3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
2FUUA 2G6QA 3ZYQA 1FBVA 3N9LA 4E4HA 4Y33A 3U78A 3RVHA 2FUIA 2M1RA 5TDRA 4F52B 4CUGA 5H1TA 3SOUA 2YBPA 2L5UA 5FZMA 5IVFA 5FPUA 4A49A 1VD4A 4D6QA 4CCJA 5FBJA 2ECTA 2C2VS 5FYVA 2W2IA 4UP0A 5TABA 1WIMA 5A7SA 4I7DA 4YAXA 3ZNIA 4WZ0A 2JMDA 4GNDA 5FY9A 2LRIC 2MNYA 5B78A 5FZ1A 4PPEA 4GJYA 2L43A 2JRJA 2YHNA 2PXJA 2MD7B 2VJEA 5KH7A 2ECGA 4IC3A 3N9MA 5IVBA 2YU1A 2L0BA 3O37A 5TDWA 3KV9A 3SOWA 2LGLA 5A7WA 5F32A 3U5NA 5FZFA 4UP5A 1CHCA 2L80A 4LK9A 3N9OA 5FZ8A 5IVEA 2H0DA 1RMDA 3PDQA 4B7YC 1K2FA 3T6RA 3KV5A 2LGVA 3DQVR 4BXFA 5FYBA 5J3XA 4CCKA 1JM7A 5E6HA 2E6RA 2MNZA 3C5KA 2LGKA 2Y1MA 4YBTA 5FEYA 3OPWA 1LDKC 5A1FA 2KWOA 4QXCA 2F6NA 4LLBA 3ZVZB 5FUNA 4N3WA 2D8SA 3ZPV1 2YU2A 4CCLA 2YBKA 3LQJA 2MUMA 4P5OB 3PTRB 5A7PA 1WEOA 5A7QA 4GNEA 5A3TA 2K16A 2M85A 2UZGA 5FB0A 4CA1A 2RI7A 1WEEA 4TKPB 4YADA 5FWJA 1MM2A 1VFYA 5A7WB 4I7CA 5FP9A 2G45A 2WWUA 3LD8A 2HDPA 5FYIA 4BU2A 3PUQA 5FP7A 4IC2A 5B77A 4UI9B 1U6GB 2QICA 5F5CA 2H0DB 5FY4A 2PUYA 4YC9A 2Y43A 3MHHA 5ANQA 2F6JA 2VPDA 2LN0A 2G43A 4CSWA 2XMLA 4AI9A 5FYUA 2KGIA 5C11A 4CCNA 1WEQA 2CKLA 4AP4A 2VPGA 3U5PA 2ZETC 2IDAA 3O33A 4YATA 5FXWA 2VJFA 5FZ9A 2RSDA 4AVXA 5FZCA 2FSAA 3UYJA 1WFKA 2YHOA 4ZQLA 5IVVA 4LIVA 4QWNA 4FO9A 5LKTA 4WZ2A 5FZ0A 4LJNA 4A4BA 2Y1NA 2ECVA 1ZBDB 1HYIA 2GP3A 2YW8A 4UF0A 5F3GA 5FP8A 4LXLA 2LXPC 4Y4RA 3L1XA 2JMJA 5LKZA 5K4LA 5AIUA 4QX8A 4C9ZA 1F62A 5FZ7A 4B86C 3U4SA 5FZKA 1VYXA 4GNGA 4GNFA 2OT7A 1JM7B 3NG2A 5FXVA 5FZBA 3RTRB 5FERA 4DO0A 1DVPA 2LGGA 5C13A 5FYSA 4CCMA 4ASKA 3ZLIA 5D1MB 2OS2A 5H1VA 3MHSA 5FZOA 3QZVA 4YBMA 1LDJB 4R2YA 3M62A 4NN2A 3VK6A 4AAPA 4BHWA 4YBSA 1X4UA 3KNVA 2EA6A 4EZHA 2K17A 2K1JA 3OPTA 2KFTA 4W4UA 5AITA 5H1UA 3N9PA 3M99A 4BBQA 4IGQA 5KH3A 3GV4A 4TN7A 2YYRA 2HYED 2MA5A 4R7EA 2MD8C 2KE1A 5LWBA 2ECIA 4AUQB 2OX0A 2PNXA 3IHPA 4R8PK 5KH9A 5I3LA 2OQ6A 3ZVYA 2MT5A 3ZPOA 2VJFB 5TBNA 2VPEA 3K3OA 1WE9A 3NJYA 3V43A 4QF3A 5KR7A 3EB5A 5DKAA 2EGPA 4URAA 5LY2A 5IW0A 2XUEA 5IVYA 2YQMA 5A80A 4XDOA 5FZHA 3KV6A 5FZDA 3KVBA 4CCOA 5A1LA 1WENA 4FJCA 2OXQC 5LKXA 2VPBA 4GJZA 5JG6A 2VD7A 3K3NA 2XDVA 2YREA 3GL6A 1X4JA 2JMIA 4QXHA 2KIZA 5LW9A 1WESA 4ZUXU 4V3LC 2ECWA 1Z60A 2YURA 4IGOA 2CT2A 5A3PA 5FXZA 5F2WA 4S3OB 3HCUA 3L1ZB 2KU3A 1WEUA 5FY7A 5DINA 4UF0B 2BAYA 5FP3A 3DPLR 4XI1A 2DX8A 3LRQA 2VNFA 4LKAA 5A3WA 3KQIA 5LKUA 5CEHA 2KREA 2YT5A 3O34A 3HCSA 4YABA 5FWEA 1HYJA 4D6SA 2F42A 2P5BA 2YUCA 2CKLB 5FZ6A 3O70A 3U5MA 3L11A 3LQIA 4A0CD 5LY1A 4LIUA 5F2SA 1FP0A 2Q8DA 5IVJA 3O35A 3O36A 5FYHA 5G04B 5A3NA 4QU1A 4V2VA 4GD4A 5FYZA 5FYYA 2KGGA 3AVSA 3C6WA 2OQ7A 1Z6UA 1WEMA 1XWHA 2M6MA 3DXUA 2AN6A 3KV4A 4V3KC 1N87A 4AYCB 4L7XA 1VRBA 4I7BA 5FYMA 5F3CA 1E4UA 4BISA 4IGPA 1MM3A 3I2DA 4Y3OA 1Z2QA 5EYAF 2KR4A 3PUAA 5F3IA 4QX7A 2LQ6A 4PTBA 5FY8A 2YQLA 5FJHA 5FZOB 5FZIA 5ISLA 4LADB 5FPBA 5FV3A 2QIZA 2M3HA 5FZGA 5FPAA 5F37A 5G05B 2NAAA 2YSJA 2KYUA 2K4DA 1WEWA 2QJ0A 2Q8EA 3HTKC 5D1LB 1WGMA 2MIQA 1X4IA 4WA6A 1G25A 3EB6A 5FZEA 2KWJA 4L58A 3KVAA 4DIQA 4EZ4A 3SHBA 1BORA 4QF2A 4GAZA 2YU4A 3RPGB 4WZ3B 4HOOA 4EYUA 2XB1A 5FZ3A 5FJKA 2WWJA 2C2LA 5FPLA 2LV9A 3LQHA 4AYCA 3K2OA 5FXXA 5FYCA 5FZ4A 5F5AA 3SOXA 5F5IA 2LXHC 4MVTA 3PU8A 4MSXA 5A7NA 3PUSA 3PHDA 4FK5A 3U5OA 4CCGX 4ZDTA 5G0FA 2LDRA 3AL6A 3HCTA 3ASLA 4LITA 3FL2A 3ZPVE 1WEPA 5A7OA 5B8DA 5FPVA 4D6RA 5FY0A 2KWKA 4Q6FA 1IYMA 5FY5A 2Q8CA 2L75A 4XDPA 5FP4A 3AVRA 3LDBA 1T1HA 4A4CA 2ECNA 2MA6A 2YSMA 4QXBA 2YBSA 5B79A 4N4FA 5B75A 2ECJA 5FZLA 4X3GA 5IVCA 1JOCA 3O7AA 4FIPA 5FYTA 3T7LA 3N9NA 4S3OC 5LCWB 2YPDA 3AL5A 2KWNA 1WILA 2VJEB 3ZTGA 4GB0A 3PU3A 1V87A 4NUBA 5IWFA 5B76A 4HONA 5FUPA 3RPGC 5F3EA 4C8DA 5F39A 2CSZA 2GP5A 2CSYA 1WEVA 5FY1A 2E6SA 3M63A 3DXTA 5H9MA 3N9QA 4V2WA 2EODA 2VP7A 4O64A 2XXZA 5D1KB 5FZAA 5TRBA 2XEUA 3PURA 2I50A 5FB1A
chains in the Genus database with same CATH superfamily
1G8WA 3ZN5A 2ORXA 3CMLA 2V8SV 5CYYA 5K8SA 3VKMA 2ZMNA 1Y3TA 1QH6A 3G6JB 1Z7S1 4CCJA 3ES4A 2X9YA 4J1WA 5FNVE 4AQGA 3IDAA 5J2TE 2R042 4D7TA 2HWB1 2A7AA 2XOZA 1OSGA 4FXGB 3M4FA 2YHNA 2CPTA 1RC6A 4MHRA 4B8EA 4FJOA 4BCUA 2Y64A 3C7HA 3KF5A 3WNNA 3ZCIA 3HN3A 1W9RA 2ACZA 3L09A 3USUA 2VKHA 1UGOA 1OMIA 3KFWX 5CB4E 3DQVR 5J3XA 2BWAA 3TLWA 2E5VA 5FO9B 3OB8A 5ERLA 5A1FA 3O1VA 2A6YA 5JDMA 1PX3A 3FUQA 3HR9A 4KWLA 4YZ3A 3WD5A 4A42A 3ZMNA 3RZHA 3ZPV1 4CA9A 5I8YA 1NX9A 1WLWA 4ZOLE 4C91A 5L7OB 5A3TA 1PZ9A 4XF9A 5C9AC 4B1MA 2PHTA 2MKEA 2QJVA 4MFRA 1NAEA 4WNKA 4OQ9A 1PMHX 4HKWA 3RYFE 1REFA 3WNXA 4I3PA 2CV6A 2RDQA 1PIV3 2KGIA 1NQJA 1YFXA 3BVCA 1FPN1 1LEMA 4AP4A 4W8JA 2ZETC 1ZKEA 2VJFA 1FMD2 1UXXX 5EYXA 2RS33 4LIVA 1GNYA 4A4BA 4Y20B 1ZBDB 5JVDE 3ZC0A 1F4AA 1RHI1 4F7ZA 2DUQA 2B9VA 4EN6B 5EJ3A 3CKDA 5IJRA 2OYZA 1UMZA 4QQ4A 5LB6A 2JMJA 4LO8A 2W47A 2VJXA 4NHYA 1HRI3 1GZWA 2FDHA 3MV11 4GNFA 4JYAT 1ZZ9A 5L7OC 4EEBA 1PMJX 4TSVA 1JZ8A 2D2SA 4CCMA 2OS2A 2XM1A 5CG9A 2R16A 4XF4A 5LNKA 2CWMA 1WMEA 4DNDA 4UWDA 1SMVA 4JC1A 4UFKA 2ZXQA 5E8AA 1KGYA 1LAJA 5AITA 3IKWA 2R061 4BBQA 4R4XA 4Q8KA 1U5YA 3PUZF 5LWBA 3OYZA 