2EGMA

Solution structure of the zf-b_box domain from human tripartite motif protein 41
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
GSSGSSGTPGRGSRVTDQGICPKHQEALKLFCEVDEEAICVVCRESRSHKQHSVVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tripartite motif-containing protein 41
publication title Solution structure of the zf-B_box domain from human Tripartite motif protein 41
rcsb
source organism Homo sapiens
molecule tags Transcription/metal binding protein
total genus 6
structure length 57
sequence length 57
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00643 zf-B_box B-box zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.200 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2egmA00
2DJAA 2CSVA 2YVRA 5K3QA 2D8UA 3DDTA 2EGMA 2JUNA 3Q1DA
chains in the Genus database with same CATH superfamily
1X4IA 2FFWA 4R8PK 2L7PA 4WZ3B 2L80A 2MNYA 2XOCA 3O70A 5LKZA 3KV6A 2MNZA 1F62A 3H7HA 5AIUA 3ZPVE 2G45A 3O47A 5H1TA 2LGVA 3PLWA 3U5MA 2KWKA 2LAUA 3EB6A 1WESA 2MD7B 4F52B 1WIMA 3ASLA 1DVPA 3O7AA 1HYIA 3N9LA 2MIQA 1Z2QA 5SVXA 3LQHA 4ZQLA 2VPBA 3N9MA 1X4UA 3PHDA 5FB0A 2YYRA 2EODA 2FSAA 2FD4A 1WILA 4ZUXU 3LVQE 4PTBA 3MHHA 3O33A 1VYXA 4O64A 4S3OC 2JMIA 2LXHC 1WENA 2IQJA 2KE1A 3T6RA 5C13A 3FM8C 4IC2A 2IDAA 1N87A 2XP0A 4AVXA 2ECGA 4CCGX 4AYCB 4V3LC 2VPDA 1LDJB 4MVTA 4C9ZA 3HTKC 4WZ0A 4CA1A 4QQ4A 4GNGA 5B76A 4AYCA 3DPLR 2CKLB 5LKTA 1JM7B 4A4BA 4I7CA 3E2DA 2QIZA 1X4JA 2YURA 2LXPC 2ECNA 2K16A 2CKLA 3JUEA 1JM7A 2RI7A 2PNXA 3MHSA 5JG6A 2Y1NA 5I3LA 4N4FA 2KGGA 3N9PA 5FEYA 2UZGA 3MDBC 2B0OE 2VJEB 1FBVA 4BHWA 2HYED 3LQJA 4A49A 2VJEA 4FJCA 1V87A 2KKXA 4B86C 4R2YA 2AN6A 2YW8A 3O35A 2QICA 2L5UA 4FIPA 4YAXA 4FO9A 2BAYA 3N9QA 5LCWB 3SOXA 5LKUA 1WEUA 5LKXA 2K4DA 1WEVA 2NAAA 2YVRA 4LLBA 4A0CD 1WE9A 3U5PA 2E6SA 2JM3A 2D8UA 2ECJA 3NG2A 3FEHA 1WEOA 3PURA 3GV4A 3FL2A 1CHCA 5SVIB 4XI1A 1WEEA 5SVIA 4X3GA 4GNFA 2G43A 3O34A 1K2FA 4I7DA 2ECIA 4UP5A 2FUIA 5G04B 1HYJA 3N9OA 4L7XA 2L43A 4PPEA 2I50A 4WA6A 4MSXA 3T9KA 4L58A 2KFTA 1RMDA 2KYUA 5B8DA 4F1PA 2YQMA 2XOZA 4QF2A 3U5NA 4UI9B 3VK6A 2E61A 1G25A 2QJ0A 2OWAA 5EYAF 4NN2A 4H9DA 1JOCA 5B75A 4WZ2A 1WGMA 4YATA 2KR4A 2VPGA 2VPEA 1Z6UA 2LGGA 2C2VS 2LDRA 5D1LB 2YU4A 3M7KA 2KGIA 2KWNA 2YSJA 2K17A 2YREA 2CSVA 2G6QA 