2EGMA

Solution structure of the zf-b_box domain from human tripartite motif protein 41
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
b'GSSGSSGTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 41
publication title Solution structure of the zf-B_box domain from human Tripartite motif protein 41
rcsb
source organism Homo sapiens
molecule tags Transcription/metal binding protein
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2egmA00
2EGMA 3DDTA 2DJAA 2JUNA 2YVRA 3Q1DA 5K3QA 2CSVA 2D8UA
chains in the Genus database with same CATH superfamily
2IQJA 2MNYA 4P5OB 3O33A 2F42A 2KWKA 2KIZA 1X4JA 2XEUA 1WILA 2CSYA 2FSAA 3DDTA 5C11A 2LGLA 2VJEA 1WEEA 2JMDA 1HYJA 1G25A 2CKLA 5LKZA 4LKAA 2KGIA 4CCGX 2E6RA 4ZUXU 1VFYA 5B75A 4YC9A 1WESA 2FUIA 4YAXA 3H7HA 4GNGA 2L80A 1WFKA 2OWAA 3FEHA 3T7LA 4YBMA 2YQMA 2EA6A 3KV5A 5FERA 3LRQA 2YW8A 4GNEA 3T6RA 1WEUA 1T1HA 1WGMA 5LKUA 2F6NA 2QJ0A 2YHOA 5B78A 3FM8C 3L1ZB 1MM2A 2JRJA 5TDRA 2M6MA 5DKAA 2ECVA 3MDBC 2KGGA 4IC2A 5FB1A 2G6QA 4B86C 1X4UA 2KE1A 2YURA 2JUNA 3ZVYA 4AUQB 2FFWA 2YQLA 2M85A 1VYXA 2YU4A 1WEOA 3N9LA 3KV6A 2VJFA 4X3GA 1MM3A 3LVRE 2MA6A 2CRWA 2QIZA 3DPLR 2XOZA 2EODA 4TKPB 5FEYA 3O7AA 5D1MB 4A0CD 5AITA 1WEQA 2D8SA 3MHSA 2M3HA 2KYUA 2EGPA 2VPDA 3GL6A 2DX8A 2VPGA 4OGCA 4I7BA 3RPGC 3SOWA 3PLWA 2ZETC 4ZDTA 3O36A 1CHCA 4BBQA 1WEPA 1WEMA 1E4UA 2K16A 1XWHA 4CA1A 3HTKC 3Q1DA 2LXHC 5JG6A 2OXQC 4YADA 2CONA 4O62A 4WZ2A 3MHHA 3SHBA 4BHWA 3O35A 3ASLA 2C2LA 2CSZA 1WE9A 3LQJA 5H1UA 4PPEA 1Z60A 5G04B 3SUBA 1RMDA 5D1KB 3FL2A 4I7CA 3EB5A 4LK9A 4AVXA 3SOXA 1WEWA 4MSXA 2P57A 2E6SA 2MD8C 5TDWA 5D1LB 2KR4A 4FO9A 2KWJA 2EXUA 2DSMA 2PNXA 4A4BA 1JM7B 2K17A 3V43A 2FD4A 2YUCA 3KDEC 4S3OC 4Z0OA 3LDYA 2C2VS 4N4FA 4A49A 3N9NA 4N3WA 5KH3A 1V87A 3DQVR 2RSDA 2ECNA 3M63A 5KH9A 1X4IA 3N9QA 3M62A 2VNFA 5B79A 3O37A 4YBSA 3JUEA 5C13A 1HYIA 5G05B 2MNZA 4OGEA 2M13A 1N87A 4YATA 2ECGA 2MD7B 2CKLB 3RPGB 1ZBDB 2YHNA 3FANA 3FAOA 5LKTA 2H0DB 2QICA 4Z0RA 5LCWB 4FK5A 4C9ZA 2XOYA 4YABA 2YSJA 2L5UA 3DWDA 3KQIA 3LVQE 2LGVA 3U5OA 3L11A 3NG2A 2LRIC 3M99A 3C6WA 4F52B 4QF2A 2D8UA 1WIMA 2ECWA 2E61A 3KNVA 4I7DA 3PURA 2IDAA 3N9OA 4V3LC 4AYCB 2VPBA 3O47A 3LQHA 2XP0A 1Z6UA 2VJFB 4R7EA 