3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
4CCKA 2ECGA 3KV6A 4GD4A 2H0DA 5FB1A 4LLBA 2Q8DA 5J3XA 2RI7A 3O34A 3RPGC 2JRJA 2D8SA 5FZ9A 2CKLA 4B86C 4CCNA 2BAYA 2HDPA 5FZ7A 2YUCA 1IYMA 5LWBA 2VPBA 5LKZA 5KH3A 3LQJA 5FZMA 4URAA 4L58A 2E6SA 4TN7A 4FO9A 2IDAA 5D1LB 2LN0A 2OT7A 5F3GA 4GJZA 2LGVA 2W2IA 1MM3A 5A3TA 4YADA 5B79A 5FYHA 3O37A 5FYZA 5FYUA 5LCWB 5FZ1A 2KWKA 5FBJA 3U4SA 1VYXA 3ZVZB 4A4CA 2QICA 1U6GB 4YBSA 1WESA 2KWJA 2MUMA 5FZ6A 2Q8EA 3N9OA 5A1FA 5F3IA 4QXBA 4MVTA 5H9MA 4A0CD 3K3OA 1WEMA 2YPDA 4LK9A 5KH7A 3N9PA 2LGLA 3PTRB 4PTBA 5FXZA 2LV9A 4NUBA 3AL5A 5F37A 1ZBDB 5FP7A 4R2YA 4LJNA 3PUAA 4WZ3B 2XXZA 4R8PK 5FY9A 5FEYA 1LDKC 3VK6A 4V3LC 4EYUA 2MNZA 3DXTA 2G45A 4O64A 3ZPV1 5TABA 5FY5A 2KIZA 3O70A 5TRBA 3SOXA 3ZPOA 3HCTA 4UF0A 2CSZA 2LGGA 5B77A 1VD4A 3L11A 1JM7B 4CCLA 2YHOA 1LDJB 3U5NA 3MHSA 1WENA 2XB1A 2ECIA 4P5OB 2VD7A 5LY2A 2KGGA 2YSMA 4CCGX 2DX8A 3KV5A 3QZVA 5FV3A 2YQMA 4AVXA 3U5MA 2YBSA 3HTKC 2KE1A 2JMIA 5E6HA 5FYYA 2LDRA 5KR7A 3N9NA 5FZDA 5FPAA 2KREA 3PHDA 4XDPA 2L75A 1HYJA 5FXVA 4GNDA 4LKAA 2XEUA 2F6NA 2OQ7A 5FZ3A 5FZAA 5ANQA 2MD8C 4LITA 5G0FA 4A49A 2E6RA 3ASLA 5B76A 4AI9A 4ASKA 4YBMA 4V2VA 5F5IA 5A7PA 4QWNA 5FPVA 2LQ6A 2M1RA 3L1XA 4WZ2A 3AVSA 1T1HA 2L0BA 2KU3A 5FY7A 1X4UA 1F62A 2VPEA 3UYJA 4YBTA 2KWNA 5FZFA 4IC2A 3HCUA 1VFYA 4XI1A 4IC3A 5FZ4A 2OXQC 5F2SA 1JOCA 4YATA 5A7WA 4C9ZA 3LDBA 5FUNA 5A3NA 2JMDA 4Q6FA 2VPGA 4BHWA 4IGOA 4GNFA 3N9QA 5C13A 5LKUA 2YU4A 2OX0A 3T6RA 3LQIA 2WWUA 2YT5A 3M62A 4FIPA 3M99A 4PPEA 1XWHA 5D1MB 3PU3A 5KH9A 4HONA 5H1TA 5FP8A 5A1LA 4V2WA 4CCJA 2L43A 4GAZA 5FYCA 4N4FA 3KVAA 3KV4A 4AYCA 5FPBA 5FZOB 2KYUA 2OQ6A 5FZCA 4N3WA 4ZUXU 2MD7B 2QJ0A 3LQHA 5G04B 1WIMA 1MM2A 2LXPC 2C2VS 5AIUA 5FZ0A 4LIVA 2YREA 5FYVA 2VJFB 5A7OA 5FJKA 4X3GA 5TDWA 2LGKA 5B75A 4GB0A 5F2WA 4GNEA 3SOWA 5FPUA 2ECNA 5FZLA 5A3WA 2QIZA 5FWJA 5AITA 5A3PA 1VRBA 4LIUA 2Q8CA 3NJYA 4BBQA 3U5PA 2EGPA 3N9MA 2MNYA 2ECTA 4QU1A 2K17A 2GP3A 3PURA 5LKXA 3N9LA 2GP5A 1BORA 3AL6A 5FZOA 4NN2A 2K4DA 3ZVYA 1WEOA 5LKTA 4E4HA 3GV4A 2YBPA 4MSXA 5CEHA 5FB0A 1K2FA 5K4LA 1X4JA 5FY8A 2MIQA 4F52B 2C2LA 4EZ4A 2AN6A 3SHBA 3DQVR 4QF3A 3KQIA 4TKPB 1WFKA 5F3CA 2VJEB 2G43A 2VJFA 4AAPA 5DINA 4CA1A 5FP9A 4L7XA 5EYAF 1FP0A 2H0DB 3L1ZB 5LW9A 5FJHA 1WILA 1V87A 3DXUA 5FZGA 2WWJA 2CKLB 4Y3OA 2LRIC 4WA6A 3LRQA 5FZEA 1JM7A 3M63A 4Y33A 2EA6A 4DIQA 1WGMA 2G6QA 5FYTA 5FXWA 1WEVA 5FYSA 1DVPA 1G25A 5FYIA 4FK5A 4CUGA 3NG2A 1RMDA 2L5UA 4QX7A 3GL6A 3O35A 4S3OB 4WZ0A 1Z60A 4XDOA 4YAXA 2VPDA 2VJEA 1Z6UA 2Y43A 4B7YC 5H1VA 5FY4A 5FZKA 5FZBA 5IVFA 4LXLA 1X4IA 2YURA 5G05B 4UP0A 3AVRA 1N87A 2L80A 4C8DA 4CSWA 4R7EA 1WEUA 4I7DA 1CHCA 2ECWA 2RSDA 5F5CA 2KGIA 2KFTA 3HCSA 3K2OA 2XDVA 3RTRB 3O33A 3PUSA 2EODA 4A4BA 4IGQA 3EB5A 3OPWA 4BISA 2Y1MA 3PDQA 2JMJA 3ZLIA 5FZ8A 1WEWA 4D6RA 5B78A 3O36A 2M6MA 2XUEA 4IGPA 2FUUA 2ECJA 3PU8A 4UF0B 2F6JA 5IVCA 5F32A 2CT2A 3ZTGA 3DPLR 4EZHA 5IVYA 1WEQA 4Y4RA 3KV9A 3RVHA 2F42A 3T7LA 4GJYA 5FYBA 4V3KC 1E4UA 2K16A 4UP5A 4YABA 4CCOA 5A7QA 5A80A 3C6WA 2P5BA 5FZIA 5FERA 2FUIA 3PUQA 4QX8A 5FXXA 3SOUA 2VNFA 4CCMA 3IHPA 2KR4A 5DKAA 1HYIA 4BXFA 4QF2A 5B8DA 1WEPA 4S3OC 5C11A 5H1UA 4ZQLA 3V43A 3K3NA 3U5OA 5LY1A 3KNVA 3KVBA 4QXCA 5ISLA 3LD8A 3RPGB 5FPLA 5A7NA 4I7CA 2OS2A 3I2DA 2CSYA 4QXHA 5FWEA 2MA6A 2PNXA 4I7BA 2ECVA 4UI9B 5JG6A 2MT5A 5IVEA 5F39A 5D1KB 5FP4A 2FSAA 2HYED 5IVJA 4LADB 5IWFA 1FBVA 2Y1NA 4BU2A 1Z2QA 3OPTA 5A7WB 3C5KA 4DO0A 1WE9A 5F5AA 2UZGA 4HOOA 2YBKA 3ZYQA 2KWOA 5IW0A 4AUQB 3FL2A 2K1JA 2VP7A 4W4UA 5TDRA 5IVVA 3ZPVE 2YHNA 5TBNA 3EB6A 2PXJA 1WEEA 2YW8A 2I50A 4ZDTA 2XMLA 5FUPA 5FZHA 3MHHA 4GNGA 5F3EA 2YU2A 5FY0A 2M3HA 2M85A 4D6SA 2YSJA 2ZETC 2YU1A 2PUYA 4FJCA 3U78A 4D6QA 5A7SA 2MA5A 3ZNIA 4AYCB 5I3LA 2LXHC 4YC9A 2YQLA 5FYMA 5IVBA 2YYRA 5FY1A 3O7AA 4AP4A 5FP3A 2NAAA
chains in the Genus database with same CATH superfamily
1W6MB 3LQCA 2DU0A 3LCPA 4B1MA 2XVLA 2JRJA 2V1DB 2W95A 4R9DA 2AREA 3RKOA 4V1PA 5LRRA 2VPBA 4W6WA 2Q8OA 4UW4A 2UUBT 3BU7A 5FZMA 4URAA 2CRWA 1O4TA 2VCAA 1PM7A 4JAAA 2OT7A 1S2KA 5FYZA 5KXJA 2YGMA 3FUOA 2Z42A 4K6BA 1RIRA 2WQYA 4KQ7A 3FXDB 1EAH1 5H9MA 3S7EA 2ZXQA 3JCIA 3HKEE 1GNHA 3D4KA 3HBZA 4ARXA 1ODMA 2ZM0A 5FXZA 4KG0A 4URTA 1BBT1 2XWBB 2E9QA 4WM7A 3BALA 2X53S 3L11A 4IEQA 2PTFA 1PO22 1Q8VA 4Q0VA 3CLPA 4N90A 5EFUA 4LHLA 2VMHA 3AE1A 4AVXA 3EHKA 5IJRA 4COVA 3N5LA 3ZT7A 1G9DA 2WP9A 1RVF1 4XBFB 5CKMA 5HEHA 3OUHA 4LMJA 2UXBT 2F6NA 3O9XA 1HB2A 3PHMA 4UR9A 4HN9A 3BOWA 4RQPB 1YYNA 3TN93 5KX5E 1LVFA 2VMGA 1OEDA 3RJRA 1CR7A 1CZTA 3ZFFC 2KWNA 2PHFA 4D69A 3WDYA 1Z0PA 5AQHB 4A2UA 2QQVA 5BNOC 2Q0AA 1O4ZA 4IGOA 5KHKA 2K3WA 1RMU2 2UXDT 2HEWF 3QNUA 4DRVA 2I45A 3BK9A 3USUA 2HWE3 5JXIA 1R1A2 4CPBA 3ETVA 1VJ2A 1O3SA 4XCBA 1K5JA 2NR4A 5AC92 2LRPA 2KYUA 1SLTA 3OEAA 3AAAB 2IXHA 1ALYA 5K9YA 3UUNA 5CFCC 2YGLA 4GZ9A 1AL21 4PBPA 4QXHB 2XVGA 4N7UA 1SZBA 2JMHA 2ZMKA 3P3NA 4RHV2 4HSJA 2MEV3 3VBSB 2W2UA 4FOVA 4UXAA 3U3IA 1UY0A 4TV8E 5JSPA 2L9QA 3O1VA 3AA7B 2VPVA 3UTKA 3VDBA 1GWLA 4Q4Y1 3AYEA 1NXMA 2V73A 3KT1A 