4DUYT 4JTOA 2VJFB 2VCCA 2WQZC 2VB6A 2VPEA 3NJYA 3WR0A 3THTA 5C8CC 2X9WA 1W8WA 1JYTA 2XJ7A 4BQ1A 1ZEEA 3BALA 4WM7C 3VBOC 1QMJA 4JI5T 2J1SA 2E53A 4FJCA 2OXQC 5LKXA 3GNEA 2VD7A 2QQVA 2BKNA 2QQJA 2IVJA 4RHV3 3HMYA 4F6RC 5IHYA 3GF6A 3T1MA 1J59A 1LGNA 4YW5A 2CT2A 3RC3A 1Q5OA 2R0HA 1C57A 2XL7A 5FY7A 2ZGSA 1Q56A 1CZTA 4HXCA 3BOPA 1UY4A 4MBQA 1CX4A 1OF4A 3MW4A 3JUUA 3PUIA 4N7UA 2VWAA 1JHNA 1FP0A 2DVDA 2KNDA 4XJAA 2IW5B 1LHWA 3ZR6A 2KWHA 2HEYF 3K48A 1TEIA 3EI0A 1N47A 1RUE2 3W58A 4Q5OA 4CXXA 3NVCA 3TN91 4AQFA 3H3ZA 1SFYA 4BJNA 1HN0A 3FHQA 3I2IA 4GH4B 1T72A 1QJU3 5ISLA 3UFGA 4RQPA 4LA3A 4CTEA 1OUSA 4HK9A 3AE3A 2H0BA 4OGEA 1MZ6A 1H8TA 2DVGA 2KYUA 3EB6A 1RJ8A 3H7YA 5EFUA 4RGAA 4XUPA 4DIQA 2C9AA 2GN7A 2E31A 5FK8A 2JWPA 3LPFA 3HQRA 3FZMB 4EYUA 2WR9A 2WRAA 4E2QA 4ZONA 4CN4A 1W9SA 4K1YA 3NL1A 2V7JA 1FPN3 1XE0A 1HRI2 1A8MA 1IGOA 2LXHC 3TOJA 1CIWA 2WZ8A 2DWGA 4U2YA 4YW7A 3ANWA 2YY1A 1D0ZA 3Q5XA 4XFHA 2ODUA 3FL2A 3ZPVE 2CRBA 2WBKA 3UUMA 1HNWT 3PUHA 3AVRA 3MLKA 3DPRA 2ECNA 2MA6A 4U72A 4I0AA 1DQ2A 4IEUA 5EJZB 4LLFA 1HV0A 1AR72 5SVIA 4XAEA 4ZI2D 3BGAA 3Q8CA 2BFUL 3O14A 4YGDA 1G86A 2NLRA 1PO22 2L7PA 2CA5A 3PL0A 2QQLA 3TEYA 4BK4A 3HA4A 1TG7A 2V6XA 3C4XA 4LPLA 2PHFA 1QIQA 2WU2A 3OD4A 3Q5EA 3E22E 3C7FA 1E5SA 4O4HE 2MPKA 2JIJA 2A72A 1NXD1 4GA9A 1B7TA 1F4HA 5FZAA 3N35A 1PVXA 3KBUA 4A4AA 4JZRA 3O4XE 3MUY1 2FUUA 1W8ZA 4Y33A 3WX5A 3W5NA 1ZNPA 2Q1MA 3MJXA 2MOZA 2Z4FA 3WDVA 3T0BA 5FIXA 2JE9A 2C2VS 2W2IA 2XY8B 1GBGA 1UZVA 3L3PA 2PBIA 2CBJA 3AP7A 2J62A 2VTXJ 3AEBA 2X53S 4DUXA 3C7GA 1XU1A 1VBD1 2YB7A 2ZX2A 2RMU2 4NJ4A 2I6HA 3NW4A 1U5IA 1XBFA 5A33A 3OEAA 1OT5A 1GV9A 2ENRA 5DQVA 4DB5A 4CCCA 2C5IT 3WW4A 5H6QB 2P6HA 2LGKA 3ZMZB 3QNUA 1YXWA 3WF2A 4HFBA 3KDEC 1QJU2 1XJAA 3C50A 1CHUA 3AYDA 4UV9B 1X9PA 4DR2T 4FPCA 4UW5A 2M6BA 5A7QA 3M2MA 2K2SA 2C9KA 2K16A 4V1Av 1S35A 2R1BA 5I0UA 4C1WA 2E7TA 1D0XA 3ZSJA 1HCIA 3QUJA 4ORFA 4TNVA 3P3PA 5T5OA 4X8PA 1JZ7A 4HTEA 1F5FA 1CR7A 3ZXLA 1WFDA 3ZXGA 3ZYIB 3MZKB 2YROA 3ACHA 2Q9QD 3AZXA 1UX4A 5FP8A 3M3ZB 4KL1A 2ZHMA 1LOBA 5LKZA 1COV2 4NIAA 1IBLT 4XF3A 1VCTA 2AUYA 4XHXA 4UFLA 2JD9A 2HYXA 1DQ6A 1JUHA 2GC3A 3T4VA 2ZGOA 2BG9E 3OUJA 2VY0A 3VGIA 3CLPA 4OUSA 2EXUA 2M67A 4A44A 1U12A 4AVTA 3P1IA 3PUXF 1P8JA 2XPJA 1FATA 1R1ZA 4EV6A 1VR3A 1UUSA 3M99A 3S7IA 4LF4T 3URFA 2MD8C 5BV6A 1MQTA 1BKZA 1JYCA 5DAPA 4CDXA 4K3UA 4LOTA 3VZMA 2ARCA 3S6PA 1G9BA 1HF8A 5KR7A 1PM7A 1JTZX 1W0BA 1CVNA 2D3SA 4WBBA 3HL6A 4XDOA 4XBFB 3WNKA 4YXDA 3ZYMA 3NWKA 1AZDA 4AGGA 2UXCT 3K46A 2P1BA 3H3UA 3LPGA 5LW9A 2VC9A 1Z60A 5HCFA 1XYPA 5F2WA 5HXMA 3OBVE 5IYZE 4OUMA 4Z0OA 3AP6A 4Q0VA 4TLFA 4AFMA 5A3WA 1VBA2 5CVRA 3WF1A 1GU3A 5I0DA 3N4MA 1H4HA 4LHNA 3NJXA 1QJFA 2LT3A 4HEAA 4PJMA 4JI4T 5G04B 2VPVA 3IIIA 1EV12 1W99A 4RHV1 4IE0A 1W0NA 5CFCB 1WR6A 4GMP0 4AYCB 4HFCA 1RUE1 2XQAA 4HFHA 4AR2A 4M4RA 3A0NA 5IFPA 3LJUX 2E9XA 3WDUA 4QX7A 5K7PA 2WA3A 3E6CC 3IAQA 5F7UA 3GBFA 4LKDA 5KXCA 2XQ3A 1J1TA 1VBB3 3RIFA 5D1LB 3ONLC 3WCRA 4GKJT 1O3XA 2AXDS 1W6PB 3MLLA 2Z42A 4K6BA 4W6XA 1KFYA 3ETUA 1QUUA 1UURA 3RX6A 2GK9A 3MHZA 4TV9E 4LFCT 4NR1A 4OHZA 5M4YA 2ZEZA 3TRSB 3UT0A 4DPNA 4LFBT 3AL6A 2B8MA 4AFAA 3E6DA 4LITA 3VL8A 3JBG2 3ZX7A 3AYEA 1N34T 5FP4A 3TNPB 4A5XA 3H3MA 1VMHA 4Q25A 1ND2B 5B75A 4U2AA 2JIWA 3I3BA 4ZHQE 4BQYA 2BKOA 3A8YC 5JMCA 2J1VA 5A1AA 5FYTA 3CDZB 2DVFA 2K0GA 3M3IA 1OPMA 3T30A 4LO4B 4TLGA 1QHDA 2QVSB 3KHCA 1WEVA 1NZCA 2LHNA 4LLOA 3DXTA 2Y8KA 3TWIA 3MKDA 2UURA 5HXSA 2G19A 2D6PA 1HN1A 1FBVA 5F9TA 2XP0A 3JAEA 2W62A 3V5SA 2M1RA 4U31A 4N43C 5LP6E 3KGLA 1HXS3 2XUMA 3E2DA 3I4IA 4HVRA 3U11A 3WP6A 3RYPA 4D6QA 4CN1A 3CZUA 4IV3B 4KHPT 3H7HA 4LBJA 2W1QA 3LVQE 2CY6A 4BMBA 4XC9A 4A6SA 4CZZB 1ZRFA 3ZYGA 3RPQA 1M7KA 1WBFA 3KHBA 2R063 2RS32 3NRYA 3K77A 1KNRA 4DY5A 1MS4A 1RUH3 3I59A 1K42A 3NZPA 1JM7A 4XUQA 3C5KA 2A3WA 4Q0PA 3PMEA 2AREA 2AZ5A 4A2UA 1LVKA 4NVPA 3IPVA 4TTGA 4BQ5A 1E57A 1IJ5A 2HBTA 4Y22A 4H9DA 2IXHA 5L9VA 1LRHA 2UZGA 1F35A 1RUJ3 4D0QA 2RDRA 3GALA 4XDQA 2GU9A 1BMV2 1BBT2 5FYIA 4IC2A 2NWBA 4XUNA 1JODA 1R1A1 3NNFA 2E2AA 1IPKA 5SV8A 1E5HA 2X5IA 2LSYA 1CX1A 4CCNA 1SLBA 2IDAA 5FKYA 4PW8A 4NOTA 4X1IE 1GQGA 1NCRA 4O7XA 3ZXAC 4FO9A 5LKTA 4LJNA 4NMIA 3RZGA 1I94T 1VBE3 4AFBA 4WM8C 1N36T 4AISA 1GNZA 4YTPA 4Y1YA 3NG2A 3SMHA 3W20A 3OKQA 4MXWB 3LOBA 4HBNA 2WZEA 3D0SA 1O3RA 1M06G 1S0FA 4NN2A 1V6OA 4BHWA 5FKBA 4ZI3D 5FVLA 1YQ4A 1IPJA 4LHSA 4AHWA 1YUDA 5HI0A 1KEYA 2XONA 4IGQA 3VDDA 1GP4A 4P9JA 1KDKA 1Q8PA 4Z8BA 4AI0A 5I3LA 5JOYA 1NCRB 2CGOA 3ST7A 2XQ7A 4YVWA 5HXHA 5JR7B 2XPKA 5FUIA 4S2FA 4QF3A 5L9BA 1GOHA 4XXPA 4MH0E 1MS9A 2VOKA 1JNZA 4FP2A 1YQCA 5GLZA 3FJUB 2XJTA 5DUUA 3JQXA 3POIA 5AQPB 2YREA 4COVA 2D98A 3NBXX 4YGBA 2P4EA 2UXNB 4QXHA 2BPA2 4KWUA 2YURA 4IGOA 2FDKA 3AE8A 5JOWA 3LG7A 1XQNA 4M3CB 3X1DA 4ZU5A 5DINA 4XF0A 4TX5A 2R062 4BB3A 4YJ2E 2WT1A 2A6VA 1MZFA 3O0WA 1IS4A 2H6BA 2WNUA 4FPHA 4BQXA 4A0CD 2E8IA 4CRQA 1OUXA 3UU5A 2AENA 4GZ9A 4BM8A 1LB2A 3ZYRA 4QU1A 3VBFB 4H14A 5T5JA 1W03A 4ZZCA 5BNNB 1POV1 1NA1A 3OY8B 2QNKA 2V4VA 4ATFA 4V3KC 4QX8B 4IEPA 