8A 3O36A 1HYIA 3M62A 3HCTA 2D8SA 1LDKC 4ZUXU 2KWKA 4FIPA 5FB0A 4YAXA 2HDPA 5D1LB 1VYXA 5LKUA 3RTRB 4UI9B 2I50A 4YC9A 2G45A 1RMDA 2XB1A 1WFKA 1K2FA 2F42A 4N4FA 3PURA 3ZTGA 4YATA 2E6SA 2LDRA 4XI1A 2YW8A 2VPEA 5B76A 4X3GA 3ZPV1 1N87A 3M99A 2EODA 1WGMA 1WEUA 4V3KC 5KH7A 4R2YA 2QIZA 5D1MB 4I7CA 3N9OA 5H1UA 2LXHC 2M1RA 5AIUA 4UP5A 4WA6A 2MA6A 2VPBA 1G25A 3ZPVE 4AP4A 3VK6A 3L1ZB 3HCUA 5LKXA 3U5MA 3EB6A 3V43A 1CHCA 2MT5A 2QICA 1T1HA 2YQMA 5G05B 2PNXA 2MUMA 3RPGB 2F6NA 2ECNA 2YURA 1X4JA 5B79A 2JMDA 5I3LA 2YHNA 3L1XA 5B78A 2VP7A 1WEEA 2EA6A 3M63A 3MHHA 3N9MA 3O33A 4QF2A 4F52B 2JRJA 2K16A 2G43A 4PTBA 1Z2QA 2VPDA 2KIZA 3KNVA 2YSJA 5H9MA 2EGPA 2KFTA 4YBTA 1WEPA 1VFYA 4A0CD 3N9PA 4CA1A 4UP0A 4ZQLA 3SOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIN A;  4L7X A;  2E6R A;  4PPE A;  3FL2 A;  2HYE D;  2LGK A;  2VNF A;  3N9L A;  1DVP A;  2KRE A;  3O70 A;  4IC2 A;  3ZVY A;  5H1T A;  2LN0 A;  2Y1N A;  2LGL A;  1WEQ A;  4Q6F A;  3SOX A;  3U5P A;  2YHO A;  4B86 C;  2KGG A;  5FB1 A;  2MIQ A;  2YT5 A;  2MNZ A;  2Y43 A;  2YUC A;  2KYU A;  4N3W A;  1X4U A;  3SHB A;  2K1J A;  4ZDT A;  1IYM A;  3RPG C;  2ECV A;  1JOC A;  2QJ0 A;  5D1K B;  5KH9 A;  5JG6 A;  2K4D A;  3LRQ A;  4CCG X;  2CSY A;  2YU4 A;  5DKA A;  4V3L C;  1X4I A;  2KGI A;  2XEU A;  2PUY A;  2ZET C;  2ECG A;  2L43 A;  4AVX A;  4O64 A;  1MM3 A;  3I2D A;  2JMJ A;  1FBV A;  4B7Y C;  2LGG A;  3O35 A;  3T7L A;  3O7A A;  4LJN A;  5B77 A;  4YBM A;  4TKP B;  5AIT A;  4BBQ A;  3T6R A;  4FJC A;  4NN2 A;  5KH3 A;  1E4U A;  3ZNI A;  2F6J A;  2YQL A;  3L11 A;  1F62 A;  3KV5 A;  5TAB A;  5H1V A;  1WEV A;  5C11 A;  2L80 A;  3KV6 A;  2C2V S;  5TDR A;  2MD7 B;  2L0B A;  1MM2 A;  3PHD A;  1WEW A;  3LQH A;  2M85 A;  5LCW B;  4R8P K;  2KWO A;  2H0D A;  2AN6 A;  4FK5 A;  4IC3 A;  2M6M A;  4GND A;  3N9N A;  2H0D B;  4S3O B;  1LDJ B;  1FP0 A;  4WZ0 A;  2Y1M A;  3DPL R;  1WIM A;  2MNY A;  4A49 A;  1V87 A;  3C6W A;  5G04 B;  3DQV R;  2MD8 C;  2IDA A;  5B75 A;  1VD4 A;  4WZ3 