1W2NA 4HPKA 2ZLYA 5ABJC 2WMNA 4QPGB 5CYYA 2C2LA 2HKXA 4EZ4A 5J1XA 1MNEA 3KQIA 4TKPB 4XMIA 3T30A 4PQ9A 3TEWA 2P34A 3O4XE 4L7XA 4NUVA 3VLBB 2AUYA 3OBRA 2P4EA 3ZR5A 2Y6LA 2XP0A 4YM3A 3HT2A 3ZC1A 1MQTB 1XNDA 3OBAA 3C3VA 3A7MA 1A6CA 4E8DA 2X66A 5FXWA 2I0MA 2PHLA 4QGNA 2L5UA 5EWSA 4ORFA 4WZ0A 2XAGB 4F8HA 4BQ4A 4DR7T 2CDOA 2CDPA 1FOD3 3MPBA 4Z90A 3H8RA 2BG9B 1VBE2 3E2DA 3HKCE 4BA9A 2VTFA 1X4IA 4K0UA 3AVRA 4QXBB 4CSWA 1E5RA 1SDWA 5DQ0A 2VOVA 3O33A 1V9DA 4NPPA 1GYKA 2D5FA 2VECA 4IGQA 4YPJA 4LNVA 2WFF1 2W5FA 2AR6A 4OMDA 2BVBA 3T1MA 3RFRA 4O61A 4CYDA 4CEYC 2ZMNA 1FXZA 4ARYA 3D0SA 4ZHNA 5BR8T 1WEQA 3LVRE 2J47A 1FMD3 1KJLA 3HJRA 4I2OA 4K7JA 4C91A 4LBOA 1QDOA 3R84B 3OGSA 1OEDE 1EV13 3UJOA 2XASB 3ZXJA 1PZ8A 2RM21 2WS93 4TZ4C 2D5UA 2KR4A 3LK42 5C9AA 2WNVA 1UY4A 5BNNA 3CJIC 2DCZA 2XQYA 4LMLA 1XQNA 1LULA 4B4PA 3FHAA 1JHJA 2P37A 4CZSA 2R32A 1SE7A 1W0NA 3WLUA 3OCPA 4ILCA 1JU3A 3PVBB 2QBXA 3HNYM 1CAVB 4EIWA 3OSDA 2IQJA 4EOZB 2JDNA 1T98A 4AWDA 4Q0QA 2LHRA 4P08A 3VDAA 1ZZBA 5G05L 5A7WB 2ZGPA 4DMVA 3OGJA 2NMNA 3ES4A 5C4WC 5JMCA 1IS3A 2CY6A 5TDRA 4YW7A 3WG3A 5JIAA 4LMKA 2R7EB 5EYXA 1UX6A 3NAPC 2M3HA 3CU7A 4FXGB 1HS7A 2GN7A 2H89A 2CGPA 1OQDA 2QVSB 3VBUB 2CWYA 5IVBA 4AG4A 2M6IA 2D6KA 2C5KT 3MFCA 3NKTA 3PMSA 4XFBA 1D0XA 2EIBA 3VDCA 5L2LA 1IS4A 5JDBA 1UW8A 1UIKA 2YYOA 1VBC3 5J1GA 2BS2A 1Y64B 4SLIA 3LOIA 3H3UA 5A3TA 1UXZA 2CXFA 3V0BB 3AEGA 4I01A 4GWIA 3ZVZB 2QICA 4O4LE 3NSTA 4H7LA 4EYYR 1C3HA 3RZLA 4LO5B 4Z92B 5FPZA 3FFZA 2VVFA 2CAUA 3PUAA 1G8XA 1RUI3 2W9XA 1VIWB 5AFEA 1H8TB 2ZM6T 1AR82 4WNKA 1CD3G 4DR2T 3BQLA 1SPPA 5I91A 1WCRA 3FHIB 3HD8B 3OTOT 1PZ9A 2YHOA 1BKZA 3MHSA 3NBXX 3IBMA 3BQIA 3VKGA 3ACIA 3W5NA 3RYCE 3IPVA 3U5MA 3WNKA 4Y5TA 3H3AA 4U2AA 3BYWA 1YIPA 1GMMA 3EXUA 5CZKA 1CQ9A 2N9DA 2X0LB 4XJ9A 4PAGA 3AVSA 1REDA 3H8XA 3RYKA 3LSEA 2OXQC 4A7KA 3I2JA 4YFSA 3OOXA 5JOWA 5FKBA 1V9U3 3IKWA 2OA2A 2X5IB 5C6CA 1ZNPA 2JJ9A 1APNA 2FUPA 4ONUA 3T6RA 3ELNA 2YKSA 1UYZA 2ZHNA 1FV2A 3O1OA 3BTYA 4CU6A 4HVRA 5JQGE 5JDMA 3HOBA 2WN2A 3I59B 2WKKA 5FMOS 1BVVA 1R093 1M06G 3TLTA 3MZHA 4AHXA 2JDYA 3BB6A 3TLUA 2HH9A 1US3A 1YI9A 4ZUXU 4KHPT 3LBXA 4NO4A 2BKPA 5FYVA 3UNPA 3BUCA 2OUJA 4QQPA 3S30A 3LVQE 5F2WA 3MGUA 3KQ4B 5IT6A 1NWMX 5KHIA 3CJXA 3AZYA 4P5HA 2DWKA 1UY1A 3U5PA 4PF5A 5CIRA 3UGHA 5FLIA 2UUAT 5FO9B 4XFFA 1QJY2 2RS12 4AI1A 5CNAA 4Z8BA 1HFAA 1CX4A 1JYVA 2NMOA 2ZAAA 3ZC0A 2VMEA 3JBG2 5K4LA 5FR3A 3ZXAC 3IBPA 4COZA 1WFKA 4AVSA 1LRHA 2NOXA 3WCSA 5EYAF 1WR0A 3MF9A 4UVBB 3V5SA 3QB5K 5BNOA 2XWJB 3AMNA 3AKSA 5CVRA 4PLNA 3GJAA 1COV3 1ENXA 3O1UA 1RUJ2 1W6PA 4YJ3E 4BK5A 1KITA 5IHYA 5FYTA 1RHI2 3ZYGA 1WUVA 1FEWA 4QQ2A 2FBEA 3DF0A 4AQGA 2RJ2A 1N36T 3NJXA 5LHGB 5FZKA 2JG9B 1HNXT 3WNNA 4LXLA 2YURA 1AXKA 3UJQA 4ZS3A 2ECWA 3VN4A 2KFTA 2NLRA 3LFMA 4QPGC 2CMRA 4XE9A 2A71A 1EUTA 4A4BA 1VBE3 2C9AA 1K5MB 4BISA 4YG0A 4LO7A 1W2UA 1B35B 1AR61 4CUAA 2CT2A 1OLMA 4DNDA 1YEWA 2ZACA 2BEOA 2RMU1 1WLDA 5I0UA 2BZBA 4IV1C 5FYBA 4L9BA 1CAWA 1E4UA 1SCRA 1OOPA 1AR91 4IXLA 3SOUA 4UW6A 5C70A 2ZHKA 4JQTA 1YC61 1C28A 1W03A 4BCUA 3DYPA 2YPJA 3ZYMA 2GNMA 1UX4A 3AJZA 2FMDA 5JG6A 5IVJA 3WUDA 4Y24A 2HWC2 4Z1VA 1VBB3 2ZGSA 3J4UH 3B5MA 4DO0A 4X62T 4HOOA 2KWOA 1W8FA 3KBTA 1JTZX 4QB1A 2RS33 2LRKA 4FOWA 1XNBA 1NENA 2LTNA 3SLIA 4NROA 4D6SA 5D2AA 2WZ8A 2IC1A 4LUMA 4ZZ8A 5EPAA 1N47A 4DUVA 2VB6A 3PVOA 3I0QA 1QJX3 3NW4A 5IK5A 2HJIA 4H63V 2TNFA 3IF8B 1AYM1 2BNNA 4CEYA 4BH9A 2ZGUA 3B9IA 4KU7A 2TUNA 5DUUA 5FZ9A 3I2FA 4CPBD 1LKXA 4B86C 1J1LA 1ULCA 4CCNA 2BAYA 4O2AE 1IS6A 5LWBA 3POWA 1XRUA 3ZYJB 3N35A 4JYAT 2W00A 5SV5A 2JM3A 3FM8C 5T5LA 4AF9A 1JZ8A 1DYKA 4G63A 2BW8A 3CJIA 4BQ5A 2WWSA 5F3GA 4MXVA 4AXOA 1ZBE3 3OYZA 4IE4A 5LCWB 3U0ZA 4YXDA 3WW1A 3WY6A 3LA2A 1N34T 4AKHA 1VB2A 4JI0T 3PUZF 5LRSA 1O7FA 1GOFA 2RP4A 5DZEA 3RZGA 2LV9A 2A6ZA 5F37A 1PIV3 1MZ5A 2JDHA 5C4WA 1MIYA 2XJSA 1JODA 3QOPA 3NV4A 4YFWA 3S5AA 3U5NA 4AOCA 3GBFA 1IKQA 2HWD3 2B42B 4AK3A 4N9HA 2YQMA 2YBSA 3JD72 3BI3A 1N1SA 1UOGA 5CFDB 3E6BA 2XEUA 2OWAA 4Y1VA 1E7PA 3L8RA 1PO21 3HQXA 1I5PA 4W50A 1WBFA 5JREA 2QQOA 1ZP0A 5IK8A 4INDA 1ND3A 1HR0T 1X4UA 1ENRA 5LA9A 4FAHA 1O4YA 1WR6A 5FZFA 2XZEA 1LU1A 5JCTA 5L3DB 3Q5EA 5M4YA 3OYWB 1IHMA 1U5IA 4Z2WA 4MHCA 4P0AA 1JNRA 1YJKA 5JDQA 1H8TC 1S0BA 4GNFA 5GM0A 2WWUA 1KNZA 4A6SA 4NIIA 1KEXA 3IAQA 4JGYB 2LSYA 2BDEA 2V4AA 4LJHA 3VBHB 2DHRA 4PJLA 4C0HA 3OKQA 1XE8A 5JRCA 1RMU1 5JR2A 3NMBA 1UGOA 1UZ0A 1R1A1 4ILAA 1AZDA 1W6MA 3FAOA 5AC91 1F2NA 2W63A 3ABZA 5A3WA 5F5QA 5GZDA 3NJYA 4AVVA 2LRLA 3ZM8A 1J83A 4RHV1 4OI4A 3F2EA 4B3TT 2WDQA 1SHWB 3LDRA 3VKHA 3GV4A 2D98A 1YUDA 1K2FA 3SHBA 4GKJT 1K45A 1ZBA2 1RUG2 3TBDA 3PL0A 4YVWB 4ISQA 4LFAT 4NR1A 4JI8T 1NAEA 1OKOA 4HVOA 4XFAA 5FQ0B 4QDRA 2WIIB 5LW9A 3OUIA 2NZ9A 4HKOA 3CNAA 3AECA 1AJ3A 4PJYA 4WVMB 4P00B 3M63A 1BR0A 2H6BA 1KEYA 3LEGA 2G6QA 4XUPA 2VMCA 1X50A 2IXCA 2K0GA 4AGRA 1RMDA 3X29B 1I94T 2G4IA 3A4UA 1ZZ6A 5H1VA 1YFXA 2DTWA 3VR8A 1NG0A 2B8MA 4XBNA 2B1EA 2EALA 1EYBA 2VW2A 2P1BA 2KXLA 5DJQC 2KINB 1WEUA 5BV6A 4RQPA 3RTRB 4FFHA 1S0CA 2RS52 2VAUA 