3WW1A 4I7BA 3FX3A 3AK0A 5D1IA 1MS3A 4JBWF 2WNEA 5SVIB 5LG3A 2EGMA 3HI2A 3ON7A 3IMMA 1DP0A 1OVSA 3AMNA 4O61A 5LK7B 2M3HA 5IUXA 5F37A 1GWLA 4JCKA 1SCSA 4Z8XA 2K4DA 2PJQA 5FMOS 4EN0A 3QACA 1RITA 4JI0T 1ZVFA 3BB6A 4IV3A 1IZ3A 5CIRA 1HJGA 1UY1A 4NIDA 1QJX1 5A6QA 4WVZA 1XC6A 2WAAA 1D4M1 4B3ST 1U5ZA 3KGZA 1YFWA 3VBHA 1Y01A 3BK9A 4ANJA 1OLMA 1IHMA 3KCYA 2Z2SB 1RVF3 4JGYB 3ACGA 3WNMA 1XNDA 4CI3B 4BA9A 2ERFA 2YUEA 4B4PA 4G2AA 5LHGB 1Z8UA 5JH7E 3ZJ2A 3LDKA 3IWZA 4NIGA 3BU7A 1ZZ7A 5FZLA 2P57A 2PFWA 4YM1A 1RXGA 5IK8A 1JOCA 2EIDA 3BIEA 5E1RA 2WZR2 2A9UA 1SBFA 5JSPA 2G9ZA 3AL5A 4INDA 4U33A 3EXUA 4UXAA 2YVRA 1IBMT 3SLIA 5F3EA 2P2KA 4AWDA 3D0TA 1ULFA 4X8NA 1NLQA 3B57A 2DJAA 4O4LE 5EWSA 4UV8B 4XJZA 1RUG2 2XM2A 4R9CA 4D3WA 3ZFEA 5FTTC 1ND2C 2E9XC 2HJIA 2R49A 4B6XA 4HWCA 1W2NA 3ZYQA 1QXRA 1UX7A 1SFPA 4F52B 4D7SA 3W59A 3SOUA 3M3OA 3VBHC 4PIYA 4YTMA 1FOD1 2ADDA 3IM0A 1POV0 1N1TA 1VCSA 3Q5DA 2B1EA 4PDWA 1MIWA 3JADA 3UU6A 3FFQA 3VHOA 1E2AA 4JLEA 2WS91 2ECGA 1RUH1 5AFBA 5KC5A 2WFF1 1RUG3 2CCQA 4P9LA 3P5BA 2KT9A 2DTWA 1CN1A 1V9DA 1O3SA 1HXS1 4CCKA 2XH6A 1OOPA 3N7LA 2E6RA 2IMLA 2FMYA 4K8RB 5FEYA 2QZ3A 5EZWA 2WNUB 2Q8OA 4FPFA 1ASJ3 5A6ZA 1I5ZA 2X0LB 2MHFA 2WWSA 2BG9A 2CL2A 5A7PA 4FAGA 2CGPA 2VW0A 4D94A 4GNEA 3H8RA 4CA1A 2RI7A 4EWAA 1WEEA 5K9YA 2VZUA 3AAAB 1DBNA 2W61A 1NE6A 1DCQA 3BTXA 1LOEA 1G7YA 4NO4A 2ES0A 3VKGA 4NPRA 5KXDA 4BE3A 2YV8A 4FOYA 3C64A 3CEWA 4QWNA 4G9SB 1JOBA 4IE4A 1Z78A 3O1SA 2VZ3A 2X10A 4C1XA 2VE1A 2ZMLA 2ECVA 3I2KA 4QPGA 1NWMX 2ZABA 3VLBB 1VBC3 4I09A 2M6IA 2B42B 4Y4RA 5JR2A 1ZRDA 4I2OA 5K4LA 3AZVA 4QX8A 1UL9A 3O1OA 1H9PA 5FZKA 2OT7A 4RR3C 4D7YA 2WDVA 3SITA 1ODNA 2VVEA 5D1MB 1PIV2 5FZOA 3QZVA 1S4CA 3SXWA 1LESA 4IEQA 5HEJA 2ZBJA 3SNMA 2I07B 3JBG1 5LASA 1V0AA 4CUCA 2V6YA 2B9UA 2BTVC 1SA0E 3VDAA 4NROA 4RL7A 2VW2A 1D2SA 2ECIA 2X67A 2OX0A 1DZRA 2DCYA 5C5UA 1QOTA 3ZPOA 4ERRA 4FI9A 2IDOB 1ZRRA 2QQMA 4W50A 4PF1A 3I3MA 1F31A 1W90A 3MIFA 4XACA 1RUH2 1DG6A 4L9IA 1OA2A 4RR3B 3K1SA 2XOCA 1H6YA 4RYDA 4HVQA 1ASJ2 4YT0A 4ZUXU 5AC91 2ZMKA 3WF4A 4FFFA 3TNQA 5FXZA 4PHZA 1UU4A 3HKBE 3R4SA 3HCUA 2XAJB 4Y5SA 2LUWA 2QE3A 3DPLR 2CWYA 4XI1A 2VVSA 3LEKA 4GWNA 4MUVA 4MGSA 1LOGA 4Q4Y3 2VZVA 3IBMA 2I74A 3ZT7A 5F2SA 3T2QA 4YGCA 1OD3A 2AEZA 2HWC3 2Y60A 4CDXB 4NHLA 3MA9A 3EVYA 4CYDA 4Q1RA 3B00A 1WEMA 2R041 2GN3A 3DXUA 1BVVA 4LTAA 2AC1A 4Y24A 1VRBA 4CDQB 1YRZA 5LEJA 4COWA 4J25A 2C26A 3Q8FA 4FPYA 3WQ0A 3ORJA 3B7MA 4IT4A 5JREA 1HB1A 4QMAA 5EYAF 1URXA 2YYOA 5CGMA 4WW0A 2VG9A 2RHPA 2Z79A 5FPAA 4XXAA 2VZPA 1LULA 4NHKA 4UEMA 1M62A 4E4DX 4XEZA 2UWAA 2ID4A 1LR5A 1XOYA 5LGNB 1YQ3A 4OHYA 5IYYA 1O91A 3FC0A 3ZN4A 1KEXA 3ETPA 1RVF1 2WDBA 3AEGA 5CNAA 2MEV2 3KQRA 3MW3A 1Q3EA 1SHWB 3H42B 3KDSE 1UWWA 5AQKB 2HWF3 1W9FA 1WYCA 2EHOC 3LDQB 1WW5A 3AMQA 2BG9B 5EP9A 2Q5TA 3OJAA 3ZDVA 5BY5A 1ND3A 3MIEA 5B79A 3M7KA 4QH1A 4AAXA 4PJJA 3TLVA 4AKGA 3I8TA 1KS4A 1UOGA 3FMGA 2LHRA 3OYXA 2JDZA 2ZOEB 5AQJB 2VH9A 3ZMTB 2EAKA 3H50A 5ACA2 1DCSA 3VZJA 5JWPA 3MIDA 2GP5A 2R072 4DV1T 2J1RA 2ZGTA 5ACA1 1I6ZA 2A1XA 2WABA 2JDAA 3BPZA 2VASA 3CWZB 3RVHA 2W68A 3DYMA 1GZTA 2FJAA 1XNCA 5C2TA 1JXNA 4CDWC 5FPUA 1V6IA 3OTFA 5CFDB 2CDPA 1FOD2 5TABA 3CQOA 4DR1T 5LXTE 5KXBA 4BK5A 1ZREA 3ZFFA 1GKBA 2VAUA 4Y1ZA 3TEZA 3ZFEB 5KH7A 3VN4A 1ZA7A 4ITCA 4N43A 2J1DG 3SOWA 5FDBA 2QQWA 3H8UA 4LK9A 1HNZT 1X7NA 1GYKA 1Q8VA 3ONJA 2MEV3 4U3CA 3HEIA 1VMFA 1FXZA 4OMDA 3L8RA 2KM2A 2D6NA 4QXCA 3JUEA 2YOEA 2WWVA 3VD9A 2BGPA 3KT4A 2D9DA 2VQUA 4IE5A 4MGTA 1CAUA 4BYYA 3AP4A 2HWF1 5I8TA 3OF1A 1LTEA 4DV0T 3LD8A 1F15A 2HDPA 3PUQA 5FRAA 5JDFA 2XWJB 2PUYA 5HCHA 1PVC3 2WS3A 1Y64B 4AHZA 4CZSA 3BUCA 5C11A 1BK0A 3LE0A 3WXPA 3U5PA 1C28A 1PO11 2YZ4A 2NW8A 3QCWA 5A32A 5HV0A 4QX3A 4UVAB 4P9GA 2PAKA 3NJVA 1FMWA 1KNPA 1UYYA 4YFZA 2ZX4A 4QHOA 5FZ7A 2PHXA 4B86C 2V4AA 1L0VA 3B5MA 1H2KA 3PUWF 4KMQA 1NA1C 3B9IA 5K0UA 1RXFA 2YFUA 4M3CA 2E7AA 4Q29A 1HRV1 4ES9A 4JKMA 1VB2A 4GULA 1I3HA 3ZXEA 1TME1 1VBB1 3QD6A 3AP5A 3RRWA 2VECA 4DMWA 2BBHA 3LIHA 4W4UA 5EYYA 1UAIA 5FOBB 2RR12 4GWJA 4U2ZA 3W15B 1FAYA 3RS6A 2CONA 5FPXA 5FPZA 2QFEA 4AKLA 4EOZB 4TZDA 2FD8A 5CADA 4B1LA 2QZ2A 4CEWB 1WMDA 1FX5A 5CG8A 1T8BA 3DKQA 4MGYE 3HNMA 1UPSA 4B3NA 2W0XA 2XJQA 1UF2C 2W67A 1GMMA 5JG6A 5JQGE 5JSOA 3TLSA 3GL6A 2IC1A 1H30A 4W65A 1X4JA 1LEDA 3HBKA 3A21A 5FBZA 2ZGMA 4V3LC 3AXJA 2RS53 2DHRA 5C8WA 3KCCA 4QX0A 5JRCA 2ARAA 1QF3A 4YG6A 4ONUA 1G9FA 3RRDA 3WDYA 2EXHA 2VMCA 3FHNA 3E5XA 5E89A 3LK2B 1D0HA 3JB8A 3O35A 3LVRE 3I2FA 3ZSMA 2PTFA 3ZJ1A 2PHDA 4UW4A 1WMXA 1BK1A 3HPNA 2JXAA 4TZ4C 4CCEA 3NNGA 3RQWA 5LK5A 2BVVA 2ZX3A 3APBA 2ARBA 5F3IA 2F17A 5DZEA 3WF0A 2YQLA 3IDBB 3OG2A 5ADXL 1PVC2 2VM9A 1D4M3 5L36A 5F5WA 3DYPA 4O65A 5G05B 3M8LA 3GM8A 4RN5A 1UZWA 4Q0SA 4QQ2A 1PGW1 2JG8C 3P4PA 4Z82A 1G25A 3POJA 3ACIA 3CX6B 3H8XA 2UXXB 2GC0A 2B76A 1YIPA 3IMNA 4QF2A 2CTVA 2J1TA 4NRPA 3ZMUB 2XOMA 3CBNA 5BYNA 2OZ6A 3PU8A 1YQ5A 3PUSA 3PHDA 1YJKA 3IIAA 1HRI1 3WF3A 4CP9A 2XBO3 2YDEA 3VBSB 4FPOB 2LDRA 5KHKA 4CE8A 2JD4A 4PF5A 2ZJCA 5B8DA 5FPVA 5M0TA 1IS5A 1X50A 