3C6WA 5D1KB 5KH3A 2CSYA 1WEQA 2JMJA 1XWHA 3O36A 1E4UA 3L11A 2YUCA 2HDPA 1MM2A 1WEMA 2C2LA 3L1XA 1WEPA 3ZYQA 2KU3A 1VD4A 2LQ6A 2JRJA 2F6NA 1DCQA 4GB0A 2ECWA 5H1UA 2L75A 4LK9A 2RSDA 2FUUA 3U5OA 4LJNA 5G05B 4TKPB 1ZBDB 2MA5A 2YHNA 3KV5A 3GL6A 2KKYA 4AUQB 5TABA 2YHOA 3LDYA 3LJUX 2LN0A 5DINA 3FJUB 2XEUA 5D1MB 3ZVYA 4IC3A 3QZVA 3V43A 1MBMA 2VJFB 4LKAA 3FANA 2VJFA 3KQIA 1WFKA 2H0DB 3T7LA 3SOWA 2KREA 2ZETC 5FERA 5KH7A 2MUMA 4YBMA 3HCSA 4OGCA 3I2DA 2EGMA 5B78A 2RR4A 2F42A 3M99A 2KWJA 3SUBA 4GNEA 2LGLA 4R7EA 2XOYA 3M62A 4O62A 2ECVA 4LADB 4YBSA 2M85A 2Y43A 3L1ZB 2K1JA 3RPGC 3LQIA 1Z60A 3KDEC 1MM3A 5SVYA 2YT5A 2CSZA 1VFYA 5G0FA 2OXQC 3RPGB 3PUQA 2Y1MA 2M3HA 2EA6A 1T1HA 4UP0A 2L0BA 4I7BA 2KIZA 2PUYA 3ZTGA 4W4UA 2M1RA 5J3XA 2LV9A 2JMDA 4QF3A 3RTRB 3LVRE 5B79A 3IHPA 2EXUA 4YBTA 3HCUA 2CONA 2CRWA 4S3OB 4GNDA 3O37A 4YABA 2VNFA 2MT5A 2KWOA 5TDWA 3DDTA 2LGKA 4V3KC 1IYMA 4Z0RA 5DKAA 4BBQA 2P57A 4Q6FA 5TDRA 4P5OB 2DJAA 2E6RA 3DQVR 3ZVZB 3M63A 2XB1A 5KH9A 3EB5A 2MD8C 2MKEA 3ZPV1 2F6JA 3HCTA 4AP4A 5C11A 5H9MA 2YSMA 4Z0OA 2LRIC 3DWDA 4YC9A 2VP7A 2MA6A 4B7YC 3SOUA 2JUNA 2M6MA 3Q1DA 2ECTA 2D8SA 2DX8A 5K3QA 4N3WA 1BORA 3N9NA 4A4CA 2EGPA 1FP0A 5H1VA 3KNVA 3C5KA 1U6GB 4OGEA 3LRQA 5TRBA 5TBNA 2DSMA 2CRRA 3SHBA 5FB1A 4ZDTA 3ZNIA 2YQLA 5B77A 2CT2A 1WEWA 5AITA 3FAOA 1LDKC 2M13A 4YADA 2H0DA 4FK5A
chains in the Genus database with same CATH topology
2CRRA 4H9DA 3FJUB 2KKXA 2FFWA 3DDTA 3JUEA 5SVXA 4Z0RA 2XP0A 2EGMA 2JUNA 2P57A 2RR4A 5SVIB 3Q1DA 2DJAA 2L7PA 2XOCA 5K3QA 3SUBA 3T9KA 3LVRE 2FD4A 2XOYA 3LVQE 2EXUA 4O62A 3M7KA 3MDBC 5SVIA 2MKEA 2YVRA 4F1PA 3H7HA 2CONA 2CRWA 3O47A 2XOZA 3PLWA 4QQ4A 2KKYA 2IQJA 2M13A 2B0OE 2YREA 2LAUA 4Z0OA 2CSVA 2E61A 3DWDA 2JM3A 4OGEA 5SVYA 1DCQA 3KDEC 2D8UA 3FM8C 2OWAA 3E2DA 3LJUX 3LDYA 3FEHA 4OGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJA A;  2CSV A;  2YVR A;  5K3Q A;  2D8U A;  3DDT A;  2EGM A;  2JUN A;  3Q1D A; 
#chains in the Genus database with same CATH topology