3R0RA 1VBE1 1XMQT 4CN4A 3CQGB 5GZEA 2WWVA 3RI5A 4OX9T 2OZ6A 3ZPYA 4LOSA 1WLCA 4IV3B 1X79A 2UUCT 2L3LA 3E5XA 5IVYA 4Y20B 1YO8A 4M3CF 3RVHA 1DLCA 1MVEA 3HNBM 4UP5A 5A7QA 5CG8A 4CE8A 3PJAJ 2B0OE 1MEC3 2ZEXA 1W04A 5ETWA 1JYWA 5AVAA 4RD7A 1DCQA 2JG9C 4UFLA 3M3EA 1QXJA 2AGSA 3UKTA 5KDMC 1GOGA 4G9SB 4QXHA 4EB6E 3TLVA 2WYSA 4MGSA 5F39A 2HYED 4WBBA 3VBSA 2R6GF 3GNEA 1RUD2 2Q1FA 1ZYBA 3HL6A 2CM0A 4K20A 5F5AA 2J1AA 5IW0A 3POGA 1RUH3 2RR12 4IEXA 5IVVA 2DJAA 4OUMA 3LFIA 5FUPA 3POIA 4HVQA 5ABFB 1KFYA 1GZWB 5F3EA 2XQ5A 2JEMA 4FJCA 4IL9A 4BJNA 4QPGA 3ZSMA 3ZMOA 3RQ0A 1PO13 1FATA 5KXEA 2YQLA 5FY1A 5HXCA 3POBA 4LT5A 4CCKA 5L3BB 1NCQB 1TG7A 4OQ9A 2ZGQA 4PIYA 2D8SA 4FPLA 1F15A 1MQTA 4IV1A 5ERLA 3ZXEA 2FDGA 1C8M2 4RSUA 5M0TA 2EA7A 3LQJA 4W6YA 1AX2A 2A9UA 4AYUA 4UI9L 4YADA 5FYHA 1OQEA 1ONAA 2KWKA 5FBJA 2Z2SB 4IUGA 4NIHA 2BG9A 1OUSA 2DI4A 2QGSA 4DXSA 1WCQA 1S0IA 4QXBA 2CAVA 1TME2 3AM2A 3MUY1 1XU2A 4QAWA 3FN9A 4FPFA 3ZYPA 3P6BA 2YEVC 3RHWA 1ZBDB 4R2YA 3FBMA 3MKDA 4TLFA 4N43B 1IJ5A 3N7JA 1W9WA 1CZVA 3O1HA 3ZEFB 2XM2A 3U37A 2ECIA 2YSMA 2EHOB 5LA2A 1KNPA 3UU4A 1AR81 3MICA 5LHHB 4AHZA 1I1EA 1LHOA 4OZOA 1GZTA 4YG3A 2VCMA 4DV2T 3FANA 1QF3A 5ACA2 4NIDA 3D8CA 3O1RA 4FTBA 5LMNT 1UL9A 1C8NA 2OA5A 2ADEA 3L1XA 2B46X 2W91A 3P4SA 5LXTE 4UT5A 5T55A 2KU3A 1PVC2 4ZXLA 1NLRA 2W3JA 4C1WA 2DCKA 4X1YE 2B9VA 1IGOA 2DVDA 3ETQA 5A7WA 1AVBA 5A3NA 2JMDA 4Q6FA 2ZAHA 1GWKA 4I43B 3C4ZA 1OD3A 5JZGC 2F4VT 3IAPA 1JH5A 1KFUL 5K7PA 4Q26A 3PU3A 5KH9A 3ZJ2A 3NL1A 4JC1A 4OK0A 3VBUA 4U2YA 4P9GA 2VVEA 2Y6JA 4QXCB 5CFDC 3THTA 5G04B 2XQRA 2BVMA 2JQKA 5FZ0A 4KI5M 4DUWA 5FJKA 4X3GA 2C5IT 3IHRA 3KF3A 3ZYRA 4GNEA 2J4GA 1HB4A 1US2A 3JUUA 4ZXEA 3VHRA 1LJ7A 4P9XA 5FFOC 2DLRA 3I4IA 3AL6A 3V0BA 2K4DA 3SS1A 3RS6A 1H2MA 4PJNA 2DCTA 4UBGA 3CVRA 2C26A 5CEHA 2MIQA 4YW5A 3T2PA 5LYJE 1UU6A 4JGYC 2ZPXA 4RR3C 1LTEA 2VJEB 1QJY1 2RS11 2P6CA 5KHHA 3IIIA 5CG9A 5KC5A 4F83A 3AEBA 1SDDB 2H0DB 4KHZF 1H8TA 3JBG1 2DWGA 3KSCA 4KMQA 2WWJA 1AJKA 5FRAA 2ID4A 3WF1A 2RPAA 4AEDC 2BG9E 4WBNE 4AQTA 4IERA 1HRV2 3RGLA 3AMHA 4LBNA 1GICA 4L2NA 2BERA 1BVP1 2VNRA 4DV0T 1RUJ1 4UXNB 3SXWA 2YV8A 1E5HA 4PIXA 3ZT5A 1LOFC 3U10A 4Q4V3 1RHI1 1REEA 4BOWA 3K2OA 3I9WA 3E22E 2V6XA 1ZRFA 2EICA 5D1IA 2ZM8A 3H8OA 3I2HA 2JMJA 1DGLA 5EJ3A 2IUBA 4IGPA 1H2NA 3K4AA 1YQ6A 5FO8B 4ZOLE 4EQVA 2PAKA 2BOJA 4Y4RA 2XL9A 4L0RA 2P17A 2YY1A 1NT0A 5FVKA 4HFIA 1VMFA 2RV9A 3I59A 1BQPA 4O4HE 5DQWA 3EDUA 1XYPA 1N32T 4ERRA 3CIHA 3QB5A 3NNJA 4ILUA 2E8IA 5HEUA 1WEPA 3C4WA 2XOCA 1YNAA 3K8PC 3ACHA 2AE9A 1R082 4M3CA 5HBAA 3T1LA 4MZUA 5I0TA 4AI8A 2FSAA 4QQLA 4UBHA 4A5XA 2WLQA 1JNZA 4CP0A 3N4MA 1WYCA 3TNPB 4KBZA 3MDBC 2MPFA 4HKAA 3D0JA 3VKOA 4KU8A 4LF8T 4IV3C 5JVDE 2X9HA 2HWC1 1SFPA 4XOGA 1HIXA 2Q1ZB 3AKQA 3KB5A 2IFRA 2YU2A 5AQKB 2N1GA 3G06A 3ZNIA 2LXHC 4PDWC 2ZJCA 1JOPA 2IVIB 3MACA 2PELA 2XSBA 1LGCA 1REFA 4FTEA 4U72A 3VL9A 4BMEA 1JYIA 1MMNA 5FB1A 5HWXA 3SH4A 1OQ1A 3O14A 4NUUA 4PW8A 3ZXFA 5J3XA 2X10A 4ISRA 4YSYA 1MS4A 2WQZC 4NAMA 2GH2A 1DG6A 1UKGA 2AC1A 3HR0A 1UXXX 5CISA 1F35A 1OVPA 3RWNA 2LW8A 3UT0A 4M01A 2JG9A 5LBBA 2UY9A 3RQWA 2ET7A 3WNMA 5A70A 4E2SA 1C1LA 1Z7S3 1W3XA 3AK0A 3GA8A 4JEUB 1K5MA 5FP7A 3T2OA 5FEYA 3N3HA 2N2NA 1NCQC 1UK5A 2CNAA 2WNUB 4A41A 3THDA 2VD7A 3GBGA 4CQIA 1AYN2 2VGDA 5C3PA 2JIGA 4LLOA 5EZYE 4EROA 4NHXA 5FPAA 3WNOA 4Q4W3 1J1JA 3A5XA 2JB8A 2VOTA 3PMEA 4ASKA 4OI2A 4V2VA 3JD71 4CRQA 1IZNB 3UYJA 1LHWA 2K48A 3TLWA 2CXLA 1ZRDA 4IC3A 2C5DA 5AQSB 2VURA 4AI3A 5LEKA 1RUF2 4C9ZA 2O8QA 4W6XA 3LDBA 2OPKA 3EBRA 4ZHQE 4OUEA 4MO3M 1W0PA 2YU4A 5D1MB 2EHOC 5DAXA 2D6LX 2RG4A 5AQMB 3E97A 4DPNA 1UO9A 4GMP1 1ZZ9A 2LSIA 1ULEA 3ACGA 2A6YA 5IFPA 3PE0A 5CFBA 4Y1UA 4Z0RA 4HFDA 1WIMA 1MM2A 3SUBA 4LF5T 4CP9A 4AL9A 3THCA 3OJBA 4CDUC 4B8EA 4YGCA 1MZ6A 2P9BA 5KHJA 2FCUA 2OV9A 5FZLA 3POJA 4YLZA 2G9ZA 2Y6GA 1CAUB 4BBQA 3R05A 1UYYA 2DUPA 4RYDA 3ZFEB 3POYA 2PTMA 3T09A 2NQYA 1W2AX 3WG2A 4MSVA 2X8KA 1U12A 1KD7A 2DFBA 5FY8A 5JH7E 3DQVR 1QJFA 1ASJ3 2VJFA 5FMCA 1BEV3 2GMPA 5DINA 4FI5A 3CQCB 1YI7A 4M0NA 5C8CB 4Q27A 1MS9A 2QQMA 5JZGA 1ZBA1 1RUG1 2WRAA 4OFZA 1JHNA 2W0GA 4NXMT 1SFNA 1O8PA 2NW8A 3OUJA 2ZM2A 3O35A 4RA0A 1H0BA 3K51A 1ULOA 2VKDA 4KUMB 5E89A 5KXCA 5CFDA 4H14A 5L9BA 4WV8A 2XONA 3LOBA 4IQPA 4UW5A 1GP6A 5I0RA 2RR4A 4Z0OA 1BHGA 4FXKB 4AQFA 4S2FA 3E6DA 4PK4A 2YDSA 1EUUA 3OPWA 3WEZA 5DQVA 1RITA 3CX7B 3OYWA 5FZ8A 3U11A 4KWJA 4XHBA 3H9AA 1C5IA 2JG8C 4XFGA 4RN5A 4Z2AA 5IVCA 1UOJA 2LT3A 2WO7A 3ZSLA 2RS51 5L9RA 4GJYA 4MLKA 3OPCA 4I0WB 3ZSTA 2QNKA 4JGYA 3VBHA 2XOZA 3ZFGB 3AE2A 4WM8B 1KRIA 2BKNA 1MACA 3I8TA 1RJ7A 1FPN3 2H0VA 4XZUG 4YRDA 4ZI3D 3U5OA 3MIDA 4YW4A 3FC0A 1VB4A 4B3NA 3ZSSA 2WNOA 5BMVE 2WZR2 2CSYA 3V56A 4OZXA 1ENSA 2MA6A 3DYMA 1KF6A 1DGWX 5D1KB 5FP4A 1G9CA 4R8HA 4BU2A 1Z2QA 3ZYIB 2Y6HA 2AYHA 1Q5OA 2ZGKA 4CU8A 3DPRB 5FOBB 2YG0A 2XQ4A 2VP7A 3RZMA 4JUYA 2VTXA 4LBQB 5BNQA 4QHOA 1LOFA 2VQTA 4NHMA 3ZR6A 4HWHA 4FP3A 1RUD1 4NWVA 5D8AB 4NE9A 4Q2FA 4B7EA 1GWMA 2MA5A 1DQ6A 2RR11 3B7MA 4DMWA 3LEIA 4LHNA 2Y64A 4FTSA 2FMYA 5C5UA 2YYRA 