B;  1Z60 A;  3LQI A;  2YRE A;  5FER A;  2KR4 A;  2CSZ A;  4W4U A;  3IHP A;  2K17 A;  4A4B A;  4BHW A;  5LKZ A;  2YYR A;  2L5U A;  3KQI A;  4YAD A;  1U6G B;  2JMI A;  4GNF A;  5C13 A;  2LGV A;  4P5O B;  4LK9 A;  1WEN A;  3ZYQ A;  4C9Z A;  2BAY A;  5TDW A;  3GV4 A;  4AYC A;  3U5N A;  2ECI A;  2MA5 A;  4AYC B;  4A4C A;  1WIL A;  2VJE A;  4LAD B;  4WZ2 A;  1WE9 A;  2VJE B;  3C5K A;  2M3H A;  4MVT A;  3N9Q A;  5J3X A;  4S3O C;  2FUU A;  2LRI C;  1XWH A;  4LKA A;  2C2L A;  4L58 A;  2KWN A;  1JM7 A;  2G6Q A;  2OXQ C;  5B8D A;  4LLB A;  2ECW A;  2LQ6 A;  1JM7 B;  2FSA A;  4GNG A;  4I7D A;  3MHS A;  4GNE A;  3GL6 A;  3HCS A;  2UZG A;  3ASL A;  2LXP C;  5FEY A;  3O34 A;  3QZV A;  4FO9 A;  1Z6U A;  2CKL A;  3EB5 A;  4R7E A;  2LV9 A;  2YSM A;  4YBS A;  2CKL B;  1ZBD B;  2KWJ A;  2ECT A;  2L75 A;  4I7B A;  1WEM A;  2VJF A;  5TRB A;  2ECJ A;  3PUQ A;  2KE1 A;  2VJF B;  1WEO A;  3HTK C;  5G0F A;  5LKT A;  2FUI A;  2RI7 A;  3NG2 A;  2NAA A;  5TBN A;  3ZVZ B;  3SOU A;  1HYJ A;  1BOR A;  2RSD A;  2CT2 A;  3U5O A;  4MSX A;  3LQJ A;  4GB0 A;  2VPG A;  5EYA F;  2KU3 A;  4AUQ B;  4YAB A;  4QF3 A;  3O37 A;  1WES A;  2DX8 A;  3O36 A;  1HYI A;  3M62 A;  3HCT A;  2D8S A;  1LDK C;  4ZUX U;  2KWK A;  4FIP A;  5FB0 A;  4YAX A;  2HDP A;  5D1L B;  1VYX A;  5LKU A;  3RTR B;  4UI9 B;  2I50 A;  4YC9 A;  2G45 A;  1RMD A;  2XB1 A;  1WFK A;  1K2F A;  2F42 A;  4N4F A;  3PUR A;  3ZTG A;  4YAT A;  2E6S A;  2LDR A;  4XI1 A;  2YW8 A;  2VPE A;  5B76 A;  4X3G A;  3ZPV 1;  1N87 A;  3M99 A;  2EOD A;  1WGM A;  1WEU A;  4V3K C;  5KH7 A;  4R2Y A;  2QIZ A;  5D1M B;  4I7C A;  3N9O A;  5H1U A;  2LXH C;  2M1R A;  5AIU A;  4UP5 A;  4WA6 A;  2MA6 A;  2VPB A;  1G25 A;  3ZPV E;  4AP4 A;  3VK6 A;  3L1Z B;  3HCU A;  5LKX A;  3U5M A;  3EB6 A;  3V43 A;  1CHC A;  2MT5 A;  2QIC A;  1T1H A;  2YQM A;  5G05 B;  2PNX A;  2MUM A;  3RPG B;  2F6N A;  2ECN A;  2YUR A;  1X4J A;  5B79 A;  2JMD A;  5I3L A;  2YHN A;  3L1X A;  5B78 A;  2VP7 A;  1WEE A;  2EA6 A;  3M63 A;  3MHH A;  3N9M A;  3O33 A;  4QF2 A;  4F52 B;  2JRJ A;  2K16 A;  2G43 A;  4PTB A;  1Z2Q A;  2VPD A;  2KIZ A;  3KNV A;  2YSJ A;  5H9M A;  2EGP A;  2KFT A;  4YBT A;  1WEP A;  1VFY A;  4A0C D;  3N9P A;  4CA1 A;  4UP0 A;  4ZQL A;  3SOW A; 