 1X4I A;  2FFW A;  4R8P K;  2L7P A;  4WZ3 B;  2L80 A;  2MNY A;  2XOC A;  3O70 A;  5LKZ A;  3KV6 A;  2MNZ A;  1F62 A;  3H7H A;  5AIU A;  3ZPV E;  2G45 A;  3O47 A;  5H1T A;  2LGV A;  3PLW A;  3U5M A;  2KWK A;  2LAU A;  3EB6 A;  1WES A;  2MD7 B;  4F52 B;  1WIM A;  3ASL A;  1DVP A;  3O7A A;  1HYI A;  3N9L A;  2MIQ A;  1Z2Q A;  5SVX A;  3LQH A;  4ZQL A;  2VPB A;  3N9M A;  1X4U A;  3PHD A;  5FB0 A;  2YYR A;  2EOD A;  2FSA A;  2FD4 A;  1WIL A;  4ZUX U;  3LVQ E;  4PTB A;  3MHH A;  3O33 A;  1VYX A;  4O64 A;  4S3O C;  2JMI A;  2LXH C;  1WEN A;  2IQJ A;  2KE1 A;  3T6R A;  5C13 A;  3FM8 C;  4IC2 A;  2IDA A;  1N87 A;  2XP0 A;  4AVX A;  2ECG A;  4CCG X;  4AYC B;  4V3L C;  2VPD A;  1LDJ B;  4MVT A;  4C9Z A;  3HTK C;  4WZ0 A;  4CA1 A;  4QQ4 A;  4GNG A;  5B76 A;  4AYC A;  3DPL R;  2CKL B;  5LKT A;  1JM7 B;  4A4B A;  4I7C A;  3E2D A;  2QIZ A;  1X4J A;  2YUR A;  2LXP C;  2ECN A;  2K16 A;  2CKL A;  3JUE A;  1JM7 A;  2RI7 A;  2PNX A;  3MHS A;  5JG6 A;  2Y1N A;  5I3L A;  4N4F A;  2KGG A;  3N9P A;  5FEY A;  2UZG A;  3MDB C;  2B0O E;  2VJE B;  1FBV A;  4BHW A;  2HYE D;  3LQJ A;  4A49 A;  2VJE A;  4FJC A;  1V87 A;  2KKX A;  4B86 C;  4R2Y A;  2AN6 A;  2YW8 A;  3O35 A;  2QIC A;  2L5U A;  4FIP A;  4YAX A;  4FO9 A;  2BAY A;  3N9Q A;  5LCW B;  3SOX A;  5LKU A;  1WEU A;  5LKX A;  2K4D A;  1WEV A;  2NAA A;  2YVR A;  4LLB A;  4A0C D;  1WE9 A;  3U5P A;  2E6S A;  2JM3 A;  2D8U A;  2ECJ A;  3NG2 A;  3FEH A;  1WEO A;  3PUR A;  3GV4 A;  3FL2 A;  1CHC A;  5SVI B;  4XI1 A;  1WEE A;  5SVI A;  4X3G A;  4GNF A;  2G43 A;  3O34 A;  1K2F A;  4I7D A;  2ECI A;  4UP5 A;  2FUI A;  5G04 B;  1HYJ A;  3N9O A;  4L7X A;  2L43 A;  4PPE A;  2I50 A;  4WA6 A;  4MSX A;  3T9K A;  4L58 A;  2KFT A;  1RMD A;  2KYU A;  5B8D A;  4F1P A;  2YQM A;  2XOZ A;  4QF2 A;  3U5N A;  4UI9 B;  3VK6 A;  2E61 A;  1G25 A;  2QJ0 A;  2OWA A;  5EYA F;  4NN2 A;  4H9D A;  1JOC A;  5B75 A;  4WZ2 A;  1WGM A;  4YAT A;  2KR4 A;  2VPG A;  2VPE A;  1Z6U A;  2LGG A;  2C2V S;  2LDR A;  5D1L B;  2YU4 A;  3M7K A;  2KGI A;  2KWN A;  2YSJ A;  2K17 A;  2YRE A;  2CSV A;  2G6Q A;  3C6W A;  5D1K B;  5KH3 A;  2CSY A;  1WEQ A;  2JMJ A;  1XWH A;  3O36 A;  1E4U A;  3L11 A;  2YUC A;  2HDP A;  1MM2 A;  1WEM A;  2C2L A;  3L1X A;  1WEP A;  3ZYQ A;  2KU3 A;  1VD4 A;  2LQ6 A;  2JRJ A;  2F6N A;  1DCQ A;  4GB0 A;  2ECW A;  5H1U A;  2L75 A;  4LK9 A;  2RSD A;  2FUU A;  3U5O A;  4LJN A;  5G05 B;  4TKP B;  1ZBD B;  2MA5 A;  2YHN A;  3KV5 A;  3GL6 A;  2KKY A;  4AUQ B;  5TAB A;  2YHO A;  3LDY A;  3LJU X;  2LN0 A;  5DIN A;  