3V5UA 4CXYA 3SRZA 3GM8A 5FP3A 1RUE2 2EF6A 1X8MA 3P5BA 1OURA 5FQ0A 3M65A 2BQPA 2K24A 3M3QA 2PAEA 4F8AA 5EIYB 3BQKA 2LSJA 4LO4B 5IFTA 3VKMA 4H9RC 3AFKA 1UX5A 1C57A 2JUNA 2LN0A 1QJEA 3WQBA 3U4SA 2ZOEB 1C8M1 2Q8EA 5GALA 1EY2A 4DR1T 4MVTA 1WGPA 2KT9A 3K3OA 2HWF2 4CTEA 2I6HA 3T4HB 5JDHA 3ZYLA 4RS5B 4PK5A 2NTXA 3PVEA 4QKDA 2AENA 4ZEYA 1LOCA 3DEMA 2WB5A 5FKYA 4FOQA 4F1PA 3H37A 2G45A 1TME1 3ZN1B 4IV3A 2R043 1LDJB 4BYYA 1AR72 3I1AA 1W06A 1RXGA 1V6KA 1OPMA 3KV5A 3UT5E 1US7B 5DDJ3 1TZOA 2LDRA 1HN0A 1AHSA 3PJYA 3WNLA 2WN3A 2D3PA 4HZFA 2GAUA 2R0HA 2R0FA 4XUQA 5G0FA 1YHFA 2QDNA 3H3ZA 2RDRA 4IE5A 2GNDA 1QJU3 3I54A 2HWB2 2M1RA 5FREA 1QU0A 3PUIA 3AB3B 3PUHA 1UMHA 4HBNA 4Q8KA 5ACA1 5F2SA 2KNDA 3ACFA 2W1QA 5FUNA 1VBA3 2EIEA 2PHRA 5SVXA 4CP2A 4COFA 1W05A 1WW7A 2EXHA 1PVC1 2WBKA 1WD4A 1H1IA 4YVSB 2OZJA 1DYOA 3OYXA 3LZZA 2WNUC 4L97A 5ABFA 3C2UA 1GZWA 3T3YA 3ENRA 3KVAA 2X68A 5FZOB 2DSMA 2LROA 4JX0A 4KBBA 4XQ4A 4HKLA 2XY8B 2BBAA 1X82A 2C2VS 1YQ3A 1NCQA 4BZ4A 4MOAA 5TDWA 2XJRA 5T5JA 4BJMA 5A3PA 4XFIA 3ONLC 4GOUA 2Q8CA 2EGPA 4FFGA 1KDKA 3LA7A 1E57A 3PVNA 4QU1A 2K17A 3WD5A 2D44A 4AFAA 3WP5A 2IXLA 1LCLA 3W5MA 2XJQA 4A3ZA 3UU6A 3AEAA 2LJLA 5DZFA 3LJUX 4F52B 2R072 4GWMA 4Y22A 1C1FA 1JYXA 2WL1A 4RFRB 5F3JA 4OMCA 4EN0A 4CA1A 5C5TA 4BB3A 5JUVA 1O91A 4XF1A 4ZZ5A 1UY2A 2XOMA 4XBLA 2VE1A 4CCDA 1O3RA 2GNBA 4WM7C 2JDMA 1JZ5A 5JDFA 2QKDA 4AW7A 1Y7BA 1DZQA 2JDPA 2VL0A 3HT1A 4OHZA 4X6RB 3CMGA 1L0VA 2EA6A 3NWKA 2EHOA 1UIJA 4QDSA 4C1XA 4QM9A 3W59A 3PUXF 4IE7A 4IETA 1YRZA 3ZT6A 4OUSA 4U36A 1VBD2 1POV0 1V6LA 3PLQA 2Y48B 5LBEA 2QUOA 2VZPA 1HRV1 3ZFEC 1Q43A 1SFYA 2MTQA 4I7DA 2GC0A 2VZOA 2JDZA 2L9LA 3NWIA 2BS3A 2DU1A 1NA1B 1OEDC 3AJYA 3GHNA 3FLRA 1SA0E 2XUEA 2YDRA 2IC6A 1CPNA 2Q9QB 5A33B 3ZMUB 3ST7A 3EDVA 3ECQA 3LE0A 4QH4A 1EAH3 4V3KC 3SCFA 1X33A 3J8F2 1BBT3 5LP6E 3UKNA 1U4QA 2CHNA 3GZAA 3HVDA 1R8IA 3J7HA 4ZQLA 4QXCA 5HEOA 5JXGA 3Q8EA 5J48A 2WLPA 1SLLA 3AE7A 3CX6B 4OYJA 4G4FA 3DYOA 3SCGA 2OW4A 4M4RA 5CU1A 4XF9A 1AJOA 1G7YA 1U0AA 3VU7H 1JS9A 1RVF3 2A5ZA 4A6OA 4W4UA 4PI2A 3WOGA 4YZ3A 1R081 3ZYHA 1SCSA 3SC7X 4XUNA 1KGYA 1H8VA 2YSJA 3NVOA 2CEAA 4PK6A 4IL7A 2E51A 5H9SA 1O3TA 4GH4C 3RMXA 2IXIA 2VC9A 3ZFGC 2NW9A 1H2LA 1JOJA 2PLV2 5JVVA 1WW4A 3WCRA 4AP4A 2XHEB 2ZHMA 1LB2A 3AEEA 3MA9A 1QY4A 3Q5DA 3UUXB 2H0DA 3S4UA 3N7MA 4ATEA 5H9RA 3ORJA 5LGUB 3SFEA 1FIOA 2Y6KA 4WZFA 4NVPA 3SITA 4CCCA 4OGCA 1Y9QA 3AE6A 2CA5A 4L58A 4BQ1A 4K8RB 4FO9A 4D7YA 3JC6C 4LK7A 3DPRC 1VAMA 4YGEA 1F4AA 1AL23 2ENRA 2JDAA 3ZKYA 3Q8FA 3SQOA 1VYXA 2VOWA 3WP4A 5E8AA 2JKXA 5A1FA 2LGLA 3RJ2X 4FQ4A 1GP4A 1GQEA 4CCEA 2XH6A 4X65T 5K0UB 3L39A 4Q4Y3 4IL4A 3T0BA 1J3RA 5B77A 2LUWA 2X09A 2IHR1 2BWAA 1QMJA 2A3DA 3LEKA 3QZVA 4O8SA 4O62A 2YZ4A 4NXNT 1OVSA 2VASA 4QX7B 3HTKC 3S6PA 1G6NA 2ZMAA 2QE3A 1D0ZA 1W0OA 2OQ7A 1W6QA 5EK2A 2WNVC 2MD8C 4LULA 1AYN1 2WM9A 4AI9A 2NTYA 2OLTA 1QEXA 2FQPA 4Q1PA 4HFCA 2D0UA 2XQAA 5K3QA 2VZQA 3VZNA 4MGQA 1CHUA 4AHYA 3AX4A 4IEOA 2F4LA 2BRTA 5FZ4A 5J2TE 3LGRA 3U07A 2X9XA 2VPGA 2WQ8A 1CVNA 2WAOA 4AAXA 3B57A 3ILFA 1S0FA 2JDUA 4RGGA 3B93A 5LB6A 5F8PA 1HLCA 5AQIB 3IB3A 3O1JA 1RUF1 2QQIA 3VUOA 4UVCB 1ZHCA 4QX8B 4GYSA 4A97A 2O0OA 4XC9A 2A72A 2WFF3 4JDMA 1ZZCA 3AP6A 5JPMB 1XNCA 2VWAA 2EAKA 2PHUA 4RGKA 5A6QA 5T50A 5GJ6A 5A6YA 1TMF2 4Q0PA 4CDWB 2W1SA 4XIKA 1YIFA 2V5DA 4DV4T 2QTWB 3T8OA 3A8YC 4LBLA 3DTOA 5AFUL 1HXS2 2RM23 1W8UA 3LJCA 4K3UA 2ZX0A 4CU9A 3BIEA 3CQXC 5LKTA 3NNGA 1NXD1 1LGBA 5FTTC 3BTXA 4CU7A 4EGWA 1LODA 2G43A 3AKTA 2VNVA 2R6QA 1IBLT 4QQHA 4H9QC 2RJLA 1IAPA 5H9PA 3CF6E 2BTVC 4XDQA 1CWPA 3DXUA 1J58A 3GJBA 5IHRA 1WLXA 2X29A 2WAUA 1W3VA 2WNUA 4WVWA 3LDYA 3WQ0A 1WGMA 2PG8A 5FYSA 1AL0G 3NG2A 1W9YA 4NHYA 1T72A 2NN8A 5J0ZA 2J1UA 1XBFA 2HEYF 1EPZA 5C71A 1OI6A 4XXAA 3NRXA 3MI8A 4Z82A 4YW1A 2G1MA 2W61A 4I3PA 3MIGA 3T2TA 5I0DA 2RSDA 3PJAA 4ANJA 4S2GA 2BWCA 3NNFA 3CQOA 1KQRA 3IIAA 4XQDA 2EODA 4W65A 3LK2B 3AP4A 4W4ZA 5LOVE 2V5YA 4D6RA 3W20A 1WD3A 2XQ8A 3FZFB 3UGGA 2LLYA 4LMFA 5C3OA 2F42A 2BPA2 3T7LA 1W8ZA 3I9YA 5T3NA 3M3OA 2ACZA 2QZ3A 3A21A 4N53B 2RVAA 1VCSA 2DBIA 5FXXA 3DL3A 4OHWA 3OJAA 1V00A 2XJVA 5LY1A 3WZ1A 4CUBA 3E6CC 3RPGB 5FMDA 4QWNB 3MFAA 1ZZ8A 4G2AA 3AXEA 4MXWB 2VKHA 1D1CA 4X8PA 5CBLA 2DL1A 1OA2A 3AA6B 1KDMA 2HBTA 1O3QA 1WE9A 2FDFA 5IAVA 1CAUA 4AUQB 2WZR1 5DABA 4L92A 3I3DA 5LBCA 3NRUA 4KG8A 3GZUC 2YW8A 3MJXA 1AUYA 2Q9QC 3ZFEA 3AP7A 1DU2A 5GLVA 1BYHA 5FY0A 2PUYA 2PA7A 4BQYA 3RRCA 1UQXA 1H6YA 2J1RA 4FCAA 4UFJA 4DNYA 4GWJA 3ZO0B 3POFA 2BGOA 5T5PA 4HEAA 5BNPC 4J2CA 2BDRA 3ZYKA 4XUTA 4DV6T 1QKQA 2IC9A 2WSUA 5IAXA 3B00A 2R062 5J7MA 3C7OA 2IXKA 1RUE1 5F6KA 5KH3A 3CKDA 1VCTA 3C8XA 1PGL2 4F3JA 4HWCA 5L4EA 3GF6A 3OPZA 5AQVB 3UU5A 1DLLA 2ZGRA 5IWAT 4CXWA 2GC2A 4PJMA 1VRH2 2FDKA 4H9OC 4FVVA 2WO2A 4DXZA 5SVIB 4JI6T 1KFXL 1GUIA 2V7LA 1N3OA 3OGGA 4GB32 4LJNA 4DQAA 4IEYA 1OXZA 2B76A 3IEEA 1CJDA 4V3LC 5HCFA 2MNZA 4PQQA 3VD9A 1NQJA 1PHMA 1ZX5A 2HWF1 4XJ8A 3IZOA 4ZS2A 1SBEA 2VQET 1QOSA 4P5OB 1DZTA 3AZWA 4CCGX 4WW0A 2E61A 5FV3A 3FL7A 4IEVA 4GH4A 3ZFGA 1OOPC 