2JG9C 3VBSA 2UXDT 4DR5T 3UJQA 4CU8A 1J1JA 4LBOA 5FL1A 1MMAA 2J47A 4MGIE 5C6CA 5JDGA 3NVOA 4YFSA 2XLFA 2XJSA 4WM8B 4K0KT 1BEV1 1SLAA 1RHI2 3S57A 2MPFA 2VNOA 5GZCA 4GIWA 1R091 3P4WA 4BQ3A 3CX7B 4QPIA 3VBRC 4RGGA 4YSXA 2OA2A 1VRH2 1E7PA 3BI3A 2XLAA 2RVAA 4FTBA 3PUVF 4ZU4A 5EXOA 3UGFA 4E4HA 5LBBA 3ESLA 1JNRA 4IEVA 2VVDA 4Y1VA 4LORA 1JYNA 3I3DA 5LHIB 1VD4A 3MF9A 4IGUA 4KBZA 1JH5A 2CEAA 5FYVA 1AL21 2X5IC 2OKXA 3RWKX 3O9XA 4RR3A 3LDRA 3P4QA 3HN1A 4XTPA 4CQIA 2MD7B 4ILCA 2WNVA 1CJDA 3N9MA 2YU1A 3BYWA 2L0BA 2LGLA 3EABA 2R071 3THPA 1CHCA 1QQP2 4DV6T 5IVEA 3PJAA 3B69A 2RA1A 1RUG1 3EAMA 1QH7A 4Q8LA 5CFDC 3FJSA 2JQ9A 4YHJA 5L47A 2DVAA 4JGZC 4QDSA 1DZQA 2W2UA 4XW3A 1GQEA 3P6BA 3P4RA 2KWOA 1WD4A 2IVIB 3LSEA 4EWEA 2O14A 2ZM6T 1NE4A 4P5OB 1K12A 2K9ZA 3P4SA 2RG4A 2VQET 4FPJA 1W8UA 1BJQA 5FB0A 3H1MA 5LMUT 4S2DA 1MM2A 5A7WB 3RKOA 4HSLA 5FP9A 2D93A 1DQ1A 3CJIC 3OYWB 4W6YA 5A33B 2XKOA 3I3EA 3MHHA 5ANQA 4IV1A 3RI5A 5FVKA 2NYYA 2G43A 5BNNC 2JQHA 1HG5A 3TB0A 1WEQA 2VPGA 4YATA 1WBLA 1FPN2 3KD4A 3H1YA 5IVVA 1QXPA 2WM9A 4JI1T 4WZ2A 1HFAA 2CDOA 1PK6C 3Q9DA 2D6OX 3QB5A 4LT5A 4RQPB 5EK2A 4E2SA 5F3GA 2VBBA 1QJY2 1AL0G 3OD0A 2ZCWA 2P34A 1OPOA 1R092 2E9QA 4H55A 1MMGA 4FSJA 3TYJA 1DVPA 4AQFC 3ZEFB 4XABA 4HANA 4NRMA 3DPRB 2DVBA 2WDRA 3ES1A 1OWAA 1WR0A 1AX1A 3N7JA 2V7MA 3WP4A 4ZXKA 3ZYJB 4N9HA 1W2UA 4YBSA 4EZHA 2WC2A 2KLQA 3QH6A 3ANWB 2CU5A 3CMGA 4IUGA 4O9GA 2E9XD 2VOWA 4ASLA 1SE7A 3UKTA 2R6QA 3AP9A 4Z90A 4LF5T 1UYZA 1YXRA 1NT0A 2BW8A 4M00A 2EGPA 2HH9A 1GOGA 3GBWA 5HEOA 1T98A 5IFTA 3S30A 1WYBA 3K3NA 2G4IA 4ZKTB 1ENSA 4O2AE 5L3BB 4GH4A 3EO6A 1OVPA 2VL8A 2WZR3 2ECWA 5CISA 1OQEA 3EYPA 1LVFA 5L3DB 5DUXA 2VURA 3POBA 2DL1A 3MGUA 2WBLA 3KT7A 5L7OA 2GZWA 2JJ9A 1C4RA 4FXKB 4LKAA 1UY2A 1X33A 4LQRA 5C3QA 1CONA 2E9XB 1H2NA 4IDOA 4WVVA 4YM0A 4H9SE 2RR11 1WCRA 4B3RT 3VBHB 1Q8OA 3JD73 5KX5E 2E32A 5BNOA 4ADZA 5C4WB 3ZFGC 2OQ7A 3JCIA 4JHTA 3ZOIA 1AJ3A 1XWHA 1CQ9A 5K0UC 1N87A 3E97A 2VUDA 3ME2A 5CAZA 1XDOA 4JX0A 5C9AA 4PTBA 1KS5A 1ZYBA 4EQVA 5ABFA 1EUTA 4JV4A 4NWVA 2V7LA 4ZZ8A 1XWMA 5EQUA 2RMU1 4HL0A 1GANA 3H37A 2YDQA 3AKTA 4Q2FA 4I01A 2MNGA 3NV4A 5J3UA 2HWD3 4WBNE 2ZACA 4ZXLA 4YWAA 2C2LA 2ODVA 3BQLA 2WMOA 2V5CA 4KWJA 5F5IA 4IV1B 2WSVA 1KDMA 4LMKA 5EJ1B 1NENA 4YTNA 2VUCA 4DFSA 1AR81 1HLCA 2DI4A 2FFWA 4OZXA 2Q8CA 4JI8T 4HKAA 1EUUA 3LFMA 3T9KA 4OCTA 4K0UA 2XR4A 3LWCA 4I30A 4ISSA 2C0ZA 3WW3A 3HD8B 2A6WA 3M3EA 2GMEA 5EPAA 2QTWB 4NUBA 4Q4W1 2QBXA 4A98A 2CGNA 5F39A 2J4GA 2Y6HA 3AE1A 4ZI3C 3I54A 4QX7B 4QGMA 2XZEA 3IHRA 3N9QA 1J3RA 2FZ1A 4X6QB 4H63V 5IUQA 4QPIC 2VNVA 2A2FX 3GMIA 2EIGA 1UOFA 3LB9A 5JXGA 5L2LA 3C98B 5AC92 3ACLA 3N9LA 1MZ5A 2VTXA 5FLIA 4IERA 2L5UA 3BTYA 1SBEA 4P14A 1W2AX 2R043 1KITA 4Z92B 3H3AA 5DPNA 1JOJA 4AQ2A 2JDMA 1ZBE1 4CDUC 4UP0A 5T5PA 2OPKA 1ZA4A 2E33A 3ZVXA 2HHHT 1VBD3 4U74A 2CHNA 3AB3B 5FMCA 2GSYA 2MNYA 1MVQA 1MBMA 5EV7A 2OW4A 3CK6A 4Q4V1 4XMIA 3I1AA 2CHOA 4LBMA 4E8DA 2JB4A 4WYVA 4B7YC 2D43A 3WY6A 3VUOA 3VDDB 3O5SA 5JVVA 2CAVA 4CVUA 1GLHA 1YKHB 1LDKC 4IESA 4FTSA 4UELA 2VKJA 3J7HA 2D5HA 4DNYA 1OHFA 2WQYA 2YU2A 3LQJA 4SLIA 4UFHA 3L2YA 1RUI3 2JDKA 5GJ6A 1VBA1 5J36A 1AL22 2W9XA 3KB5A 1HQWA 2VZ1A 4UI9B 5F5CA 4YW3A 3OGRA 2LN0A 3HAGA 1BLZA 2O8QA 2VL0A 1G9CA 3FZLB 1XYNA 4AHYA 4CDQC 4HWHA 1PVC1 1R093 2XHKA 3B3QE 5GLWA 4XUOA 1QQP1 1HYIA 5SV5A 4FFIA 4MLOA 1WCQA 2J1EA 4A45A 1PO23 1QNYA 3RIUA 3LAGA 2ORZA 3UKNA 3NV3A 1JM7B 3H1WA 4I02A 4KGQA 5C13A 1QJU1 1JZ2A 3Q1DA 3MHSA 3POYA 2ZGLA 5DUWA 1Y4WA 3RZZA 2P3JA 3O1MA 4AAPA 2NTYA 2P6CA 1HTJF 3MI8A 2JIGA 3S4UA 5K3QA 2WS93 1OEDC 1K5MB 4TN7B 1UXZA 3NRUA 2F4PA 5TBNA 3I0OA 2X09A 4IL9A 2KZ7B 4EB6E 2GNDA 3EB5A 4CUAA 2WJSA 3WQBA 4URAA 3ZR5A 4WVMB 2W91A 1YQ8A 1X9BA 3AXJB 1NCQB 1WLXA 2JPFA 3SFDA 1CAWB 4PQQA 3UKVA 3VU7H 3T8OA 4A56A 4XFBA 5T50A 3WG4A 2KIZA 4P5YA 5C4WA 4GYRA 2HEWF 1RUF3 2D97A 2FUPA 3L1ZB 5AQQB 4DV7T 3EHKA 2V1DB 2KKYA 4UF0B 2SLIA 1F5JA 5CKQA 4PLMA 1MVEA 2D0UA 3O34A 2V73A 4KI0F 3OVUA 3OOXA 1IKQA 1IPSA 4H63H 2Y6XA 1QU0A 4QM9A 4JAAA 4COFA 4WVMA 2J22A 2YEVC 4QM8A 3CQXC 4ZZBA 4XURA 2N9DA 1WA4A 5FYYA 2E5LT 1IOAA 2BEOA 4N53C 3WAKA 3A5XA 3KCXA 3NKGA 5D8AA 3JBG3 2DBNA 3FBZA 2AN6A 3KV4A 1LOFA 4QHBA 1E4UA 5KC6A 4B7EA 4IEWA 3MZHA 1BHGA 2BGOA 3F2EA 3I2DA 4Y3OA 2EA7A 5FY8A 2Q9QB 4UVCB 3VBUA 3DCQA 1FNZA 1PZ8A 4LEJA 2ZS6B 1IKPA 2BVMA 5FCCA 2XQ8A 2HWD1 3HKEE 3HTKC 2P17A 5C4WC 1W9YA 4CEYB 5LA0A 4XJ8A 5LBFA 1W28A 2GC2A 2X51A 3K75B 3C7OA 1RHI3 1NZIA 3J9X1 2QA7A 2O8OA 4BA6A 2CE7A 2ET1A 3U0ZA 2WWJA 1GZCA 3D0JA 1C8M2 1S0BA 4XILA 3ZIXA 4PBPA 2J1AA 2TUNA 4ZDTA 1HRV2 3RDIA 5G0FA 2NTXA 3BQKA 5LZ6A 1BBT3 2VNGA 4OHVA 3HCTA 4DV3T 1ZRCA 3M65A 2BV4A 2WN3A 2NOXA 4LK6A 3RPUA 4XZUG 2BOJA 1ZP0A 4OLLA 1AR63 4FAHA 5I0RA 5JCTA 1VP6A 1HG2A 1XE8A 4S3OC 4NIQA 1MS5A 3ZTGA 4MG2A 1MS1A 2P3KA 4Z2WA 4GQ7A 3B93A 2P3YA 1OEDA 2KWIB 2XJVA 1QJEA 2CSZA 3V0AB 4GWMA 2PYTA 2GMMA 3MLJA 3FLPA 1VPHA 1PIV1 3PURA 3RKGA 3VRAA 4Q27A 3P3NA 3LK42 1SZBA 1U5PA 4AVCA 5AQUB 1MEC3 1YC61 3BCWA 4QDQA 4L9BA 2QRXA 1OXZA 3JQWA 1Y9GA 4TWDA 