2FUUA 4B7YC 5KH7A 4AP4A 3U5PA 1WEVA 1Z2QA 4L58A 2KU3A 5H1TA 2M1RA 2RI7A 1FBVA 5DINA 4R8PK 2CT2A 2L7PA 2YVRA 2LDRA 3EB6A 4S3OB 3HCSA 4V3KC 2LV9A 5G0FA 2MA5A 1JM7A 2VP7A 2MUMA 5SVIB 2L75A 4F1PA 3VK6A 4R2YA 2KKYA 3ZTGA 3T9KA 3LJUX 2MIQA 4GNFA 3ZVZB 5B77A 2KKXA 2NAAA 2UZGA 3ZNIA 5H1VA 3ZPVE 5B8DA 2LN0A 2CRRA 2LGGA 2LGKA 4UI9B 2Y1MA 4LJNA 1U6GB 2DJAA 5B76A 5J3XA 1JOCA 2VPEA 2AN6A 2HDPA 4UP0A 4UP5A 2H0DA 2XOCA 4O64A 1DVPA 4QQ4A 4LLBA 2ECJA 4MVTA 2YSMA 3HCUA 4FJCA 4WZ3B 4PTBA 2LAUA 5K3QA 4WA6A 4ZQLA 2VJEB 1DCQA 2G45A 2YT5A 3E2DA 5LKXA 3FJUB 2MKEA 3QZVA 1MBMA 2I50A 1F62A 2ECIA 2KFTA 5EYAF 5TRBA 5TBNA 5FB0A 3ZYQA 4QF3A 3PHDA 2EGMA 3L1XA 3GV4A 4XI1A 3U5MA 4AYCA 4LADB 5SVYA 2KWOA 2CSVA 2Y1NA 2HYED 3ZPV1 3C5KA 3N9MA 4L7XA 2ECTA 2B0OE 2XB1A 2BAYA 4GNDA 3LQIA 2KREA 1WENA 2KWNA 4GB0A 3HCTA 3O70A 3IHPA 2MT5A 3I2DA 1LDKC 2LXPC 4YBTA 2K4DA 5SVIA 1K2FA 5SVXA 4A4CA 1IYMA 3O34A 3PUQA 4WZ0A 1LDJB 2JM3A 4FIPA 1VD4A 3N9PA 3M7KA 2RR4A 2PUYA 4H9DA 4NN2A 2G43A 2K1JA 5AIUA 2YREA 2F6JA 2JMIA 4W4UA 5I3LA 3U5NA 2JMJA 3SOUA 2L0BA 1FP0A 4Q6FA 4IC3A 2YYRA 5H9MA 3RTRB 5TABA 2LQ6A 2Y43A 1BORA 2L43A
chains in the Genus database with same CATH topology
2EGMA 2IQJA 2OWAA 2FD4A 3FEHA 4OGEA 3O47A 2LAUA 2DJAA 2JUNA 3Q1DA 5SVYA 5SVIB 4Z0OA 5K3QA 3SUBA 4F1PA 3LDYA 3KDEC 2KKYA 2M13A 2CSVA 5SVIA 2XP0A 3T9KA 2FFWA 2CONA 4O62A 5SVXA 3DDTA 1DCQA 3LJUX 3LVQE 3E2DA 2JM3A 3M7KA 2D8UA 3FJUB 2MKEA 4OGCA 2P57A 2RR4A 2E61A 4Z0RA 3PLWA 2B0OE 2KKXA 3LVRE 4H9DA 2XOCA 3FM8C 4QQ4A 2XOYA 2CRWA 2EXUA 2XOZA 2CRRA 2L7PA 2YVRA 3MDBC 3JUEA 2YREA 3DWDA 3H7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGM A;  3DDT A;  2DJA A;  2JUN A;  2YVR A;  3Q1D A;  5K3Q A;  2CSV A;  2D8U A; 
#chains in the Genus database with same CATH topology
 2IQJ A;  2MNY A;  4P5O B;  3O33 A;  2F42 A;  2KWK A;  2KIZ A;  1X4J A;  2XEU A;  1WIL A;  2CSY A;  2FSA A;  3DDT A;  5C11 A;  2LGL A;  2VJE A;  1WEE A;  2JMD A;  1HYJ A;  1G25 A;  2CKL A;  5LKZ A;  4LKA A;  2KGI A;  4CCG X;  2E6R A;  4ZUX U;  1VFY A;  5B75 A;  4YC9 A;  1WES A;  2FUI A;  4YAX A;  3H7H A;  4GNG A;  2L80 A;  1WFK A;  2OWA A;  3FEH A;  3T7L A;  4YBM A;  2YQM A;  2EA6 A;  3KV5 A;  5FER A;  