5EV7A 3PDYA 1UYXA 5KR7A 4WVZA 5IUXA 2ZEWA 3MIBA 5FZAA 1ND2C 1MS3A 1AR71 3I2KA 3USUB 4LITA 4O4JE 3ASLA 4ZZCA 3EABA 4YGDA 3A0KA 2LAUA 1OFNA 4DV1T 5FUIA 1CX1A 1OLQA 5JOXA 3BVCA 4DY3A 2YDEA 3JQXA 1D4M2 4IDNA 3WQ7A 2A6VA 2KMFA 3HCUA 4OHYA 1YXWA 4DEQA 4ZPIA 1XNTA 3DPRA 1JMUB 2HWB1 3APBA 4X64T 4X6QB 1LESA 4AVAA 4DB5A 3QH6A 3W9AA 4IEZA 1JYNA 4YTMA 1MZFA 4LBQA 2VG9A 4XZCA 1MS0A 3B5LB 1GBGA 4HONA 2A2FX 5D8AA 3VZLA 1ZA7A 1J84A 5FYCA 3UFEA 1V6OA 3AA1B 5DN2A 3S0MA 1QWRA 4AQ2A 1BK1A 2MD7B 1AR63 4Q4X2 4UVAB 4DR6T 2V09A 4D8MA 1J3QA 5FNVE 4JGZC 4YM2A 3BODA 3GZEA 2ZGOA 2RMU3 3AMMA 3RQUA 3PIJA 1OSGA 4K40A 1AR93 3KS7A 4PLMA 1VLNA 3VL8A 2I07B 1HRI2 2E26A 5JI7A 2HN1A 3O7OA 4CDQB 4LIUA 4B3MT 3I3QA 3F31A 4X20E 4BIFA 3E1F1 2CCQA 3PURA 2GP5A 1O59A 5DAWA 3S57A 3ZXKA 3ZVYA 4JI3T 1HX6A 3CZJA 4HWFA 1MMDA 2D7FA 3UL2A 3N2GE 2VXRA 3NO8A 5F3CA 2VL8A 2VK9A 4AAPA 4RS5A 4B4RA 2VKOA 2JQ9A 3SCHA 3BIWE 3R4SA 3ZCJA 1ODNA 3VBOB 4A7ZA 3NV1A 1T8BA 2FZ1A 2R071 1NUKA 2QJVA 2A70A 5FPXA 3H7JA 3FMGA 4Y33A 2CWOA 3VZJA 3GZTB 2X0HA 2LE8A 3ZIXA 4QX2A 4TN7B 3WG1A 5F9TA 4DIDB 3GHMA 2CHOA 5C7GA 4OYKA 2WZPP 1AYM3 1OF3A 5IVFA 4BLJA 5APAA 4TWDA 1JUIA 5JR7B 4LEJA 2KGIA 1MMGA 2ZZJA 5H6RB 1R1ZA 3PUSA 5BNNB 3OY8B 2I2SA 1VBD1 3U1XA 1B7TA 4BQXA 5L19A 1DZRA 1ND3C 1SACA 3JUEA 3MW4A 3KLSA 3PDQA 4KX6A 2MYSA 4LBMA 4HE8A 3ZLIA 3O36A 3RC3A 1ST8A 1MR5A 3KQRA 4MALA 2C0SA 4CZZB 3RIUA 1LR5A 5J37A 5TAOA 4YVSA 1ZRRA 4LF9T 2B7YA 2IW5B 1Q56A 1P8JA 3AE4A 4XUOA 2P6HA 4LA2A 3M2MA 1D4VB 2K2SA 5IUQA 4CCMA 5C2TA 3C50A 2P57A 1T6BX 3NJVA 1N3PA 1HYIA 1WFDA 4I4TE 1WLWA 2CV6A 1CJPA 4QX3A 5C11A 3RYIE 2VO5A 1XYOA 4QKBA 3KVBA 3LD8A 2CL2A 4J6GA 2K5BB 2OS2A 4QM8A 3ETUA 3J8F1 3NNLA 5T5OA 4MYEA 2VZRA 2QZ2A 2DNXA 5IWFA 4U7YA 4P02B 4JKKA 4LFBT 1WCKA 4JCKA 2UZGA 1PO23 2JD9A 1STMA 5BYNA 1O3XA 3O1PA 2PXJA 3UQ7A 2C9KA 2I50A 1NE6A 3H3LA 5LG4A 2BV4A 4YM0A 3MIEA 2Y33A 5A7SA 2IVJA 3TNQA 1U5PA 1POV1 1W8OA 4MG2A 2XJ7A 4TV9E 1YKHB 3KV6A 3TRSB 2XOYA 2WT1A 3RPGC 1UYPA 3BGAA 3FLPA 3P8CD 3WP6A 2PLV1 5FVLA 4AKIA 1IYMA 5FL1A 4P9IA 2XAQB 1RMU3 2FD4A 2JIWA 2IDAA 3ZN5A 4Q8LA 4GA9A 2W2IA 2VZ3A 5B79A 2D93A 3L2YA 1R1A3 3RDIA 2H88A 4A4CA 1HQWA 1QQP2 1WESA 5F5WA 3MBWA 3WHUA 5AC93 5F3IA 4QPYA 2XPKA 3AZXA 4A98A 3Q8BA 4HG6B 1GZCA 4RQPC 4NHLA 4XFCA 2J1DG 4HL0A 5DUXA 1Z0HA 3ONXA 3LSVA 5FDBA 3I7DA 3IDBB 4LKSA 4RHV3 1TNRA 5FY5A 1RUC2 3O70A 3BOPA 4M0HA 4XAXB 2Q9QA 3K1SA 5A33A 1UUSA 2IAKA 2XBO2 2VU9A 3MLLA 2HH7A 3ZXGA 2W1UA 2KA3A 5FYYA 4FQZA 1AF9A 2M6BA 2GN3A 1HJFA 3EYPA 5BNPA 4XF0A 1GQHA 5ANQA 2V26A 1NZCA 4P09A 5FK8A 2A7AA 2DVGA 1QLBA 4YG6A 4NRQA 2XQ7A 4XQWA 3UFGA 1D2QA 2UWCA 4LBJA 4LFCT 3VBSC 3ITQA 1JOCA 2WAAA 5ABGA 3KHBA 5HV4A 3FE5A 4MFRA 4JKLA 3T08A 3ROUA 1K12A 3CL1A 1I6XA 2OX0A 3FZHB 5EK4A 3M99A 4DZGA 1O5UA 3MPPG 1WCUA 5EXOA 1VAKA 2VBPA 5KXDA 1HJGA 4CCJA 4YYOA 1W8NA 1FI2A 1HG5A 5JPNB 3MDPA 2ZZQA 4JV4A 3ZX7A 2GZWA 3MUZ1 4LKFA 4YSXA 4NRPA 4OCTA 3ZFFB 4OHFA 2V7IA 4R9AA 1QDCA 2LGKA 1BR4A 4X66T 3VR9A 2RHPA 2JB4A 4TYSA 1MQTC 5BNOB 3WW4A 2ZBJA 4BK4A 3MW2A 1N33T 1TE1B 1XNRT 1TMF1 1RB8G 5AQPB 1ND2A 1YQ5A 1W6PB 4NN2A 4QX0A 1A3KA 3RG0A 2F17A 1W6OA 4LTAA 2YBPA 4M1PA 3IM0A 1HXS1 1LHVA 2CRRA 5F1RA 1JI6A 2N7GA 4PHZA 2BG9C 5E0OA 3CBNA 1SG3A 3O0VA 3ANWB 3TN92 3RYPA 2FHRA 1LENA 2VVDA 2AZ5A 5CFCB 5DZGA 2WT0A 1XNAA 2ODVA 4FBFA 1SHZC 2QQKA 2CWMA 2EIDA 3JQWA 2CKLB 1K3IA 3HQUA 3WF0A 3UU8A 5A3UA 2YC2A 1NE4A 2HWE2 4QX7A 5FKCA 4CDQC 3AE5A 1DFQA 4XDOA 3N7KA 3WX5A 1Y9GA 4EN6B 5FZBA 5ABJB 3CKHA 4JGZA 2DVAA 4UP0A 5HCMA 2VY0A 1N87A 3AMQA 4V1Av 4QMAA 3M4FA 4AZZA 5F5CA 1PNFA 2W08A 1G86A 3P50A 5GLZA 3O47A 3ZIWA 2MEV2 3AYCA 2FJBA 3RC8A 2WNEA 2A3YA 4O65A 4QKNA 3ZMSB 2FUUA 1W99A 2ES0A 2W67A 4UF0B 3N7LA 2VZSA 4UYBA 3NQHA 3JAFA 2FJEA 2Z5WA 3AAEB 1MZEA 1BR2A 4XZPA 5IK4A 1NEKA 4AGGA 4QX8A 1QNWA 4XYXA 1F4HA 2A6XA 4I09A 4BQWA 4IEPA 4GIWA 5H1UA 4YNIA 4ZXKA 2WS3A 3VBUC 3VB9A 2XHNA 4CUCA 4LE3A 4U31A 4AEMA 4E4ZA 4A44A 3RIAA 4YSZA 2MT5A 1LEDA 2NPIA 4JRLA 4DINB 2B5HA 1AR83 1FBVA 4KWUA 2Y0IA 5LGNB 3C5KA 4CEYB 1HNWT 4KI0F 1M4WA 2ZHLA 5JTGA 1LKNA 2BVVA 1VAVA 3RNSA 3ZPVE 1IZ3A 3RSJA 1K42A 1WEEA 1NLSA 3UETA 1FOD2 3WV6A 2ATFA 1O5LA 3WUCA 3EVYA 2JPFA 1VP6A 2UXCT 2C6SA 1L7RA 3CJIB 2FCVA 4Y26A 1X8EA 3JC6D 3VHOA 5FYMA 2VBBA 4DUXA 1S0JA 1QXPA 3O7AA 4A42A 4DR4T 1DP0A 4OQ8A 5C33A 4LBQD 2VW0A 4QHBA 4KGGA 2FDHA 5JWPA 5DG1A 3PUWF 1S0EA 1D0HA 2VZ1A 5JOYA 4BQ2A 1ZZ7A 3I2OA 2HDPA 5FZ7A 1QIQA 2JE7A 5LKZA 1FMD2 3VBFB 4NPRA 2LSKA 1EV12 4Q29A 5C3SA 5JAXA 2WS92 3NAPB 4PI0A 2ARAA 2R061 4YBSA 2KWJA 3QOFA 5FZ6A 3LPFA 4HWIB 1Y01A 1PGL1 3OVUA 2XTLA 3ALQA 1UCUA 3WXPA 4PTBA 2GSYA 4DUZT 1GZ9A 2DF7A 4R8PK 5HYAA 5LJMA 3LF7A 1WRDA 2R49A 2AEYA 4O64A 1VRH1 3URFA 3WDVA 5TRBA 1S2BA 3E5QA 2LGGA 2YDQA 4DEVA 1D1AA 4CCLA 1LOEA 4E4SA 2X5IC 4TUYE 4GB31 5LA6E 3KM5A 2UU8A 2J1SA 4QU2A 4IW3A 1BZWA 4LKDA 4TWTA 1QJY3 5FK7A 2RS13 3Q9DA 5E6HA 4XF4A 2KREA 3OBTA 3D82A 4XETA 4X5TA 5FZ3A 3JBG3 4B29A 3P3PA 1IG3A 4E8CA 5B76A 1WMDA 1IJ6A 4QWNA 4Q0UA 2PHXA 2GU9A 2L0BA 4MXWA 3TOJA 2J1TA 1FX5A 