4F3JA 3FFZA 3R6NA 2ECTA 2H7VC 1T2XA 4W6WA 4I0WB 2R073 5HEUA 2VBPA 5A7SA 4PLNA 4YAXA 4DUVA 4XFIA 2ZX0A 2LLYA 1H4GA 2IUWA 5ABHA 1ONAA 3VBFA 2Y38A 2PXJA 1BEV2 5EK3A 4GKXA 4JVAA 2VKOA 4EXTA 1XPWA 3UL2A 2L80A 1QY4A 1XNBA 4KG0A 4I50E 1LHOA 3RF1A 3KV5A 4Q4W3 4NWWA 1DU2A 3U4XA 4A7ZA 4TWTA 2VZRA 3FEHA 3MDBC 5F6LB 2PMWB 3AZWA 1NLSA 2VR4A 5CA0E 2M13A 4YSFA 5HCBA 2SPCA 1WCUA 3KWVA 3E5UA 4B7KA 2PN5A 5CFDA 2JM3A 3VDDC 3P7IA 2FBEA 4YC9A 2VQTA 1QDCA 2UUCT 1T7SA 1UOBA 2UYAA 2D40A 3MIBA 1XB9A 1V9U3 2L3LA 3VBFC 5GZGA 4ZQLA 3LBXA 1GWKA 2B5HA 1CWPA 1A6CA 3MW2A 5HPOA 1FYUA 5J98B 3C4WA 1UKRA 2LXPC 2WQ8A 5AQTB 5AIUA 2DNXA 4BIOA 4FBFA 3KQ4B 4DUWA 1ENQA 5FZBA 3RTRB 1WCDJ 1EY2A 5KXEA 3ETQA 5H1VA 1ZV4X 1GUIA 3VK6A 1JYXA 2BGCA 4J6GA 2RPAA 1RIRA 3I2JA 1QDOA 5H1UA 3O1HA 4OYKA 5KH3A 2HEVF 1H8VA 1R1A2 1RUNA 1EZ3A 4JI3T 4LMFA 1W8TA 2KE1A 4RHV2 5DXDA 3SCFA 5KH9A 1Y43B 4BQ2A 3FM8C 2WZHA 1EPWA 5LA1A 5JIAA 2BS4A 1JW6A 5DKAA 3LDYA 5IW0A 2TEPA 1COV1 1V6MA 1YFUA 5KDMC 5A80A 3MACA 1KJRA 2DBIA 1S0IA 3RWNA 4Y5TA 5JR9A 5HV4A 1W05A 3U14A 2CSVA 4R9AA 5J48A 1AYM3 1UK5A 2CYFA 1XYOA 1W8NA 3ITQA 5AQOB 4Q26A 3VHPA 3K8PC 5CEHA 4QHZA 5FWEA 3SS1A 4NPMA 4AQ6A 2A75A 2P5BA 2RJ2A 1XNKA 1W6NA 3I3QA 5FZ6A 2RS12 3GZTB 1AYM1 4LIUA 3KS7A 5IVJA 3OTOT 2Y33A 3O36A 3VHLA 2MYSA 2HN1A 4CU9A 5A3NA 2RS11 3SOLA 4MXWA 3I59B 4META 3U1XA 3USSA 3ZMOA 5C5TA 2X0YA 3LK3B 2QQIA 1FNYA 1ZOYA 1FMD3 4BISA 2VVNA 1CGPA 4I43B 1B35A 4AI8A 4QQLA 3AE4A 1Z2QA 2ES3A 5FK7A 5I91A 1HW5A 1KK7A 1YNAA 4URTA 4EV0A 4LADB 5FV3A 2CSGA 5AVAA 2PQSA 2XSBA 5GZEA 5FLJA 3ZFGA 1SPPA 5DG1A 2XAQB 3KSCA 2HWD2 3FHIB 4P9XA 3NKZA 2VK9A 2BERA 2O1QA 4M0NA 4EZ4A 3THCA 4PAGA 4CP2A 4JRLA 4JKLA 3E1F1 5IWAT 4HFDA 3RYIE 1QJX2 4R4ZA 4NUUA 3GDBA 4A41A 1FV3A 4XAXB 1QGLA 2A71A 4JV5T 1J84A 4DR7T 5A7NA 4FK5A 1TME3 4HFSA 1UMIA 4CEYC 1DLLA 1EV11 1ENRA 3NAPA 3VZNA 5FY0A 4AVVA 4XDPA 4N4FA 3B9CA 1R1A3 3BTAA 4TYSA 2ZMAA 1CZSA 5HWXA 3T7LA 1PK6B 2WKKA 2I2SA 4H7MA 4AEKA 1ACCA 4AOCA 4AEMA 1NLRA 3FLRA 1MMDA 5DDJ1 4L97A 2X66A 2XBO2 3A7MA 5ABEA 1UY3A 3O0VA 3M63A 4KH9A 5DMYA 2PHLA 4PFPA 3OBAA 4O64A 3R05A 2JJ6A 4UFMA 3HOBA 1LGBA 3C3VA 4OYJA 2XEUA 2ZM0A 1JU3A 3AE5A 5I0SA 2OV9A 1CESA 1N1VA 1HJFA 3AKQA 3ZO0B 5IAVA 1I9RA 5FZMA 2W63A 3B01A 4Y1XA 4H2AA 3SH4A 5BR8T 3A7QA 2H3RA 4A49A 1DYOA 1JZ4A 1RUD1 1HIXA 2UXBT 4NXNT 1WIMA 2C5DA 3ZNIA 3MIHA 4AI1A 3CPZA 4YW6A 2VZQA 2HPLA 3O0XA 1OC1A 4FP3A 3SFEA 5FZ1A 4GJYA 4M3CF 5JLVA 2ACXA 4Q4W2 3USUB 2WN2A 1UX6A 1V70A 3LEIA 3UQ4A 1XNRT 2LSKA 5A7WA 1X8MA 3WCSA 5FZ8A 4Q4X2 3ETVA 5KMGP 3A4UA 5AVPA 4IQPA 4CCDA 2LGVA 2C6SA 3THDA 1GZWB 1CAWA 4YBTA 2X9XA 4KP3C 3VZLA 3MXZA 4NHMA 4CI2B 1MZEA 3CF6E 3EHZA 2VOXA 1D7PM 4EE2A 4IDZA 1DGWA 3POWA 5H9QA 3TLUA 1GWMA 5ACA3 4UFIA 2K48A 1VBE1 4TKPB 4MO3M 5F3JA 3ZYBA 5LEKA 3VKFC 3I2OA 1XRUA 3R84B 1QQP3 5LCWL 1O4ZA 2RS51 2Y6KA 2QICA 1CUNA 2LKGA 2A73B 2B46X 4W4ZA 4XTMA 3AJZA 2KINB 4E27A 4AI9A 2Q1ZB 2Z69A 3C2UA 4NIHA 3KLSA 1LKXA 3RFRA 2CLYB 2E61A 1XMOT 5JOZA 3ZKRA 2WSUA 5FZ9A 3VRBA 5HEHA 2WNOA 4YARA 4PI2A 5JPNB 4O4IE 5DDJ3 3GJAA 4JEHB 3WSOA 4OHWA 3RQ0A 4LXLA 5HCJA 3TBDA 4OULA 4KGGA 4DQAA 2H88A 5C71A 2JG8A 2Y0OA 4N7IA 4DO0A 4AEDA 1UKGA 3ZLIA 2H0VA 4YW2A 3INAA 2Y6GA 4UYBA 4COZA 4FOQA 4K1ZA 1D0GA 2H89A 1V9U1 3C51A 2XB6C 3CJIA 5CA1E 2WLQA 5J37A 2K1JA 3OPTA 5ANNA 2CLYC 1DGRN 2DLRA 3EDVA 1ULPA 4R7EA 4AVBA 4AUQB 2PNXA 4KG8A 2N2NA 2ZKLA 2B45X 3R4UA 2WO3A 3HJRA 1H7CA 4H9QC 4IIJE 1CJPA 2YFZA 3V43A 1W6MA 3L39A 3JXSA 1WUVA 3DN7A 5IVYA 2W66A 1DQ0A 2RMU3 1B35B 3GHNA 4CCOA 1YHFA 1LGCA 3T08A 2DF7A 4DEQA 2W52A 4BXSV 2XJRA 2WAOA 1SLIA 4HPKA 4YHHT 2WSSV 1TMF1 4LR4A 1CAXB 2XQYA 3LRQA 1MIYA 5LKUA 5FL0A 2YT5A 3F2ZA 3WHTA 2FCUA 3OBRA 4S2GA 2LOPA 1NCRC 1RUC3 1ZBA2 3CIRA 2XHNA 5LY1A 2CRWA 2ATFA 5FYHA 5A3OA 1K5JA 5L3CB 4V2VA 1C8M3 4HWDA 4OZOA 3AVSA 4R9DA 4OX9T 2A6ZA 3C6WA 1ZZCA 1VAVA 1GZ9A 4YLZA 3GN5A 3F31A 2CRRA 3NV1A 3VL9A 3POGA 2W46A 1REDA 2YN6A 4L0PA 1Z0PA 3HVDA 3RZMA 4QT6A 4LO7A 3V5UA 2CHHA 3FZHB 2MTQA 1PHMA 3QLQA 4LE4A 3BTZA 2QIZA 2DCTA 3CVRA 2C5JA 5IK7A 3LJCA 4AKRB 2QJ0A 3IPVB 2VVFA 2CBIA 5A3LA 5FZEA 1DGRA 3IA3A 4IL4A 4KQ7A 3FBMA 4XCAA 4NAOA 1YLLA 4UW3A 4I3GA 2IXJA 5DUVA 4UVBB 1V6JA 1RVF2 1HX8A 3O1UA 2DCZA 5FYCA 2EHOD 2WUHA 1X82A 3LF7A 3OGSA 3PLWA 5BUVA 1O59A 1PGL1 2QQPA 4B29A 1DF0A 3A0KA 5A7OA 4JI2T 1PO13 1W8OA 2K46A 2EVXA 2ZGPA 3Q8EA 1YD8G 2WS92 1KF6A 4K9SA 4ISRA 4ES8A 1PM4A 1MS8A 3NZQA 2YPDA 2KWNA 2XAGB 3WOGA 3ILNA 3ABVA 1V87A 3UGHA 2KSRA 2NN8A 3C8XA 1AR83 1HXS2 4E4SA 2CSYA 2R6GF 2C5KT 1C5HA 1RUJ1 3AZYA 1KD7A 3GBGA 4AEDC 1UYPA 5LJNA 2Y34A 3VD5A 3FUOA 3WNPA 1MPXA 1JZ6A 3OBZA 2P9BA 2DDUA 2BDEA 1R64A 4LF8T 1W6QB 1AXKA 5H1TA 3MK7C 3FN9A 2FHRA 1EAH2 4IEXA 1OOPB 1HDKA 1AXZA 4N9IA 3LGRA 4AG4A 1UYXA 1GP5A 5LCYA 2JKBA 2WA4A 2XLGA 2HWC1 1C8NA 3DJBA 3DWDA 4OI1A 2BVBA 2W3JA 1YI7A 2WINB 4E8CA 1O4YA 2PQQA 5C8CB 4K40A 5L73A 1XXNA 2LS6A 4AFCA 1YW0A 5TDWA 5JDQA 4AEDB 3I2HA 4HWFA 4JHZA 4UP5A 2HLEA 4CXWA 1NCQC 2H0DA 1N33T 2E63A 1HRV3 2NP0A 3GA8A 3T6RA 3WHUA 1YO8A 3AE9A 2PLV3 2ZHNA 