3LRQ A;  2YW8 A;  4GNE A;  3T6R A;  1WEU A;  1T1H A;  1WGM A;  5LKU A;  2F6N A;  2QJ0 A;  2YHO A;  5B78 A;  3FM8 C;  3L1Z B;  1MM2 A;  2JRJ A;  5TDR A;  2M6M A;  5DKA A;  2ECV A;  3MDB C;  2KGG A;  4IC2 A;  5FB1 A;  2G6Q A;  4B86 C;  1X4U A;  2KE1 A;  2YUR A;  2JUN A;  3ZVY A;  4AUQ B;  2FFW A;  2YQL A;  2M85 A;  1VYX A;  2YU4 A;  1WEO A;  3N9L A;  3KV6 A;  2VJF A;  4X3G A;  1MM3 A;  3LVR E;  2MA6 A;  2CRW A;  2QIZ A;  3DPL R;  2XOZ A;  2EOD A;  4TKP B;  5FEY A;  3O7A A;  5D1M B;  4A0C D;  5AIT A;  1WEQ A;  2D8S A;  3MHS A;  2M3H A;  2KYU A;  2EGP A;  2VPD A;  3GL6 A;  2DX8 A;  2VPG A;  4OGC A;  4I7B A;  3RPG C;  3SOW A;  3PLW A;  2ZET C;  4ZDT A;  3O36 A;  1CHC A;  4BBQ A;  1WEP A;  1WEM A;  1E4U A;  2K16 A;  1XWH A;  4CA1 A;  3HTK C;  3Q1D A;  2LXH C;  5JG6 A;  2OXQ C;  4YAD A;  2CON A;  4O62 A;  4WZ2 A;  3MHH A;  3SHB A;  4BHW A;  3O35 A;  3ASL A;  2C2L A;  2CSZ A;  1WE9 A;  3LQJ A;  5H1U A;  4PPE A;  1Z60 A;  5G04 B;  3SUB A;  1RMD A;  5D1K B;  3FL2 A;  4I7C A;  3EB5 A;  4LK9 A;  4AVX A;  3SOX A;  1WEW A;  4MSX A;  2P57 A;  2E6S A;  2MD8 C;  5TDW A;  5D1L B;  2KR4 A;  4FO9 A;  2KWJ A;  2EXU A;  2DSM A;  2PNX A;  4A4B A;  1JM7 B;  2K17 A;  3V43 A;  2FD4 A;  2YUC A;  3KDE C;  4S3O C;  4Z0O A;  3LDY A;  2C2V S;  4N4F A;  4A49 A;  3N9N A;  4N3W A;  5KH3 A;  1V87 A;  3DQV R;  2RSD A;  2ECN A;  3M63 A;  5KH9 A;  1X4I A;  3N9Q A;  3M62 A;  2VNF A;  5B79 A;  3O37 A;  4YBS A;  3JUE A;  5C13 A;  1HYI A;  5G05 B;  2MNZ A;  4OGE A;  2M13 A;  1N87 A;  4YAT A;  2ECG A;  2MD7 B;  2CKL B;  3RPG B;  1ZBD B;  2YHN A;  3FAN A;  3FAO A;  5LKT A;  2H0D B;  2QIC A;  4Z0R A;  5LCW B;  4FK5 A;  4C9Z A;  2XOY A;  4YAB A;  2YSJ A;  2L5U A;  3DWD A;  3KQI A;  3LVQ E;  2LGV A;  3U5O A;  3L11 A;  3NG2 A;  2LRI C;  3M99 A;  3C6W A;  4F52 B;  4QF2 A;  2D8U A;  1WIM A;  2ECW A;  2E61 A;  3KNV A;  4I7D A;  3PUR A;  2IDA A;  3N9O A;  4V3L C;  4AYC B;  2VPB A;  3O47 A;  3LQH A;  2XP0 A;  1Z6U A;  2VJF B;  4R7E A;  2FUU A;  4B7Y C;  5KH7 A;  4AP4 A;  3U5P A;  1WEV A;  1Z2Q A;  4L58 A;  2KU3 A;  5H1T A;  2M1R A;  2RI7 A;  1FBV A;  5DIN A;  4R8P K;  2CT2 A;  2L7P A;  2YVR A;  2LDR A;  3EB6 A;  4S3O B;  3HCS