3FJU B;  2XEU A;  5D1M B;  3ZVY A;  4IC3 A;  3QZV A;  3V43 A;  1MBM A;  2VJF B;  4LKA A;  3FAN A;  2VJF A;  3KQI A;  1WFK A;  2H0D B;  3T7L A;  3SOW A;  2KRE A;  2ZET C;  5FER A;  5KH7 A;  2MUM A;  4YBM A;  3HCS A;  4OGC A;  3I2D A;  2EGM A;  5B78 A;  2RR4 A;  2F42 A;  3M99 A;  2KWJ A;  3SUB A;  4GNE A;  2LGL A;  4R7E A;  2XOY A;  3M62 A;  4O62 A;  2ECV A;  4LAD B;  4YBS A;  2M85 A;  2Y43 A;  3L1Z B;  2K1J A;  3RPG C;  3LQI A;  1Z60 A;  3KDE C;  1MM3 A;  5SVY A;  2YT5 A;  2CSZ A;  1VFY A;  5G0F A;  2OXQ C;  3RPG B;  3PUQ A;  2Y1M A;  2M3H A;  2EA6 A;  1T1H A;  4UP0 A;  2L0B A;  4I7B A;  2KIZ A;  2PUY A;  3ZTG A;  4W4U A;  2M1R A;  5J3X A;  2LV9 A;  2JMD A;  4QF3 A;  3RTR B;  3LVR E;  5B79 A;  3IHP A;  2EXU A;  4YBT A;  3HCU A;  2CON A;  2CRW A;  4S3O B;  4GND A;  3O37 A;  4YAB A;  2VNF A;  2MT5 A;  2KWO A;  5TDW A;  3DDT A;  2LGK A;  4V3K C;  1IYM A;  4Z0R A;  5DKA A;  4BBQ A;  2P57 A;  4Q6F A;  5TDR A;  4P5O B;  2DJA A;  2E6R A;  3DQV R;  3ZVZ B;  3M63 A;  2XB1 A;  5KH9 A;  3EB5 A;  2MD8 C;  2MKE A;  3ZPV 1;  2F6J A;  3HCT A;  4AP4 A;  5C11 A;  5H9M A;  2YSM A;  4Z0O A;  2LRI C;  3DWD A;  4YC9 A;  2VP7 A;  2MA6 A;  4B7Y C;  3SOU A;  2JUN A;  2M6M A;  3Q1D A;  2ECT A;  2D8S A;  2DX8 A;  5K3Q A;  4N3W A;  1BOR A;  3N9N A;  4A4C A;  2EGP A;  1FP0 A;  5H1V A;  3KNV A;  3C5K A;  1U6G B;  4OGE A;  3LRQ A;  5TRB A;  5TBN A;  2DSM A;  2CRR A;  3SHB A;  5FB1 A;  4ZDT A;  3ZNI A;  2YQL A;  5B77 A;  2CT2 A;  1WEW A;  5AIT A;  3FAO A;  1LDK C;  2M13 A;  4YAD A;  2H0D A;  4FK5 A; 
#chains in the Genus database with same CATH homology
 2CRR A;  4H9D A;  3FJU B;  2KKX A;  2FFW A;  3DDT A;  3JUE A;  5SVX A;  4Z0R A;  2XP0 A;  2EGM A;  2JUN A;  2P57 A;  2RR4 A;  5SVI B;  3Q1D A;  2DJA A;  2L7P A;  2XOC A;  5K3Q A;  3SUB A;  3T9K A;  3LVR E;  2FD4 A;  2XOY A;  3LVQ E;  2EXU A;  4O62 A;  3M7K A;  3MDB C;  5SVI A;  2MKE A;  2YVR A;  4F1P A;  3H7H A;  2CON A;  2CRW A;  3O47 A;  2XOZ A;  3PLW A;  4QQ4 A;  2KKY A;  2IQJ A;  2M13 A;  2B0O E;  2YRE A;  2LAU A;  4Z0O A;  2CSV A;  2E61 A;  3DWD A;  2JM3 A;  4OGE A;  5SVY A;  1DCQ A;  3KDE C;  2D8U A;  3FM8 C;  2OWA A;  3E2D A;  3LJU X;  3LDY A;  3FEH A;  4OGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...