#chains in the Genus database with same CATH topology
 5DIN A;  5SVI B;  4L7X A;  2E6R A;  4PPE A;  3FL2 A;  2HYE D;  2LGK A;  2VNF A;  3N9L A;  1DVP A;  2KRE A;  3O70 A;  2KKY A;  5K3Q A;  4IC2 A;  3ZVY A;  5H1T A;  2LN0 A;  2Y1N A;  2JUN A;  2LGL A;  3JUE A;  1WEQ A;  4Q6F A;  3SOX A;  3U5P A;  2YHO A;  4B86 C;  2KGG A;  5FB1 A;  2MIQ A;  2YT5 A;  2MNZ A;  2Y43 A;  2YUC A;  2KYU A;  3DWD A;  2XOY A;  4N3W A;  1X4U A;  3SHB A;  2K1J A;  4ZDT A;  1IYM A;  3FM8 C;  2ECV A;  3RPG C;  1JOC A;  2QJ0 A;  5D1K B;  5KH9 A;  5JG6 A;  2K4D A;  3LRQ A;  4CCG X;  2CSY A;  2YU4 A;  5DKA A;  4V3L C;  1X4I A;  2KGI A;  2XEU A;  2PUY A;  2ZET C;  2ECG A;  2EGM A;  2L43 A;  4AVX A;  4O64 A;  1MM3 A;  2JM3 A;  3I2D A;  2JMJ A;  1FBV A;  4B7Y C;  2LGG A;  3O35 A;  3T7L A;  3O7A A;  4LJN A;  5B77 A;  3LDY A;  4YBM A;  2CSV A;  4TKP B;  5AIT A;  4BBQ A;  3T6R A;  3Q1D A;  4FJC A;  4NN2 A;  5KH3 A;  1E4U A;  3ZNI A;  2F6J A;  2YQL A;  3L11 A;  1F62 A;  3KV5 A;  2CRR A;  5TAB A;  2OWA A;  2RR4 A;  2LAU A;  4QQ4 A;  5H1V A;  1WEV A;  5C11 A;  2L80 A;  3KV6 A;  2C2V S;  2XP0 A;  3FJU B;  5TDR A;  2MD7 B;  2L0B A;  1MM2 A;  3PHD A;  1WEW A;  3LQH A;  3KDE C;  3FEH A;  2M85 A;  5LCW B;  4R8P K;  4O62 A;  2KWO A;  2H0D A;  2AN6 A;  4FK5 A;  4OGE A;  4IC3 A;  2M6M A;  4GND A;  3N9N A;  2H0D B;  4S3O B;  1LDJ B;  1FP0 A;  4WZ0 A;  2Y1M A;  3DPL R;  1WIM A;  2MNY A;  4A49 A;  1V87 A;  3C6W A;  2P57 A;  2EXU A;  5G04 B;  3DQV R;  2MD8 C;  2IDA A;  5B75 A;  4H9D A;  1VD4 A;  4WZ3 B;  1Z60 A;  3LQI A;  2YRE A;  5FER A;  2KR4 A;  2CSZ A;  4W4U A;  3IHP A;  2K17 A;  4A4B A;  4BHW A;  5LKZ A;  2YYR A;  2L5U A;  3KQI A;  4YAD A;  1U6G B;  2JMI A;  4F1P A;  4GNF A;  5C13 A;  2LGV A;  