4GB33 5JXHA 2VOVA 4FI5A 2UU9T 2VQFT 1LNSA 1ZX5A 3V64A 3O7OA 4JI7T 5EIYB 2NW7A 3AMMA 4HETA 2ZZQA 3MEPA 4DXTA 3U37A 4RSUA 5FAXA 3K4ZA 5J09A 1RUD2 2Y6LA 1H8TC 2W5FA 5FWJA 4ZEYA 1VBE2 3NKTA 3C7EA 3RSJA 1ND3B 2H0DB 5FY4A 3ZFFB 3CQGB 2XQ4A 4V1PA 5FXWA 4AVXA 3AKRA 1FMVA 4L99A 1HX6A 4UR9A 3AEFA 4HGAA 3RGBA 4EEDA 5FMDA 3ZYPA 2WNUC 2FDFA 5AQGB 1GFF2 4IEYA 1U5XA 1PNGA 1W8FA 2BBAA 4FPKA 2LGGA 2CM0A 5GALA 3WW2A 1BR2A 4R9BA 2JUNA 5A6XA 3MF6A 3M70A 3T4HB 2PHRA 3UULA 2OZJA 4P9WA 4CPBA 1X4UA 5KHGA 5LBQB 5KWRA 4HG6B 2DYCA 1O5LA 2KFTA 4K7JA 5FOJB 3HWJA 3T1YT 2Y6FA 3IDCB 3VKLA 5HXCA 2A3DA 1T6GC 4X64T 3IHPA 4R8PK 2ZEXA 4LUKA 1IG0A 1S1AA 4OHXA 4QB6A 3OGVA 4AHXA 2MT5A 4JUYA 1YCIA 2XSAA 3OPCA 1MR5A 3W9AA 1ZZBA 4QPWA 4PDWB 5LY2A 4XBNA 4Y26A 2HWE2 3FL7A 3RIAA 2NPIA 4XQDA 3VBUC 1XU2A 2B39A 3VKNA 2JG9B 2DV9A 4Q1PA 1S0DA 3SEEA 4AZZA 4BHPA 3ZDSA 1O7FA 1W6OA 3HKDE 5HCMA 5LA2A 3KT1A 1RUE3 4LF9T 5D8AC 5FMOL 5FP3A 3DKWA 2WCAA 3DF0A 2C24A 4FFHA 3V0BA 4XAAA 1W09A 4HWIB 1LODA 2JQKA 2JENA 4D6SA 5C3JA 2DCKA 4PT6A 1L3JA 2BDRA 3BIWE 1JI6A 2D8UA 5FR3A 5FYZA 4LHLA 3RI8A 3R4DB 3UU3A 1Z7S3 4GIQA 3LIGA 5LHHB 4DMVA 3KZ4C 1TMF3 1IS6A 1MS0A 4E4ZA 2X5IB 3K51A 2TBVA 4OVEA 3N2KE 2BBVA 1O8SA 3ZT6A 4P0AA 3RYRA 5FJHA 3CHXA 5F5QA 5IAXA 3RZJA 2LSIA 4TWFA 1VBD2 1BYHA 3ACFA 4PK6A 5DQ0A 4A7YA 3TEWA 4Z2AA 2JRKA 2K24A 2LEHA 2YKSA 3LSDA 2P37A 2WNVC 3DUIA 1W8HA 3OGGA 3IT8A 3SWHA 4CP9B 5LBCA 5JI7A 1LENA 3PUYF 2RP4A 3JB4C 3PNAA 5FJKA 1OKOA 3LQHA 5FXXA 5AQLB 2JEMA 5G05L 3IEEA 4HN1A 1DU3D 3OPZA 2H7OA 3PUGA 1EAH3 3U5OA 4RA0A 1E5IA 4EIWA 3ASLA 3K3QC 2R7EB 2HWB2 4KBBA 4D6RA 4QKFA 1X9TA 2FCTA 3U10A 3K4DA 4B4RA 3LDBA 2JECA 3JC6C 4U7YA 4AI2A 2YBSA 3PJYA 3JD71 4IXLA 2A3YA 4XJUA 4FIPA 4QX2A 3N9NA 2Q0AA 2WIIB 1VBC2 4Q4Y2 5JDNA 1OFNA 4RS5A 1K3IA 2VXJA 2WMNA 4U7IA 4HONA 4H7LA 1IQDC 5B4XA 2VKDA 5G04L 2DSMA 1OKQA 2XXZA 2W87A 2BYVE 3UV9A 4AIUA 3PV0F 1RMU3 2BZBA 1SFNA 4GKYA 2CWSA 4JDOA 4K20A 3IDEA 5EZYE 3UUBA 4ET7A 3ZT5A 1RTVA 3B94A 2BJSA 2LTNA 4YSYA 4H9OC 2WYSA 2C4XA 2LALA 1VE0A 2I45A 4XZCA 2RDNA 2AH2A 2JMDA 3J7MA 5FY9A 2LRIC 2IAKA 2JG9A 1QEXA 1J83A 2JICA 2JRJA 3SCGA 3RZLA 5DQWA 3WNLA 4X62T 2ADEA 4MALA 5F32A 3U5NA 1T6BX 3AEAA 1RMDA 1W0AA 2GC1A 1OOPC 5KXJA 2V09A 3MPPG 4BMEA 4ISTA 2G9GA 4MOAA 2Y1MA 2IFRA 2FDGA 3PJQA 4A97A 1XDPA 3LZZA 3W21A 2X68A 1RMU1 3RYHE 3ZVZB 1V6NA 2YBKA 2HPJA 3PTRB 5KHHA 5FQ0A 2V7IA 1LRZA 4F8HA 3ZCJA 1DHKB 2HWC2 4PIXA 3LKJA 1IAPA 2W0GA 3I9YA 4EJRA 2XTLA 3OJBA 3H8OA 1BXHA 3TKLB 2VPDA 1S0JA 2XMLA 2AE9A 2CKLA 3NJZA 4ZS2A 2RE9A 4DV5T 4X65T 5H9RA 4QPGC 4BPZA 2ZM8A 4LBQB 4UF0A 1H6XA 1QWRA 3VBOA 1H8TB 4A3ZA 1NYWA 3ZM8A 3UK9A 3MICA 4GNGA 4CDWA 3OYWA 4QB1A 4YW4A 3ZFFC 3BPSA 4HSJA 2WT0A 3DEMA 1PGL2 3M62A 2NMOA 2XBO1 5A32B 4NPLA 2E7QA 2XJPA 3KNVA 4WV8A 2R32A 1UIKA 3KINB 2XJUA 3N9PA 1SG3A 3AB0A 1W6PA 3U75A 5LJMA 4YJ3E 4WZCA 2FJEA 2V5DA 2AACA 4ZI2C 1AHSA 2KA3A 2YG0A 4B3MT 1APNA 2WFF2 5BNNA 1G8XA 1VBA3 4X66T 4BH9A 2R1DA 2TNFA 2N1GA 1UZZA 4ZXEA 5FO7B 5HXVA 3T2OA 4BJMA 3KVBA 2IZWA 1D1AA 3J8F2 4P02B 3QB5K 2XDVA 5BNPB 5JXIA 2BNOA 2PHUA 2W92A 4QH5A 4IE7A 4M01A 4COUA 2KU3A 3VDBA 3ZPYA 4LULA 5C8CA 5F8PA 1SACA 4PDWC 3ZXKA 1ND3C 2D3PA 1MMNA 5I8SA 1GICA 2YUCA 2CKLB 1TME2 3Q5WA 2ILMA 3RMXA 3CQCB 1W0PA 3O1RA 3ROUA 1DGLA 2HN2A 2ZHLA 4UOJA 2KGGA 5B4NA 4C0HA 3K4AA 4YVWB 1LJ7A 3LEGA 4NXMT 2PELA 4L7XA 3VR8A 5FYMA 5CZKA 2KD7A 3VB9A 3OY8A 1R8IA 4IW3A 3E5QA 1I6XA 2HBUA 2LSGA 2L8KA 5HCAA 4H9RC 1EYBA 5C7GA 3H7JA 5JSRA 5JI9A 4DR4T 4LHKA 3ZSEA 2NAAA 2YSJA 2AEYA 1COV3 4CDXC 1WEWA 4QX1A 2D5FA 4HFEA 3SISA 2MIQA 2FBWA 3RI9A 2Q9QA 4HVOA 5T54A 1HKDA 3SHBA 4C90A 2I0MA 5JIUA 5DJQC 1D4VB 1TQ5A 5C8YE 3K2OA 2ZGNA 5FZ4A 4OYUA 5F5AA 2VQAA 3NQHA 3AC0A 2YC0A 1OFSA 4CCGX 4FQZA 2ZPXA 4X20E 1UCUA 2QVAA 4L0RA 2NZ9A 1AUYA 4MSVA 5LB7B 2ZAAA 1YKEB 3LBXB 3WDTA 5LBEA 2XHEB 1OQDA 1W39A 5J1GA 1IQAA 4AVAA 1K5MA 1WGPA 4I0BA 3UTKA 2GNMA 3I2GA 4QB2A 2QQUA 1ENXA 5CFCA 2XKPA 1UMHA 2I59A 1PGW2 4K8FA 3PU3A 3PIGA 4M4PA 5FUPA 1UPIA 3EUHA 3T2TA 1SEFA 2E6SA 3LOIA 3ZXFA 4JKKA 4V2WA 4NRQA 2VP7A 4HK8A 4ZI7E 5JMOA 1W0OA 3G7DA 2HH7A 3NWIA 2UWBA 2ARXA 2G6QA 2RR4A 3AA0B 5AQSB 3KMHA 3VHNA 3WDWA 4LBLA 4A7KA 3ZIWA 2EALA 3JC6D 2LOSA 2RR13 5JRCB 2YBPA 1POV3 5FBJA 4MGKE 4KU8A 4QQPA 3WP3A 3UETA 4I7DA 4JGZA 4MHUA 3ZSTA 4GNDA 1H2LA 1TE1B 2EXKA 5AC93 1UY0A 3ZMSB 2IUBA 2XQ5A 2BZDA 4U36A 4BZ4A 1K5MC 2VNRA 5IVBA 1QJY1 3KV9A 1FMD1 3E6BA 4DXZA 1RUJ2 1ULEA 1WCKA 3UESA 3HNYM 2W39A 1YEWA 3O1TA 3MIGA 4CN6A 1UNBA 2BVLA 1D2QA 5E6HA 4P0BA 5IHRA 5T3NA 4EAHA 1DFQA 1ZZ8A 2EXJA 1NUKA 3C4ZA 4XYXA 1GOFA 1CD3G 4DV4T 5AQIB 2F6NA 4KMCA 5FUNA 1ST8A 5DZFA 3ZKYA 4B3TT 5BXXA 1AYM2 1ZBE2 1JUIA 2EIEA 4YADA 4X5TA 2Y26A 4AF9A 5I93A 2VXRA 4BU2A 5FP7A 2OLTA 1S2EA 5T5LA 3U3IA 3VBRA 2Y43A 4OFZA 5L4HA 1RL3A 5AQRB 2XQRA 5FYUA 1ZM1A 2GMPA 3O33A 1DQ5A 1IBKT 1US2A 3UYJA 1WFKA 4XPVA 4H9NC 1Y9QA 5FZ0A 4ARXA 2GP3A 4QQHA 4IHJE 2ZLYA 3HIFA 1UD1A 2W1WA 3FB2A 1B09A 2W00A 5E16A 5HWYA 4AYUA 3EB7A 4WVWA 1H2MA 2YHJA 5FXVA 2ZEWA 2Q9QC 1L7QA 1SLCA 5H9SA 4QKDA 