4M4PA 4O9EA 3SH3A 5LCWL 2D43A 4XI1A 3O1MA 4YZ2A 1V6JA 2IDOB 1SLCA 1BMV2 1XC6A 5FOJB 3WF3A 3MF6A 3I3BA 1EP0A 5HV0A 1VBC2 2QRXA 2WBLA 4I0AA 2JICA 1RUJ3 2PMWB 1G73A 1I3HA 1D4M1 1PM4A 3FBYA 2VBDA 2YT5A 3M62A 5AQJB 3EAMA 1RHI3 3J7Yq 2D6MA 4N78D 2QFEA 3LAGA 3OD4A 1HQNA 2V7JA 4GKXA 5FPBA 4N8MA 5F6LB 1W8WA 3ZMZB 2VQFT 3LQHA 3NVCA 1PMHX 3EJKA 3V0AB 4YZ4A 3FB2A 2LXPC 1DGRN 1XE0A 1RUI2 5HXHA 1GNYA 1H2KA 4GB0A 3B02A 2ECNA 1LECA 4Q4X1 2ODUA 2JDKA 2E31A 4OLLA 2QQNA 3N9LA 1WKYA 1BORA 4HN0A 3VD3A 4DV5T 1GU3A 1UOBA 4QD2A 2ARBA 1URXA 1HRI1 4MSXA 3I2GA 2VW1A 4I02A 3K46A 3ES1A 4AFMA 5LA0A 2P2KA 4QF3A 4GXLA 5SVIA 3DKQA 1S0GA 2E7AA 1X9PA 3QLQA 2EVXA 4AQYT 1HG2A 4IE6A 4RFT0 1K5MC 1IPSA 4L99A 3L1ZB 2G19A 4YHHT 1W9TA 4BMBA 3G6JB 3ZMTB 4BE3A 4XILA 1B35C 1XNQT 1N1YA 4NHKA 2HWC3 5HCHA 2LRIC 1V9U2 1XDPA 5LK5A 2Q5TA 3IMMA 4L11A 4Y5Z0 2GC3A 5HXEA 2JX9A 1U5YA 3J9X1 4AISA 4BXSV 5C3RA 1G25A 1XPWA 2J62A 5D21A 2GH8A 3ZSEA 3HNMA 1R092 4XIOA 2Y43A 1OMIA 4DY5A 5G05B 3KINB 4IDQA 2KSRA 5DUVA 3PUGA 2PJQA 4XHXA 4HSLA 1XNKA 4D7TA 3AE3A 2OXBA 4YW6A 3ZCIA 3PV0F 2Y1MA 3MLJA 4TZDA 1OH3A 3HI2A 1UN1A 1W2TA 4LQRA 3MIFA 2XJUA 5B78A 1YQCA 4CI3B 3RI8A 4NPLA 3DPLR 5JSRA 5L3CB 3J7LA 4F7ZA 3FHQA 2YOEA 2KKXA 5EQUA 5BXXA 3OF1A 5HXVA 2W87A 5FZIA 2GK9A 1AX1A 4M00A 4EWEA 3KCXA 5B8DA 3AXJB 1IPKA 3K3NA 2Q9QD 2XAJB 1MS5A 2F6BA 5L47A 3EMRA 4CVUA 3I2DA 1QOTA 1ZRIA 5GZFA 2W1WA 4GK0E 2E7QA 1WMXA 3ZOIA 4P9WA 5AQLB 1COV2 4FJOA 3FHNA 4LPLA 1MNDA 3MV01 2W52A 4EAHA 5A6ZA 4CDQA 2K1JA 1BJQA 1VOMA 4IDPA 4IV1B 1M62A 2XMLA 5I8SA 4O2BE 4CN6A 1UD1A 3CEWA 1ZEEA 1J59A 4I55E 3JD73 4JQRA 2FFWA 1ACCA 1DQ2A 3AC0A 5IATA 4D6QA 3IN9A 4AYCB 1CAVA 4XCAA 1JUHA 4QX5A 2W92A 1YQ2A 4ILBA 2XAFB 4E2GA 1GOHA 3H42B 1XB9A 3VBOA 1SLAA 3WDTA 5HXSA 3GGLA 3GDBA 4CP1A 2RI7A 4FPKA 4XW3A 3AE9A 4QT6A 3U14A 2CXDA 4FAGA 3ZKUA 4LF6T 2K9ZA 4GMP3 2ORZA 2E6SA 4TN7A 1ULGA 2WC2A 2I74A 5D1LB 3JADA 2TEPA 2A1XA 5SV8A 3KD4A 3ACLA 1XE7A 2Y6FA 3BCWA 3O1TA 1OHFA 3N9OA 1JYTA 4DXTA 1FNYA 4A0CD 4Z8XA 3AMPA 3W21A 1X7NA 1HQLA 3RYRA 5KH7A 3N9PA 4AQFC 4AFDA 3OY8A 5EJZB 4NUBA 3WI3A 2V4VA 4WZXA 1SMVA 3D5OA 1QQP1 5FBZA 4F6RC 4EYUA 1ULDA 1VBB2 5JSOA 1MMAA 3PJQA 1PNGA 1ZV4X 2XB1A 3HPNA 2RS32 1UKRA 1OLRA 1F31A 4I0UA 2VZTA 1ULFA 1Y3TA 1DGWA 3VBHC 1NKGA 1RUC1 4ZKTB 2QVAA 3VBFC 4L0PA 1D0YA 2QDRA 2CLYB 3AKRA 1UU5A 4A49A 2XBO1 1QJX2 3SEEA 1VE0A 2GALA 1IBMT 3P4PA 3DGTA 2BVLA 3DDTA 1ZBA3 1RUG3 4CA9A 1T1HA 1F62A 1V6MA 1OC1A 4IC2A 3MW3A 2X9WA 2WUHA 3C7HA 4XVHA 4TSVA 4H7MA 5HEJA 3K77A 1ZKEA 2ZX1A 3RRWA 1UZVA 2XJTA 2JENA 4AI2A 5LKUA 4AXPA 1FMWA 3LQIA 5HWYA 2C5JA 2VTXJ 1ZBE2 3NNMA 4CI2B 2DUOA 3FLTA 3H1YA 3RRDA 5DAQA 3NRYA 5AVPA 1H6XA 1L7LA 3JB4C 3QC9A 1UPSA 2D3RA 3ESLA 4YVWC 1PIV2 1JXNA 2E7TA 3H0OA 2M67A 2RS53 3ZSKA 2FDIA 5A7OA 2X5IA 3P7IA 4GIQA 1W2OA 5B75A 2XHKA 4IEWA 1QGLA 2V6YB 3KGLA 3SOWA 4I3GA 1J5WA 5AITA 5FLJA 2AH2A 1JZ3A 2E33A 3B9CA 2HWD2 4EEDA 2VQ0A 1G9FA 2NW7A 4OFGA 2ECTA 1YLLA 4O4IE 4XJWA 3UUMA 4EWAA 2XQ3A 1WEOA 2W0XA 3OEBA 2XQ9A 5JOZA 2E53A 2OIIA 3B69A 3IDEA 3R6NA 3G7DA 4PT6A 3VBRB 3FZLB 2C1FA 4MGTA 5FP9A 2BOIA 5JI9A 2CRBA 3WDUA 3VD4A 2BNOA 3M8LA 3LIHA 3CDZB 2LKHA 1XSQA 4Y3OA 4HK8A 4HETA 3TN91 1RUD3 2O14A 3PUYF 1UZWA 2VUJA 4DIQA 5G04L 3MHZA 2ZX3A 2RR13 1W09A 3IA3A 5CA1E 4AHWA 2L8KA 2VPDA 1RTVA 5BY5A 3ZYFA 4AFCA 3LDKA 1PVXA 1SEFA 1JYCA 1W39A 2RDSA 1WCDJ 1C5HA 2HWE1 4GYRA 4KWKA 3VRBA 4JHTA 5HI0A 4FFIA 2P3JA 3AFGA 4OGEA 3ATGA 4DBRA 4QH1A 5JMOA 1V6NA 2GDFA 1UWWA 4BM8A 3L9JT 1WEWA 4LLFA 3F2ZA 2ZABA 1F5JA 4KBMB 3ZMNA 4D0QA 1FV3A 4M3CB 2SPCA 1C8M3 4I50E 2H0BA 2MEV1 1Y43B 2W94A 1SUMB 3WAKA 2BU9A 2Y6XA 4BIOA 2PN5A 3UUBA 4UAPA 3HEIA 1U5ZA 2XQ6A 3SH5A 3ZYBA 3RPUA 1CGPA 1TME3 5I8TA 1H1AA 3KNVA 1CIWA 3P1IA 4DR3T 2Y8KA 3Q1DA 1B35A 3ASIA 4NPMA 1MIWA 3LA3A 4XEZA 2X51A 2WCAA 3ZFFA 4FPEA 5IVEA 2H7OA 1H1MA 4JI2T 4ZU4A 4DRRA 5JDNA 1A78A 1OBNA 4QKFA 5LEJA 4AFBA 5JR9B 3PUVF 2UWBA 3PLWA 3NJZA 5CKQA 3HKDE 4A7YA 4QB2A 5GLUA 1H9PA 3MHHA 4GNGA 3JZVA 2ZEYA 1LOAA 5C3JA 1ZREA 2CE7A 3B13A 4R9BA 2Q1MA 3ANWA 5AQTB 3S5QA 5ACA3 3P4RA 5CFCA 2JQQA 1HW5A 1FOD1 1F8VA 4TNVA 3THPA 2ECGA 3AYAA 1PVC3 5DXDA 2BS4A 4Y4YA 4AGVA 4N43C 2CKLA 2WDVA 2DYCA 2HBUA 2XLFA 4N7IA 4JTNA 4S2HA 3FBLA 5GZCA 3KZ4C 1X9BA 4BDVB 3HN1A 1W28A 2LGVA 4GJZA 1MM3A 3O12A 1MEC2 2A75A 2J1VA 5ABJA 4NJ4A 2MUMA 1D2SA 1FMD1 2EGMA 1CN1A 4AQ6A 1WZXA 1Y4WA 2V8SV 1EV11 2WS91 2G9FA 2XXZA 1LDKC 4NRMA 1IQDC 5LBQB 1A34A 2VNGA 3ZPOA 1BK0A 4UF0A 2CSZA 1DQ0A 1VD4A 1JM7B 5KMGP 1RUH2 4TNWA 4E9KA 1UZYA 4H9DA 1E5SA 4EJRA 4TLGA 4ZI3C 1FNZA 2ZX2A 2O8OA 5CGMA 1PO12 3QBQA 4UFHA 4JVAA 4OYUA 1DQ4A 2E6RA 4AEJA 5F5IA 5A7PA 2MOZA 5FMNA 4JTOA 1WWYA 1WCSA 1HDKA 1YKEB 3X1DA 2EXJA 2YVRA 2VL4A 1DF0A 4ZI2C 3VKNA 4CP9B 4DV7T 2CTVA 4Z91A 2DVFA 4DFSA 4BHWA 1LEMA 1DQ1A 4EV6A 1HV0A 1HRV3 4IE0A 4FIPA 3VZMA 4Y1YA 2YINA 1IS5A 2PHWA 5H1TA 1BMV1 5FP8A 1UY3A 1UU4A 4HXCA 5FCCA 4ES9A 1VBC1 2CGOA 1GQGA 3RIFA 4G3YC 3RGBA 4GMP0 3I3EA 3O0XA 2JE8A 2E6VA 5FZCA 2VCCA 4EN7B 4FPJA 2QJ0A 1OH4A 2VQUA 4K0KT 2CLYC 3MEPA 4IHJE 