3FAN A;  4P5O B;  4LK9 A;  4OGC A;  2FD4 A;  2DJA A;  2L7P A;  1WEN A;  3ZYQ A;  4C9Z A;  2BAY A;  5TDW A;  3GV4 A;  4AYC A;  3U5N A;  2ECI A;  2MA5 A;  4AYC B;  4A4C A;  1WIL A;  2VJE A;  4LAD B;  4WZ2 A;  1WE9 A;  2VJE B;  3C5K A;  2M3H A;  4MVT A;  3N9Q A;  5J3X A;  3LVR E;  4S3O C;  3LVQ E;  2FUU A;  2LRI C;  3E2D A;  1XWH A;  4LKA A;  2C2L A;  4UP0 A;  4L58 A;  2KWN A;  1JM7 A;  2G6Q A;  2OXQ C;  5B8D A;  2YVR A;  1DCQ A;  4LLB A;  5SVY A;  2ECW A;  2LQ6 A;  1JM7 B;  2FSA A;  4GNG A;  3DDT A;  4I7D A;  3MHS A;  2FFW A;  4GNE A;  3GL6 A;  3HCS A;  2UZG A;  2LXP C;  3LJU X;  5FEY A;  3O34 A;  3QZV A;  4FO9 A;  1Z6U A;  2CKL A;  3EB5 A;  4R7E A;  2LV9 A;  2YSM A;  4YBS A;  2M13 A;  2CKL B;  1ZBD B;  2KWJ A;  2B0O E;  2ECT A;  2L75 A;  4I7B A;  1WEM A;  2VJF A;  5TRB A;  2ECJ A;  3PUQ A;  2KE1 A;  2KKX A;  2VJF B;  1WEO A;  3HTK C;  5G0F A;  5LKT A;  2FUI A;  2RI7 A;  3NG2 A;  2NAA A;  5TBN A;  3ZVZ B;  3SOU A;  1HYJ A;  1BOR A;  2RSD A;  2CT2 A;  3U5O A;  4MSX A;  2XOZ A;  3LQJ A;  4GB0 A;  2VPG A;  1MBM A;  3SUB A;  5EYA F;  2KU3 A;  4AUQ B;  3PLW A;  4YAB A;  4QF3 A;  3O37 A;  1WES A;  2XOC A;  3H7H A;  2DX8 A;  3O36 A;  1HYI A;  3M62 A;  3HCT A;  2D8S A;  1LDK C;  4ZUX U;  2KWK A;  4FIP A;  5FB0 A;  4YAX A;  2CRW A;  2D8U A;  2E61 A;  2HDP A;  5D1L B;  1VYX A;  5LKU A;  3RTR B;  4UI9 B;  2I50 A;  4YC9 A;  2G45 A;  1RMD A;  2XB1 A;  1WFK A;  1K2F A;  2F42 A;  4N4F A;  5SVX A;  2MKE A;  3PUR A;  3ZTG A;  4YAT A;  2E6S A;  2LDR A;  2YW8 A;  4XI1 A;  2VPE A;  5B76 A;  4Z0O A;  4X3G A;  3ZPV 1;  1N87 A;  3M99 A;  2EOD A;  1WGM A;  1WEU A;  4V3K C;  5KH7 A;  4R2Y A;  2QIZ A;  3MDB C;  5D1M B;  4I7C A;  3N9O A;  5H1U A;  2LXH C;  2M1R A;  5AIU A;  4UP5 A;  4WA6 A;  2MA6 A;  2VPB A;  1G25 A;  3ZPV E;  4AP4 A;  3VK6 A;  3L1Z B;  3HCU A;  5LKX A;  3U5M A;  3EB6 A;  3V43 A;  1CHC A;  2MT5 A;  2QIC A;  1T1H A;  2YQM A;  5G05 B;  2PNX A;  2MUM A;  3RPG B;  3M7K A;  2F6N A;  2ECN A;  2YUR A;  1X4J