2XWBB 4RD7A 1AYN1 4PJYA 2FJBA 4R2YA 5GLVA 3RRCA 2XASB 1O6UA 1MIVA 2J1UA 4AXOA 4Q4V3 4YZ5A 2DWKA 1FV2A 1HB4A 1XSRA 4O2BE 1LHVA 4Y4YA 3ZVYA 2D44A 4GWIA 5SVXA 3J8F3 4KHZF 4B4QA 1W06A 1E1HB 1WE9A 3AAEB 4HFIA 4IEZA 4FVVA 5J96B 4YGEA 5CFCC 3FAOA 3N7KA 1W9WA 3GHMA 3N3HA 4UW6A 3WUCA 2JMHA 4YVSC 5F1RA 3HNBM 3H9AA 4PLOA 2LM2A 4FPEA 4P00B 2JMIA 2K9AA 3OCPA 4JI6T 4GKKT 5BNOC 4AEJA 4S3OB 4MHCA 5E0OA 1WEUA 1VRH3 2DFBA 2BAYA 5ABJA 1G73A 2VNFA 2AR6A 4MYEA 3KQIA 1BR4A 4F83A 1RINA 3AYCA 1GP6A 3GCWA 4L5GA 2ZX1A 4JRAA 1XZYA 2BU9A 1US7B 3L11A 3FHAA 5BNPC 3T09A 2FZ2A 1SDWA 1PK6A 2LJLA 1NCQA 3UNPA 5IK5A 4MADA 2EIBA 4OMCA 3ABZA 3OSDA 5DAVA 5FMBA 2YINA 4PIZA 3N36A 4YNIA 4AI3A 1EV13 3J7Yq 2GDFA 3DL3A 1QLBA 3HR0A 5GZDA 2J7MA 1MM3A 2ZGQA 3AA6B 5BNOB 5IT6A 3WQ7A 3RJ2X 2OUHA 1J58A 1VOMA 5AFUL 2JE8A 3BQIA 5FZIA 2JMKA 1AR71 4YSZA 4QGLA 2IQJA 4LMJA 4IETA 4JGYC 4F8AA 4RS5B 4LOSA 2LRPA 4KX6A 3RHWA 3OBTA 3VV1A 4LFAT 3HKCE 4L58A 5KHJA 4ZS3A 4L8QA 3KVAA 5L19A 1OF3A 1VBB2 3ONXA 2R0FA 2VZOA 5DN2A 4GAZA 3A23A 5JR9B 5HXRA 2WQ4A 1UZYA 4PK5A 3ELNA 3MFAA 2ZGRA 3JU9A 4YG0A 4AYCA 4CP0A 1WW7A 2ZA9A 3ZXJA 3MPBA 4ILAA 5K0UB 2L9LA 3Q8BA 4MVTA 4WM7A 3I97A 4MSXA 5FKCA 4NHXA 5AQVB 1A3KA 5T55A 4S2HA 4ZU7A 1D1CA 1UW8A 4WM7B 2LRLA 2XAHB 2KWKA 1DGWX 3WQ1A 1PNFA 4CEYA 4DV2T 4CEWC 4TUYE 3EBRA 2YSMA 2VUJA 2WL1A 2R30A 3FBYA 2Z5WA 1M4WA 2RS13 1NY71 4Q4V2 4HN0A 2V26A 3LSVA 1WILA 3ALQA 2Y6JA 1CPNA 4P08A 1FT9A 4XIOA 1IS3A 1XMQT 1REEA 1JHJA 5JR9C 3AM2A 2QQNA 3ZMVB 1W2OA 4KI5M 2Q4SA 4HT1T 2DTYA 2VGDA 5I0TA 2IFWA 3H0OA 4IV1C 4XE9A 3H3LA 1NQDA 3ZYFA 3D3AA 1AR93 5C3OA 5JZGB 1C8M1 1GSLA 3ZC1A 3MUZ1 1DYKA 3QOPA 2ZM2A 2YMZA 3ZYLA 2BKPA 1CZVA 1BMV1 1ULGA 2NM1A 4P5HA 4YYOA 3RYCE 5TAOA 2QUOA 4P1NA 4E7SA 4QXBB 5LMNT 3VBRB 4WZ0A 5BMVE 2EHOA 1JU4A 5A70A 3AA7B 1JYVA 4PPEA 2L43A 2CMRA 4NN0A 3MYXA 2K3WA 4P9IA 1WD3A 1ULDA 1JN2P 5LGTB 3O37A 4OUEA 1L7LA 2XQXA 1OLQA 3CX8B 3FWEA 3O12A 5JZGC 1RB8G 2ZZJA 5LA6E 2HWE3 4XMAA 5JDHA 4D69A 5FYBA 1GNHA 2JG8B 4ZY9A 3MBWA 3E0ZA 3OPWA 5AFEA 2LSJA 1SBDA 2ZEYA 1AX2A 1OQ1A 2CXLA 5APAA 2VZSA 4CDUB 5HEGA 2MUMA 4MV2A 3D5OA 1WEOA 3T2PA 1BCXA 3NMBA 3DTOA 1WRDA 3P50A 3RJRA 3GZUC 4AK3A 4LNVA 1MEC1 3D8CA 2YXSA 5B77A 5LBMA 1CAVB 4JGZB 3P8CD 2CAUA 2OVUA 3Q2MA 1KRIA 4HPKB 1F8VA 5H6RB 2KXLA 2KXPB 5FZCA 4IDQA 4TXWA 4Y5Z0 2YW8A 5L3EB 2QDNA 4NPPA 4O62A 2BUKA 4C9ZA 2HKXA 3LQCA 4UBHA 2RJLA 3L9JT 1DDLA 2XQ6A 3LA3A 3AXDA 2VMDA 1TVGA 2F4LA 4L11A 1XE7A 3VD7A 3CJXA 4CDUA 2IHR1 1YYNA 2WNVB 2Y0IA 3ZYKA 3VZOA 1LDJB 1IG3A 4DOUA 4E9KA 3WEZA 2BP6A 1C1FA 4XFAA 4XVHA 3TLTA 4AI6A 1BVP1 4GMP3 4WM8A 3DV8A 2OUJA 3QC9A 3S5QA 4PK4A 1Z7S2 4YM2A 4FPLA 4DRVA 3N2GE 1A78A 1YIFA 1OXCA 1NOVA 2OQ6A 4ASMB 3QOFA 3PVOA 2WLPA 2JDYA 2LKHA 3DPRC 4A3XA 3CIHA 1O8PA 2QGSA 2ZGUA 3ZN6A 4NE9A 1VJ2A 2P3IA 5FZHA 3I9WA 2IXIA 3CL1A 5FZDA 2W94A 1O5UA 3M3QA 2OXBA 4Z1VA 4M0HA 5LYJE 2YC4A 2NP9A 5J2UE 4CI1B 4NAMA 4DUZT 4AKHA 5A3MA 2VMIA 1OURA 4YG3A 2D7FA 2W1SA 4UAPA 3CU7A 4GK5E 2KREA 4PJLA 3HCSA 1OEDB 5FREA 4YABA 3ECQA 4DVDA 4Q0QA 4O9EA 3O70A 4JQTA 1H0BA 2YDRA 4GALA 3GZEA 1NEKA 2FJDA 4QGNA 2O0OA 3SUBA 1RMU2 4HLTA 1SUMB 5BNPA 2OA5A 3AMPA 1SLTA 4GD4A 5BNQA 1BR0A 5CA6A 4JQRA 1X79A 2LAUA 3AE6A 4ILBA 3J8F1 2WB5A 3ZFEC 4IGPA 5BPXA 4IE6A 2WZR1 1UZ0A 3LA2A 5AQHB 4LK7A 4R52A 2QCSB 1L7RA 5FZGA 1VIWB 3WAJA 4Q4X3 4QDRA 3RMYA 3RGLA 4BIFA 3O1PA 1ZHCA 2KWJA 3ZSSA 2JDUA 4UBGA 4BQ4A 2UY9A 3F95A 1TZOA 2A6XA 3JAFA 4AE2A 2XB1A 2VU9A 4MGZE 3Q8AA 1OD5A 4MLKA 2WU5A 4YM3A 2Y8DA 3D82A 2IC6A 2BWCA 2N7GA 4FFGA 4YFWA 1LOFC 3NNMA 2J42A 1N1YA 1KFUL 4TNWA 1HNXT 4MGQA 4QPGB 3VHRA 5ABGA 1WZXA 5IVCA 4YZ1A 2G0UA 1Z0HA 4E2GA 4XFGA 4DBQA 2IC9A 1SQ4A 2UUAT 5HXEA 2YGMA 3EDUA 2VJEB 2XGXA 4GB0A 1ULCA 5D21A 5GLTA 5IWFA 3RH3A 4CDWB 4YPJA 3TAYA 4RFT0 3KF3A 1DYPA 2RS31 3AYAA 1STMA 2VMFA 4EROA 3AFKA 5CFBA 4EN7B 3B5LB 5JOXA 1US3A 1QXJA 4JEUB 1V6LA 2PFVA 2ZGKA 1D1BA 1AJKA 4LBQA 2BNNA 2XVLA 1R083 2D5UA 3FE5A 2Z6EA 2VCBA 4OI2A 1YFYA 4DZGA 3I0QA 2KKXA 4BOWA 3VD3A 3OGJA 1RUC1 4CUGA 1S94A 4DY3A 4FOWA 3V56A 4R8HA 2PA7A 1POQA 3SC7X 1QJY3 4G3YC 4LA2A 2LM9A 2YDSA 1WMFA 1OI6A 2QDRA 1ULOA 4LUMA 4QPIB 5LOVE 4DIDB 1A34A 2JE7A 4OHFA 2VJEA 4RS5C 4QH4A 2XOYA 2HWE1 4IC3A 5DDJ2 2FDIA 5E88A 2AYHA 2CXFA 1FOD3 2UWCA 5JXJA 2X29A 3CKHA 1D0YA 1NG0A 4XBQA 5FLHA 5A3UA 3N7MA 4C0BA 2MBGA 2DUOA 2LM3A 1AR62 1I5PA 1ZBE3 2D8SA 4SBVA 3ZN0B 3LEMA 1AR82 2M85A 5CJ5A 3BU0A 3AKPA 4OFGA 4PBOA 3S5AA 1BBT1 3ILFA 4I7CA 2G45A 4CXYA 1W04A 2SBAA 1U6GB 1YJLA 3JCFA 4FCAA 1FI2A 1WLCA 1YQ6A 4YVWC 2PAMA 5JDLA 3EJKA 4HFVA 4AQTA 5J1XA 2FSAA 2YHOA 3HT1A 1W2TA 4AFDA 4PFOA 2Y1NA 5L9RA 4LMLA 3RIUC 1RUI2 3HT2A 4BWOA 3DDTA 3L1XA 2BS3A 4XUTA 4OK0A 4QX5A 1F62A 5JUVA 3U4SA 3VR9A 3WI3A 4N43B 3ZXDA 4ASKA 2ZAHA 3FXDB 4XF1A 1UQXA 2GNTA 4Q0UA 4YBMA 1GQHA 3V65A 2K17A 1MACA 2IIUA 4Y20A 2YYRA 1C1LA 3VKHA 1C5IA 1UN1A 4HZFA 1PX4A 1H1IA 4L2NA 3DGTA 4X1KE 2XVGA 1CAXA 4N90A 3WG1A 5GLUA 4LO6B 3SH5A 2WO2A 3T1HT 1UO9A 1W6NB 2XUEA 2JDHA 1IZNB 1ODMA 5J7MA 1LU1A 4CP1A 2B0OE 3W5MA 3PLQA 1RGSA 5DZGA 2VPBA 