A;  4V3K C;  2LV9 A;  5G0F A;  2MA5 A;  1JM7 A;  2VP7 A;  2MUM A;  5SVI B;  2L75 A;  4F1P A;  3VK6 A;  4R2Y A;  2KKY A;  3ZTG A;  3T9K A;  3LJU X;  2MIQ A;  4GNF A;  3ZVZ B;  5B77 A;  2KKX A;  2NAA A;  2UZG A;  3ZNI A;  5H1V A;  3ZPV E;  5B8D A;  2LN0 A;  2CRR A;  2LGG A;  2LGK A;  4UI9 B;  2Y1M A;  4LJN A;  1U6G B;  2DJA A;  5B76 A;  5J3X A;  1JOC A;  2VPE A;  2AN6 A;  2HDP A;  4UP0 A;  4UP5 A;  2H0D A;  2XOC A;  4O64 A;  1DVP A;  4QQ4 A;  4LLB A;  2ECJ A;  4MVT A;  2YSM A;  3HCU A;  4FJC A;  4WZ3 B;  4PTB A;  2LAU A;  5K3Q A;  4WA6 A;  4ZQL A;  2VJE B;  1DCQ A;  2G45 A;  2YT5 A;  3E2D A;  5LKX A;  3FJU B;  2MKE A;  3QZV A;  1MBM A;  2I50 A;  1F62 A;  2ECI A;  2KFT A;  5EYA F;  5TRB A;  5TBN A;  5FB0 A;  3ZYQ A;  4QF3 A;  3PHD A;  2EGM A;  3L1X A;  3GV4 A;  4XI1 A;  3U5M A;  4AYC A;  4LAD B;  5SVY A;  2KWO A;  2CSV A;  2Y1N A;  2HYE D;  3ZPV 1;  3C5K A;  3N9M A;  4L7X A;  2ECT A;  2B0O E;  2XB1 A;  2BAY A;  4GND A;  3LQI A;  2KRE A;  1WEN A;  2KWN A;  4GB0 A;  3HCT A;  3O70 A;  3IHP A;  2MT5 A;  3I2D A;  1LDK C;  2LXP C;  4YBT A;  2K4D A;  5SVI A;  1K2F A;  5SVX A;  4A4C A;  1IYM A;  3O34 A;  3PUQ A;  4WZ0 A;  1LDJ B;  2JM3 A;  4FIP A;  1VD4 A;  3N9P A;  3M7K A;  2RR4 A;  2PUY A;  4H9D A;  4NN2 A;  2G43 A;  2K1J A;  5AIU A;  2YRE A;  2F6J A;  2JMI A;  4W4U A;  5I3L A;  3U5N A;  2JMJ A;  3SOU A;  2L0B A;  1FP0 A;  4Q6F A;  4IC3 A;  2YYR A;  5H9M A;  3RTR B;  5TAB A;  2LQ6 A;  2Y43 A;  1BOR A;  2L43 A; 
#chains in the Genus database with same CATH homology
 2EGM A;  2IQJ A;  2OWA A;  2FD4 A;  3FEH A;  4OGE A;  3O47 A;  2LAU A;  2DJA A;  2JUN A;  3Q1D A;  5SVY A;  5SVI B;  4Z0O A;  5K3Q A;  3SUB A;  4F1P A;  3LDY A;  3KDE C;  2KKY A;  2M13 A;  2CSV A;  5SVI A;  2XP0 A;  3T9K A;  2FFW A;  2CON A;  4O62 A;  5SVX A;  3DDT A;  1DCQ A;  3LJU X;  3LVQ E;  3E2D A;  2JM3 A;  3M7K A;  2D8U A;  3FJU B;  2MKE A;  4OGC A;  2P57 A;  2RR4 A;  2E61 A;  4Z0R A;  3PLW A;  2B0O E;  2KKX A;  3LVR E;  4H9D A;  2XOC A;  3FM8 C;  4QQ4 A;  2XOY A;  2CRW A;  2EXU A;  2XOZ A;  2CRR A;  2L7P A;  2YVR A;  3MDB C;  3JUE A;  2YRE A;  3DWD A;  3H7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...