A;  5B79 A;  2JMD A;  5I3L A;  3FAO A;  2YHN A;  3L1X A;  5B78 A;  2VP7 A;  1WEE A;  2EA6 A;  3M63 A;  3MHH A;  3N9M A;  3O33 A;  4QF2 A;  4F52 B;  2JRJ A;  3O47 A;  2K16 A;  2G43 A;  4PTB A;  1Z2Q A;  2VPD A;  2KIZ A;  3KNV A;  2YSJ A;  4Z0R A;  2CON A;  3T9K A;  5H9M A;  2EGP A;  2IQJ A;  2KFT A;  4YBT A;  1WEP A;  5SVI A;  2DSM A;  1VFY A;  4A0C D;  3N9P A;  4CA1 A;  3ASL A;  4ZQL A;  3SOW A; 
#chains in the Genus database with same CATH homology
 5DIN A;  4L7X A;  2E6R A;  4PPE A;  3FL2 A;  2HYE D;  2LGK A;  2VNF A;  3N9L A;  1DVP A;  2KRE A;  3O70 A;  4IC2 A;  3ZVY A;  5H1T A;  2LN0 A;  2Y1N A;  2LGL A;  1WEQ A;  4Q6F A;  3SOX A;  3U5P A;  2YHO A;  4B86 C;  2KGG A;  5FB1 A;  2MIQ A;  2YT5 A;  2MNZ A;  2Y43 A;  2YUC A;  2KYU A;  4N3W A;  1X4U A;  3SHB A;  2K1J A;  4ZDT A;  1IYM A;  3RPG C;  2ECV A;  1JOC A;  2QJ0 A;  5D1K B;  5KH9 A;  5JG6 A;  2K4D A;  3LRQ A;  4CCG X;  2CSY A;  2YU4 A;  5DKA A;  4V3L C;  1X4I A;  2KGI A;  2XEU A;  2PUY A;  2ZET C;  2ECG A;  2L43 A;  4AVX A;  4O64 A;  1MM3 A;  3I2D A;  2JMJ A;  1FBV A;  4B7Y C;  2LGG A;  3O35 A;  3T7L A;  3O7A A;  4LJN A;  5B77 A;  4YBM A;  4TKP B;  5AIT A;  4BBQ A;  3T6R A;  4FJC A;  4NN2 A;  5KH3 A;  1E4U A;  3ZNI A;  2F6J A;  2YQL A;  3L11 A;  1F62 A;  3KV5 A;  5TAB A;  5H1V A;  1WEV A;  5C11 A;  2L80 A;  3KV6 A;  2C2V S;  5TDR A;  2MD7 B;  2L0B A;  1MM2 A;  3PHD A;  1WEW A;  3LQH A;  2M85 A;  5LCW B;  4R8P K;  2KWO A;  2H0D A;  2AN6 A;  4FK5 A;  4IC3 A;  2M6M A;  4GND A;  3N9N A;  2H0D B;  4S3O B;  1LDJ B;  1FP0 A;  4WZ0 A;  2Y1M A;  3DPL R;  1WIM A;  2MNY A;  4A49 A;  1V87 A;  3C6W A;  5G04 B;  3DQV R;  2MD8 C;  2IDA A;  5B75 A;  1VD4 A;  4WZ3 B;  1Z60 A;  3LQI A;  2YRE A;  5FER A;  2KR4 A;  2CSZ A;  4W4U A;  3IHP A;  2K17 A;  4A4B A;  4BHW A;  5LKZ A;  2YYR A;  2L5U A;  3KQI A;  4YAD A;  1U6G B;  2JMI A;  4GNF A;  5C13 A;  2LGV A;  4P5O B;  4LK9 A;  1WEN A;  3ZYQ A;  4C9Z A;  2BAY A;  5TDW A;  3GV4 A;  4AYC A;  3U5N A;  2ECI A;  