2LM3A 5AIUA 2G0UA 3SNMA 2CU5A 1XXNA 2YREA 2VJFB 1FMVA 2IIUA 4AKGA 1MBMA 4HANA 5LNKA 3LPGA 5JDGA 5FWJA 1UOFA 1E1HB 4QH5A 3T1HT 1RUI1 4D94A 5LASA 1DGRA 3VBFA 2MNYA 3GN5B 1OKQA 2KR2A 4AQSA 5JZGB 3HAGA 1PGW2 3A22A 3KGZA 4J25A 3NAPA 1XJAA 4YW2A 1DCSA 4LE4A 2V72A 1QSDA 2XKPA 3O0WA 3NKZA 2JJ6A 2LOPA 2W46A 3O1SA 2YK0A 3POEA 5L73A 2Z69A 3KCCA 1HB3A 5FJHA 1R083 5ANNA 1OLME 3SMHA 4WA6A 2D9DA 4OHXA 5FZEA 4XJUA 2XLGA 3T4VA 2K46A 4EEBA 3I3MA 1DVPA 5FYIA 3M70A 4S3OB 2PHTA 4XTPA 1W0AA 1Z60A 2ET1A 3LG7A 1V9U1 3Q2MA 4ATFA 4YVWA 3TYJA 4RR3B 3KT7A 5L3GB 1C4RA 4CDXB 1GANA 3RZKA 5L3FB 5CB7A 4WVMA 2BNMA 2MHFA 1R091 3QD6A 1GV9A 3VBRC 2E9XB 2YXSA 3K3QC 4JEHB 1HCIA 4HT1T 4AEDB 4AE2A 3PU8A 1WW5A 3T0AA 2D6PA 2F6JA 1R64A 2D8UA 4EZHA 1PGSA 2BFUS 3M3CA 1PMJX 3ZXLA 3OG2A 5LMUT 3K75B 3RYHE 3OBZA 3UULA 2DCFA 1NOVA 3C6WA 2ZGLA 1H30A 2ZTNA 2VMFA 4BXFA 3WT3A 2H7VC 2BBHA 2DCYA 3VHPA 3T2QA 4B3RT 4B1LA 5FPLA 2YHJA 5A7NA 3V0AA 2J1EA 3I0OA 4I7CA 4YARA 1TVGA 3KMHA 2ECVA 1NY72 4UI9B 3TEZA 3V65A 3WF4A 4LADB 4Y20A 2WDBA 4AVBA 3VRAA 1CAXB 4JI5T 2VZVA 4HGAA 4U33A 1SBDA 3ZYQA 2JKBA 2YROA 5AQUB 5K8SA 4BWOA 2WU2A 5TBNA 3EB6A 2WA4A 5HCBA 1AYN3 2UXNB 5LBFA 4BA6A 1COV1 1V70A 3TEYA 3GBWA 4D7SA 4Q4V2 5FIXA 1JZ7A 1I6ZA 5CJ5A 3QUJA 4QGLA 1UZZA 3R6SA 4UIGA 3VHLA 3OGVA 4META 2CSVA 3OBVE 2WZHA 4XACA 3IT8A 2FCTA 2LEHA 4YSFA 5L7OB 4LLBA 4XXPA 4FT8A 5E88A 3OGRA 4XJZA 1RGSA 2DWRA 4OHVA 2VULA 1RUF3 3SEPA 2NYYA 1SLIA 4QQOA 3RMYA 1Q8OA 2QQLA 2P3IA 3H3MA 4YTPA 4MADA 3WDXA 4OI1A 2Q30A 5FYUA 5JR9C 3J26N 5I0SA 4A4AA 3WHTA 5L9VA 2P3YA 3GYDA 3AZZA 2EXUA 3MXZA 4NOTA 3WP3A 1I5ZA 5CA6A 1YFYA 3FBZA 2YB7A 4PDWB 1DIWA 2VH9A 3PTRB 3AAIA 3N2OA 3RZJA 5GONE 4WZ3B 1FT9A 3RWKX 3WF2A 3DP7A 4MBQA 4CN1A 4LA3A 5A3MA 5IYZE 3JXSA 3KWVA 1IG0A 2KWHA 5LJNA 2GNTA 5LY2A 4DXRA 2IXJA 4MGKE 1Z8UA 2WSVA 3UQ4A 1U5XA 1VBB1 1SQ4A 2L7PA 4P0BA 4LKAA 2QQWA 4E27A 3B01A 2CBJA 2RS31 3SOLA 3AXJA 4Q1RA 2C0ZA 2BGPA 2Y0OA 1S1AA 2WDRA 3C64A 4N43A 3C51A 3UV9A 2JRKA 2LM2A 1WA4A 5AQGB 1Q3EA 3RLFF 4LO6B 1QJX1 3BKZA 4YATA 3M7AA 2ILMA 2C24A 4DOUA 1JU4A 3BPSA 5JIUA 1LAJA 2BZDA 3WW2A 5C13A 4HFBA 1XWHA 4Y1XA 4P14A 2XKOA 3WVJA 4GWNA 2OKXA 1W6NB 4FPOB 5HCAA 4AYCA 1Z7S2 4N3WA 3WNPA 1VMJA 1OF4A 1ZBE1 3WSOA 4Y22B 5C8CC 3KDEC 3A7QA 3MLKA 2LSGA 4HMZA 4XTMA 4SBVA 2BYVE 1WBLA 3PTYA 4BAYB 4NMIA 1VRBA 1PIV1 4X1KE 4MLOA 2M13A 4JI1T 1HKDA 5DPNA 2XPJA 4C90A 4P1NA 1XOYA 2GP3A 2QA7A 1LNSA 5LKXA 5LGTB 3C98B 5A32B 2VJXA 2Y26A 4COUA 4E4HA 4Q4W2 4JBWF 2HYKA 1GNZA 2FBWA 2HWD1 4MV2A 5DUWA 1HN1A 4ISTA 2ZCWA 1TQ5A 2C4XA 2JQHA 2WZR3 4CDUB 3C4XA 2WA3A 1WW6A 1O8SA 5AFBA 3LK3B 3QK6A 5KWRA 3HIFA 2VUDA 3GXUA 4JI4T 1WEVA 1IOAA 3VHNA 1NAFA 2JWPA 3HMYA 2DBNA 1X36A 1T6GC 4K9SA 3BTZA 4WM8C 4PBOA 3FFQA 1H7CA 4YAXA 2VJEA 4HFSA 1Z6UA 3IDAA 3RKGA 3KHCA 4ZY9A 2L80A 4C8DA 1HV1A 4YFZA 3WAJA 1CHCA 2W47A 1UF2C 1D1BA 2BGCA 3TWIA 3KBUA 2B45X 1RUE3 4H63H 4OI0A 3ZKRA 5SVYA 3EQEA 1XSRA 3BU0A 3INAA 4MGYE 5GKAC 4XAEA 2YC0A 3KV9A 2XG3A 1UCXA 2HPLA 2XGXA 3ZDVA 1G8WA 4LK6A 4FFFA 2V7KA 4U74A 1V0AA 2WZEA 1E5IA 5A80A 4QPIB 3EI0A 5HEGA 4K8FA 2FUIA 2R16A 5D8AC 4P5YA 2PYTA 3IHPA 4PNIA 1AXZA 1NZIA 5JDLA 3KF5A 4S3OC 2W4XA 1Q8QA 1ASJ2 1KXGA 1BEV2 4X8NA 2HWF3 2WO3A 1XDOA 5A3OA 4NAOA 3V64A 4CDXC 4I7BA 1PK6B 5DMYA 4PLOA 1KNRA 2V6YA 1SBFA 2WINB 4EN8B 2VKJA 2JG8B 1LU2A 2NM1A 4AEKA 2P3KA 3T9KA 2E9XC 3LB9A 5AQQB 4ISSA 4KL1A 1AR73 2YFUA 2EIGA 2YHNA 2VUAA 4MGZE 4PIZA 4B6XA 1S35A 5FZHA 4JI7T 2Y34A 2ZETC 4J1XA 3U78A 4IEUA 2WY2A 3ABVA 4YZ1A 3TLSA 2MKEA 1L3JA 3VBRA 3M3IA 2QQJA 2FJAA 1MS1A 4RS5C 2HWB3 2NAAA 5GZGA 5EJ1B 4GD4A 2KWIB 2ZGTA 4KMCA 3DV8A 2CBIA 3EB7A 4XF3A 1S55A 2A6WA 2VQAA 5E1RA 4JHZA 5DAPA 2KLQA 2ES3A 2OUHA 1J5ET 4AKLA 2ARCA 2A3XA 3GALA 1FPN2 5FZ1A 2VNOA 3ILRA 3LWCA 4MX3A 2UURA 1A8DA 4MUVA 2YPDA 1HTJF 3C7EA 3AB0A 1W6QB 1MEC1 4U2ZA 1LRZA 3VK6A 1KS5A 3M1HA 4JDNA 3DXTA 1IPJA 1JBCA 3UESA 1DQ5A 1ENQA 4AVTA 2DV9A 4ET7A 2F4PA 5L7OC 2VCBA 3RIUC 1WENA 3HN3A 2KGGA 4P9JA 4C0BA 5L4HA 3I2IA 2VVSA 1AX0A 3EHZA 4YVSC 3U75A 2BKOA 1MVQA 1Q8PA 1YXRA 2KE1A 2WZIA 3PIGA 2JMIA 3DCQA 4A56A 1NCRB 2E5VA 3MV11 1OFSA 5A3LA 5FXVA 1HYJA 2IWGB 1N1VA 3L09A 1RUH1 5AQRB 2VR4A 4DVDA 3ETPA 2R073 3GMIA 3D3AA 3VZOA 1RL3A 3DJBA 2Y60A 1BLZA 3BTAA 4MHUA 3ZDSA 2GC1A 2A73B 2VPEA 1PO11 1VFYA 5GLWA 3UU3A 1JZ6A 1GLHA 4LHSA 2ZMLA 2KD7A 4D3WA 1W8TA 1XYNA 4B4QA 2HPJA 3N9QA 5JR9A 4QHZA 1HX1B 1HB1A 1MPXA 5ABEA 3C7FA 4NN0A 4HLTA 1ZRCA 3F95A 3I49A 3POSA 1QUUA 1VBD3 2YMZA 2L43A 4HTEA 3KV4A 2DVBA 3H8UA 3VDDB 2OQ6A 3AXDA 4XBQA 4FI9A 3AEFA 3E5UA 3DUIA 3IWZA 4OVEA 4XFHA 2R1BA 3ZSJA 5I8YA 1I9RA 2KXPB 1J3PA 2JMKA 5FPUA 3GWHA 2R042 4CEWB 2QQUA 4U7IA 1S4CA 1JZ2A 1RXFA 4HFVA 3ZN6B 3N9MA 1WLTA 2RJKA 3SKJE 5DDJ2 3SKVA 3AA0B 5JXJA 1DDLA 2LOSA 2UU9T 3JCFA 5B4XA 3FXEB 3H7YA 2A3WA 3J8F3 4QDQA 2CPTA 3J7NA 1QJU2 4KNCA 2BBJA 1PGW1 2J22A 2XR4A 4DR5T 4DBQA 1FP0A 1VALA 5FMBA 1NA1C 2VMIA 4EN9B 2AXDS 1BCXA 3ME2A 1UMIA 1ZVFA 1GSLA 1NX9A 4YZ5A 2PHDA 3UK9A 1VBA2 1JM7A 1JOBA 3HQRA 3S7IA 2B9UA 4N9IA 4O9GA 4L9IA 2XAHB 2UWAA 4ES8A 