3WUDA 3KM5A 5DAQA 4X1YE 2D0TA 2NR4A 4ARYA 1UU6A 5A3PA 4P09A 3SEPA 1O3QA 4DEVA 1V9U2 3IB3A 3UT5E 5ABFB 4QD2A 1N3PA 2AGSA 3LQIA 4HE8A 1D4M2 2DWRA 2Q8DA 5TSWA 1HQNA 3N2OA 2JDPA 5ETWA 1OLRA 3BKZA 1Z6UA 4WZXA 3AE7A 1S0GA 2FD4A 4AXPA 2E51A 3WT3A 2C1FA 3UU4A 4LKEA 4AL9A 1XSQA 4OQ8A 4GOUA 2BOIA 3NNLA 2EHOB 5JAXA 5FZOB 4KUMB 5CBLA 2ETEA 5FPBA 4FQ4A 2Q8EA 1CAVA 1X4IA 4WA6A 1JYWA 4BAYB 2IXLA 4Y22B 2NQYA 1EP0A 4XFFA 5DAXA 4NIIA 1MEC2 3RPGB 3VDCA 4WZ3B 1HB2A 4AGRA 5CKNA 2VCMA 3PJAJ 2L9QA 5JZGA 3SOXA 3VZKA 2C0SA 4YZ2A 1K45A 2XQ9A 1PGSA 3S0MA 4DBRA 2FMDA 3CJIB 1N1SA 5C33A 4UXNB 2WFPA 2F6BA 5L3FB 4JDNA 5CB7A 3IN9A 3ZN1B 4DRRA 2PTMA 4RFRB 4XIKA 1WEPA 3HBZA 4XQWA 2WDQA 3F57A 1S2BA 4A4CA 1KQRA 4COYA 4IREA 1WWYA 3M1HA 4X3GA 3A22A 3WV6A 3O7AA 3EMRA 3VBOB 2LRKA 1XNQT 5GONE 3UUNA 4PQ9A 1HB3A 2EF6A 1AXYA 1S55A 2B4KA 1JMUB 5B76A 1HR0T 2D6KA 4CUBA 1G9DA 3RPGC 3T1LA 3ZSLA 4C8DA 3WINE 3J7NA 4I0UA 5FY1A 4QAWA 1WCSA 5H9MA 3VD4A 1OA3A 1WLTA 2Q30A 1O3TA 1YI9A 4N78D 1QJZA 4LKSA 1H9WA 2WZPP 2JQQA 1J1LA 1VAMA 5TDRA 4Z91A 1N32T 4XCBA 2GH2A 2VULA 5IVFA 4E7ZA 2MEV1 4UFJA 4AW7A 4KBMB 1RUC2 2NMNA 2IWGB 1QOSA 4G63A 4N53B 4GYSA 1GQPA 2PHWA 4P9YA 5FFOC 2BNMA 1Q8QA 1OH3A 5AQNB 2JKXA 4BDVB 1UIJA 1O4TA 4FT8A 2UYBA 1U0AA 4GMP1 3O1IA 5CU1A 1XNTA 4MX3A 4YVSB 3N9OA 2LW8A 1S2KA 2WFF3 4AKIA 3ATGA 3ZKUA 2YGLA 5EK4A 3PMSA 3VBUB 1CAUB 4N53A 1VB4A 3SRZA 2ZTNA 1NAFA 3EQEA 2OPWA 1ZRIA 3QK6A 1RUOA 2VW1A 3GCXA 4IDNA 4RQPC 5CKMA 2QKDA 1OA4A 2BBJA 4YW1A 4I4TE 5ABJB 1NA1B 1J3QA 3B13A 2VMHA 2WWUA 4WBOA 3PVBB 2UU8A 2F6JA 4A6OA 3ZFGB 4DR6T 1AR91 4CSWA 4PCRA 2WT2A 3D6EA 3FBLA 1AJOA 1AR92 2QQKA 3PVEA 1BZWA 2GNBA 1WKYA 3NAPB 2EAAA 1QOOA 1ND2A 4YVSA 1U4QA 1LHUA 3LFIA 3LA7A 5GM0A 4Q4X1 4WZFA 1SCRA 5FQ0B 4GK0E 4ZZ5A 1MNEA 4LO5B 3SCHA 3Q9OA 5FERA 2X8KA 5ABJC 4DXRA 5HAXA 1CIYA 2DU0A 4X6RB 2G1MA 2PG8A 3LCPA 1QJX3 4IL7A 4N8MA 1LCLA 1Y7BA 1CPMA 3HQXA 5KBFA 1WW4A 2WP9A 3J26N 4LF6T 1MQTB 2FDJA 3MO4A 4OI0A 1OBNA 3J7LA 1LOCA 4CU6A 4Y1UA 4TN7A 5AQMB 2MA5A 4IEOA 3WDXA 3I7DA 2RM21 4QXCB 1FEWA 4O4JE 1KNZA 2VOTA 4I55E 4CU7A 1ALYA 2HWB3 2CWOA 2DCJA 3K3OA 3WG3A 4K21A 4F1PA 4CDQA 2Q1FA 1HQLA 3IAPA 1WLDA 3J4UH 1HS7A 5A1LA 1WENA 3M7AA 4GJZA 3TN92 1W6QA 1HV1A 1SHZC 3U07A 4EWDA 3JD72 2E6VA 1JZ3A 4Q4Y1 1F2NA 1NKGA 1W3VA 2GALA 5HYAA 3AEDA 2DURA 3OUIA 3UU8A 2H6CA 2CXDA 2DX8A 3IZOA 2YC2A 3KBTA 1G6NA 5DAWA 4QXHB 5J0ZA 4ZHNA 4QU2A 3S7EA 2X05A 3U5MA 3X29B 3SH3A 4LJHA 2JB8A 1VMJA 1MNDA 3RQUA 3UGGA 4TWHA 5DG2A 2RJKA 4XJ9A 2M6MA 3NV2A 1DLCA 2D3RA 3VKOA 3SKVA 3ZN6B 1A8DA 2FQPA 1W6MB 2WO1A 1Q8SA 3VBSC 3I49A 2KR4A 3PUAA 2LQ6A 3CO2A 1SLLA 2A3XA 3GGLA 3DP7A 4KNCA 3GWHA 2PAEA 5AQFB 3POSA 1UOJA 5H9PA 3N5LA 3RC8A 2X0HA 3AKSA 3R6SA 3SKJE 4YY3T 1W9TA 1TMF2 3WLUA 1AX0A 2VCAA 2YU4A 1SDDB 2V72A 5JDBA 4IDPA 4JTNA 2LV9A 1S0EA 4ZPIA 3FXEB 4HN9A 2KR2A 3FZFB 2VTFA 3AX4A 4OI4A 1WA6X 3ENRA 3SQOA 4ATEA 2KMFA 5FO8B 2V6YB 4FTEA 4LF7T 2RM22 2XL9A 2WZIA 1UCXA 3NRXA 1PMIA 3V0BB 1IYMA 4Q6FA 2D6MA 5FY5A 4QWNB 4XJWA 4AVSA 1T1HA 2DU1A 4QXBA 3T0DA 3M3CA 2ECJA 4O8SA 3AMHA 2EXIA 4LBNA 1N3OA 1AF9A 2NW9A 1H1MA 1RYYA 3RLFF 1VBC1 2WAUA 4BLJA 2UUBT 4FOVA 2XG3A 3G06A 4M1PA 2VBDA 3AFGA 4PJNA 3UQ7A 3IBPA 1KFXL 2JDNA 5FB1A 1XNAA 1NXMA 2F4VT 2E26A 2W4XA 1JZ5A 3PTYA 3BODA 3WZ1A 3U78A 2FUIA 1OLME 2BS2A 1YWKA 3PHMA 2GAUA 5C3RA 4M3CE 4CPBD 3AJYA 1C3HA 3MFCA 2HWF2 3WNOA 4CEWA 1QNWA 3PIJA 2G9FA 3NSTA 1AR73 3RNSA 1VLNA 1YQ2A 4XQ4A 4MZUA 5B78A 2LROA 1G9AA 4EYYR 2W1UA 4LBQD 5JTGA 2XVKA 1DIWA 4PNIA 1V6KA 3BOWA 5C9AB 3POFA 5FZFA 4GXLA 3POEA 1JBCA 1OEDE 2A5ZA 3PDQA 4BQWA 3CZJA 1K2FA 5LGUB 1KJLA 4BXFA 5GZFA 3AEEA 3R0RA 2MNZA 2YK0A 1DZTA 4QPYA 1JS9A 4MXVA 4UIGA 4LLBA 2V7KA 5DABA 1SPPB 2WY2A 4N3WA 4AQYT 1RUD3 1ZBA3 1S0CA 4CCLA 3GZAA 2RDSA 3JZVA 2IXKA 5EHDA 2BG9C 3D4KA 5SVYA 5KHIA 4KU7A 1LECA 1WW6A 4ILUA 1N3QA 4QKNA 1VFYA 3AAIA 5LRRA 2BQPA 2ZKNA 3MDPA 1EAH1 3FLTA 4OGCA 1VALA 1R081 3ZSKA 1FIOA 1W6OB 2DCFA 3GXUA 2Y48B 4EN8B 1R082 2RSDA 3B02A 1ZZ6A 4HKOA 5C3PA 3V0AA 1TNFA 2IXCA 2X9HA 4NUVA 4AQSA 5IK4A 2VUAA 1VAKA 4XBLA 4AGVA 4JGYA 4DINB 3E08A 1J5ET 3O1JA 2HYKA 1VYXA 1AR61 2WYFA 1LU2A 2W08A 4GH4C 1PO21 1Q43A 3PVNA 5FYSA 2BRTA 3DECA 4YZ4A 3PE0A 2W95A 1I1EA 1AYN2 1LKNA 4QXKA 3CNAA 1J3PA 2EA6A 4PI0A 2A70A 2B7YA 2BFUS 4Z0RA 3WP5A 4XHBA 3GV4A 2HYED 1X8EA 4XZPA 1JYIA 3AECA 3T3YA 5C3SA 4IV3C 1TNRA 4XETA 3DYOA 4UT5A 5D2AA 2YPJA 4TV8E 3OEBA 5LG4A 5L4EA 3TN93 1OH4A 3FZ3A 3WG2A 5L3GB 1JOPA 1RUI1 2QYWA 3FANA 3UJOA 2YQMA 2D6LX 3O47A 1ASJ1 3KV6A 2LE8A 3HQUA 1Y9MA 1IJ6A 1BR1A 2DUPA 3SHRA 1FJGT 2PLV1 4GB31 2VQ0A 1WESA 4FPGA 1LOAA 1BQPA 2RV9A 4J2CA 2ET7A 1QSDA 4Z07A 4LBKA 4D8MA 2MAWA 1KXGA 1HYJA 2RS52 2F42A 1RJ7A 1V00A 2CNAA 4H3WA 3AZZA 1UU5A 3ZYHA 5LATA 5T52A 1AL23 1PO12 4KWKA 3QBQA 3UUXB 3NAPC 1F9KA 3RYKA 4UI9L 3FZKB 4EN9B 5F3CA 1E5RA 4BLIA 5F6KA 4DR3T 3QH7A 1BEV3 1PZ7A 3IF8B 2FCVA 4DXSA 4YLHA 3BN6A 5D8AB 3TEXA 3RZKA 4DMIA 4LE3A 5A6YA 3UFEA 2DFCA 1DQ4A 3MV01 2VMGA 1X36A 2OIIA 4H9PC 1WGMA 2XAFB 2K5BB 5C70A 1MQTC 4QQOA 1UX5A 4DS0A 1BORA