2MA5 A;  4AYC B;  4A4C A;  1WIL A;  2VJE A;  4LAD B;  4WZ2 A;  1WE9 A;  2VJE B;  3C5K A;  2M3H A;  4MVT A;  3N9Q A;  5J3X A;  4S3O C;  2FUU A;  2LRI C;  1XWH A;  4LKA A;  2C2L A;  4L58 A;  2KWN A;  1JM7 A;  2G6Q A;  2OXQ C;  5B8D A;  4LLB A;  2ECW A;  2LQ6 A;  1JM7 B;  2FSA A;  4GNG A;  4I7D A;  3MHS A;  4GNE A;  3GL6 A;  3HCS A;  2UZG A;  3ASL A;  2LXP C;  5FEY A;  3O34 A;  3QZV A;  4FO9 A;  1Z6U A;  2CKL A;  3EB5 A;  4R7E A;  2LV9 A;  2YSM A;  4YBS A;  2CKL B;  1ZBD B;  2KWJ A;  2ECT A;  2L75 A;  4I7B A;  1WEM A;  2VJF A;  5TRB A;  2ECJ A;  3PUQ A;  2KE1 A;  2VJF B;  1WEO A;  3HTK C;  5G0F A;  5LKT A;  2FUI A;  2RI7 A;  3NG2 A;  2NAA A;  5TBN A;  3ZVZ B;  3SOU A;  1HYJ A;  1BOR A;  2RSD A;  2CT2 A;  3U5O A;  4MSX A;  3LQJ A;  4GB0 A;  2VPG A;  5EYA F;  2KU3 A;  4AUQ B;  4YAB A;  4QF3 A;  3O37 A;  1WES A;  2DX8 A;  3O36 A;  1HYI A;  3M62 A;  3HCT A;  2D8S A;  1LDK C;  4ZUX U;  2KWK A;  4FIP A;  5FB0 A;  4YAX A;  2HDP A;  5D1L B;  1VYX A;  5LKU A;  3RTR B;  4UI9 B;  2I50 A;  4YC9 A;  2G45 A;  1RMD A;  2XB1 A;  1WFK A;  1K2F A;  2F42 A;  4N4F A;  3PUR A;  3ZTG A;  4YAT A;  2E6S A;  2LDR A;  4XI1 A;  2YW8 A;  2VPE A;  5B76 A;  4X3G A;  3ZPV 1;  1N87 A;  3M99 A;  2EOD A;  1WGM A;  1WEU A;  4V3K C;  5KH7 A;  4R2Y A;  2QIZ A;  5D1M B;  4I7C A;  3N9O A;  5H1U A;  2LXH C;  2M1R A;  5AIU A;  4UP5 A;  4WA6 A;  2MA6 A;  2VPB A;  1G25 A;  3ZPV E;  4AP4 A;  3VK6 A;  3L1Z B;  3HCU A;  5LKX A;  3U5M A;  3EB6 A;  3V43 A;  1CHC A;  2MT5 A;  2QIC A;  1T1H A;  2YQM A;  5G05 B;  2PNX A;  2MUM A;  3RPG B;  2F6N A;  2ECN A;  2YUR A;  1X4J A;  5B79 A;  2JMD A;  5I3L A;  2YHN A;  3L1X A;  5B78 A;  2VP7 A;  1WEE A;  2EA6 A;  3M63 A;  3MHH A;  3N9M A;  3O33 A;  4QF2 A;  4F52 B;  2JRJ A;  2K16 A;  2G43 A;  4PTB A;  1Z2Q A;  2VPD A;  2KIZ A;  3KNV A;  2YSJ A;  5H9M A;  2EGP A;  2KFT A;  4YBT A;  1WEP A;  1VFY A;  4A0C D;  3N9P A;  4CA1 A;  4UP0 A;  4ZQL A;  3SOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...