4CUGA 5E16A 1POV3 1RJ8A 3DN7A 4IIJE 1NYWA 1LHUA 4B7YC 5FY4A 3RI9A 1UPIA 2UXXB 3CIRA 2PFVA 1EPWA 3WNXA 5C8CA 1O6UA 4R7EA 2D3SA 4TWHA 4M3CE 2NWBA 2PLV3 4H9PC 1WMEA 3DKWA 2LALA 1GFF2 4LF7T 4UEMA 5T52A 1PMIA 3GCWA 2LS6A 3KFWX 1W0BA 2WYFA 4U3CA 1WMFA 4WM7B 2UYBA 4UV9B 1T7SA 2OYZA 5ADXL 3RZZA 4H2AA 2ECJA 4UELA 2FDJA 2MBGA 2EAAA 4LBKA 2PBIA 1H4GA 5KC6A 1UURA 1FJGT 4COWA 2K16A 4YABA 3P4WA 3FZMB 4ZONA 5KXBA 2P5BA 2WO1A 3PUQA 3USSA 4TXWA 4XJAA 3KT4A 2VZUA 5HCJA 2ERFA 5CB4E 2MAWA 4EE2A 2XL7A 3L2HA 2ARXA 1N3QA 5FWEA 1OEDB 3CHXA 4FOYA 1WYBA 2LM9A 3FJSA 4S2DA 3Q5XA 5BPXA 1N1TA 2VOKA 4PJJA 2H6CA 1T2XA 1Y9MA 3NV2A 2YBKA 4WM8A 3GN5A 2DUQA 1NY71 2X9YA 5LBMA 4ZDTA 5CAZA 2EXKA 1ZOYA 2GMEA 1DHKB 3H7HA 2MPKA 3ON7A 2EHOD 4LORA 3ZN0B 5I3LA 4QPIC 2YN6A 2E2AA 1A8MA 5A1AA 1RINA 1CPMA 2CSGA 4DMIA 2Q8DA 1CUNA 4Q4V1 5K0UC 3O34A 2IUWA 2DDUA 5DAVA 4JLEA 1PK6C 2YUCA 3WINE 1EAH2 3ZJ1A 5KHGA 5FMOL 3B3QE 5EP9A 1GP5A 5FLHA 5CKNA 1BBT2 4NWWA 2QYWA 3CWZB 2J42A 4H9NC 4HPKB 4RGAA 5LZ6A 3H1WA 4GH4B 1UNBA 5C8WA 2ZKLA 4RR3A 1RYYA 3N36A 4CDXA 1WEMA 4LK9A 4IGUA 3NV3A 1J1TA 5J98B 5HAXA 4LR4A 1CONA 5J36A 3AL5A 5ABHA 4JZRA 1MS8A 2E9XA 1PZ7A 1TMF3 4DUYT 2KZ7B 5TABA 4R52A 2OVUA 3SOXA 4AEDA 1RVF2 3JAEA 1HXS3 1LHNA 4E7SA 3FX3A 3H50A 4W8JA 1H9WA 5H6QB 4ZI2D 3FZKB 2XVKA 1LVKA 3N9NA 5FZDA 4UWDA 4Y5SA 3PHDA 1UX7A 2L75A 4GNDA 4IT4A 4TX5A 2ORXA 3VGIA 4I30A 5LATA 1UMZA 4Q0SA 2HN2A 4YBMA 1OXCA 2LQ6A 2D2SA 4UFIA 3IMNA 3OB8A 4FPCA 3LEMA 3GCXA 1IQAA 4TWFA 5B2GB 4Z07A 4CDWC 5DG2A 3CX8B 3ZMVB 4XAAA 3A0NA 1CAXA 3O5SA 1VMHA 1KS4A 3NZQA 2E32A 5FO7B 3ZXDA 3VKFC 3HR9A 3RX6A 4FPYA 4H55A 4EWDA 4PPEA 4A3XA 1AL22 2Y8DA 3R4DB 2B39A 3D6EA 4V2WA 5LB7B 3MO4A 4UFKA 3WR0A 5C9AB 1HF8A 2WNVB 4N4FA 2WT2A 3F57A 2XUMA 5LCYA 5J2UE 4NIQA 2FZ2A 5IYYA 2PQQA 2E63A 4HKWA 3QACA 5AQOB 1NCRC 4P9YA 2D0TA 3W58A 5FL0A 1OA3A 3TB0A 1EZ3A 3Q8AA 2W68A 1QH7A 5L7OA 4GQ7A 4ZI7E 2XM1A 4B3ST 2JIJA 3EUHA 4WYVA 3N2KE 4Q4Y2 4YTNA 1Z7S1 5T54A 2QIZA 1OT5A 4ZZBA 2KKYA 4YGBA 2ZKNA 2RDQA 3VD5A 2ZS6B 5J3UA 3K48A 1OPOA 5FZOA 5EZWA 2NP0A 4L8QA 2IZWA 3TKLB 4K1YA 3H1MA 4PDWA 3OD0A 4TTGA 3FWEA 2VOXA 1YFWA 1NQDA 3QCWA 2WR9A 3NZPA 4KWLA 4Q4W1 2CWSA 4IREA 2HLEA 2CYFA 2WMOA 3VDDC 2IMLA 2AEZA 2XLAA 1MIVA 1V87A 5FZGA 4ASMB 3CZUA 2BJSA 4DS0A 3BN6A 3LRQA 2K9AA 5A6XA 1D7PM 2E5LT 4E2QA 3J7MA 4HN1A 3T0DA 4YW3A 2MNGA 2RA1A 1PX3A 4FK5A 4CEWC 4N53C 4PF1A 3WQ1A 2I59A 1IBKT 1JZ4A 3WDWA 4QX1A 1FYUA 1ZA4A 2WFF2 1RUNA 3UKVA 3KCYA 1F9KA 3J9SA 1YQ8A 3WG4A 4A45A 4HK9A 2VMDA 5EHDA 4Y1ZA 3MYXA 1RC6A 1SPPB 2M6MA 3VD7A 1BR1A 2RM22 1GR3A 1YWKA 2QCSB 5F32A 2R063 3FZ3A 3VV1A 2XJPA 4WBOA 4KH9A 3IPVB 4CCOA 2EXIA 5LK7B 2D5HA 1W6NA 5DKAA 3TEXA 1G9BA 5LA1A 4QF2A 1NA1A 2HEVF 2YC4A 2H3RA 3V43A 3U4XA 1VRH3 1KK7A 5ISLA 4HFEA 2WABA 1DBNA 1PX4A 2PNXA 1H4HA 4GB33 3CMLA 4QPWA 2D97A 4QGMA 1ASJ1 4JKMA 3RH3A 1BEV1 2HYXA 3DWDA 2X05A 2FD8A 3VZKA 3RPQA 3HA4A 3FL2A 1WA6X 2D40A 4I0BA 5A32A 1YD8G 4GKYA 2NP9A 3UGFA 5HPOA 4AR2A 4COYA 1FAYA 4FPHA 4H9SE 4EXTA 5FAXA 1CIYA 4LUKA 2WU5A 2W62A 4YC9A 5BUVA 1TEIA 1YJLA 2V5CA 3I97A 5H9QA 4OULA 4GALA 2PAMA 1QHDA 3JB8A 3LBXB 4CDUA 1D4M3 1VPHA 4XPVA 2X67A 2XB6C 3AZVA 3AP5A 4IDOA 3FUQA 2JXAA 3RYFE 4ADZA 4JDOA 4GKKT 4JV5T 2IFWA 3CO2A 5I93A 3CPZA 3O37A 1XU1A 4QQ4A 2LKGA 1X9TA 1U6GB 3TAYA 2KM2A 2FJDA 5BNPB 2DURA 4WZCA 4Q4X3 3OTFA 1FPN1 4PCRA 2BFUL 4IESA 1QJZA 5FY9A 3WW3A 2ACXA 1D0GA 3CK6A 3ZPV1 2KIZA 2GMMA 3HCTA 3MZKB 1XZYA 3LDQB 1GQPA 4BQ3A 1HRI3 5EYYA 1DU3D 2DX8A 3MIHA 2B4KA 5LG3A 2YFZA 3QH7A 1XMOT 4LO8A 2JECA 4QPIA 2D6NA 1LOBA 4XDPA 1Z78A 2Z4FA 4YJ2E 2DTYA 3L3PA 4QB6A 3O1IA 2VUCA 5EK3A 3AE8A 1VR3A 5K0UA 4YT0A 5FPVA 1XWMA 3W15B 4WZ2A 1QH6A 4DV3T 3SISA 5FY7A 2G9GA 1PK6A 4YBTA 4HFHA 3R4UA 5L36A 4BJ0A 3EO6A 4RL7A 2JG8A 1HNZT 4L5GA 2O1QA 4YWAA 3T1YT 4YLHA 5AQFB 1W8HA 2SLIA 1YFUA 1CESA 1CAWB 1GKBA 1OOPB 1NLQA 5L3EB 2WFPA 5A1LA 4K1ZA 4LOTA 2DFCA 4GAZA 1ND2B 5F7UA 2VXJA 4CXXA 2UY8A 1S94A 1W6OB 2BUKA 3A23A 4UFMA 4LF4T 1TNFA 1YQ4A 2CHHA 5CA0E 1Q8SA 1W9RA 3VBOC 4LIVA 4XURA 5JLVA 4AIUA 2WQ4A 4ZU5A 1OUXA 4XMAA 4AVCA 1LOGA 4ZU7A 5KBFA 4EV0A 2ETEA 5JXHA 3ILNA 2HHHT 1BXHA 1IKPA 2RDNA 3AYDA 1ZM1A 3Q8CA 2R1DA 1S0DA 4CI1B 1W9SA 2YUEA 2R041 3VKLA 5HXMA 1QOOA 3ONJA 1YW0A 4FSJA 1B09A 5FB0A 2J7MA 1X4JA 4NIAA 1OA4A 1RUOA 2AN6A 2XQXA 1V6IA 4UV8B 2RE9A 4LKEA 1F5FA 5DDJ1 2QQPA 3HBKA 4CDWA 3E0ZA 1CZSA 5J96B 4B7KA 5C9AC 2ZX4A 4JGZB 4AI6A 4MGIE 5BNNC 1QNYA 2UYAA 2JE9A 2VVNA 3MK7C 1WILA 5HXRA 1YCIA 4HWDA 3SWHA 1QJU1 4AI0A 2D6OX 2DCJA 5B4NA 2WJSA 3ZN4A 3C7GA 3SFDA 2Y38A 3GL6A 5CADA 4YHJA 2BP6A 2PQSA 4XABA 4P9LA 1JW6A 1NCRA 1S2EA 4Q5OA 1VBA1 1OD5A 3DECA 4R4XA 2PFWA 3KDSE 5AQNB 4E7ZA 2W39A 4GK5E 2ZEZA 1AR62 5TSWA 1HX8A 3ZVXA 2OPWA 3HCSA 2XDVA 1W90A 3HKBE 4R4ZA 3EB5A 2XSAA 1QXRA 2RMU2 5C4WB 3AKPA 3D0TA 3NKGA 1AR92 3LIGA 4J1WA 2TBVA 4X1IE 3LKJA 2Z79A 2ADDA 3FJUB 3HWJA 4MHRA 3ZTGA 3JU9A 3P4QA 1POQA 4FPGA 4BHPA 1ULPA 2AACA 3AP9A 3IDCB 5J09A 5GLTA 3K4DA 4WVVA 3BPZA 4KP3C 1SLBA 5LHIB 2W66A 4QXKA 4JRAA 4YY3T 5FERA 4R9CA 5IK7A 2VNFA