3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
5FXXA 3V43A 4BISA 2M85A 4IGQA 5FYUA 5ISLA 2L0BA 4AUQB 2QIZA 2JMDA 5LY2A 1CHCA 1HYIA 5B78A 5FXVA 4CCOA 2YREA 5DINA 3MHHA 1T1HA 5FJKA 5A7NA 5A80A 5IW0A 4YBMA 5FZ9A 5A7SA 3LQIA 4XI1A 3KVAA 2VJEA 3GL6A 2F42A 3OPWA 2M3HA 3C6WA 5B76A 3VK6A 5A1FA 4P5OB 2JMJA 4YBTA 3NG2A 4DIQA 5D1MB 3SOXA 5JG6A 1K2FA 3EB5A 3HCUA 2YHOA 2P5BA 2K16A 5FB1A 2MD8C 5H1VA 1LDKC 2CT2A 4IC2A 4Y4RA 3KQIA 4FO9A 5FZCA 3LQJA 5LWBA 4GJYA 4GJZA 5C11A 5F2WA 4ASKA 4CCNA 2E6RA 3LD8A 1FP0A 5FUPA 4ZQLA 5TRBA 3O37A 5F32A 3AL6A 3C5KA 4CCMA 2YW8A 4PPEA 2AN6A 2L75A 2GP3A 4D6RA 4I7BA 5FY4A 3LRQA 5FZOB 2LN0A 2YT5A 5FZ3A 1F62A 2HYED 5FYYA 2L5UA 4V3KC 5FY7A 2M6MA 3SHBA 3O35A 2ECJA 4BBQA 2GP5A 3EB6A 2W2IA 2F6JA 5LKZA 5FWJA 5E6HA 4ZUXU 5FYCA 4YBSA 4CCKA 1JM7B 2MA5A 4QWNA 3T7LA 4AVXA 2FSAA 3ASLA 5FZ1A 2CKLB 5FZMA 5G05B 2FUIA 5H1UA 5FZIA 3ZPV1 2OX0A 5FZ0A 2K1JA 2KYUA 4QF2A 1WEEA 3DQVR 5F3EA 1FBVA 3RPGC 4CCLA 4LIVA 4F52B 2ECGA 4WZ0A 5F3CA 1VYXA 2EA6A 2YU1A 2VPEA 5F5AA 2ECWA 4YADA 2LGVA 2MA6A 1LDJB 3L1ZB 2LGLA 4QF3A 3N9QA 2KWNA 3U5NA 2YYRA 5FZOA 2VJFB 2YSMA 5A3NA 3HTKC 5FV3A 3FL2A 1WENA 1WFKA 4O64A 4BXFA 5TABA 5FZ6A 2Q8DA 2L80A 3T6RA 4ZDTA 5FP3A 5LCWB 4GD4A 4PTBA 2M1RA 3N9NA 5FP9A 2YQLA 3PU8A 4N3WA 1VD4A 3PU3A 4EYUA 5TBNA 3U5PA 2NAAA 4LKAA 2KIZA 4XDOA 3M63A 5FY9A 1JM7A 4V3LC 4IGOA 1WEOA 5FPVA 2KGGA 4AP4A 2CKLA 4LLBA 4A4BA 3PURA 3KV9A 4R7EA 2RSDA 2G43A 4L7XA 1RMDA 2YBPA 5FYBA 3RVHA 5FXWA 2LRIC 3UYJA 5IVEA 5LKXA 1BORA 5FZHA 5FYTA 5FZDA 3K3OA 4YATA 5LY1A 4D6QA 3AL5A 5H9MA 4YC9A 4NUBA 3N9LA 2XEUA 2OS2A 5ANQA 5F5IA 2PUYA 5FY5A 4NN2A 2OQ6A 2VP7A 2XXZA 2VJFA 2MD7B 4MVTA 2LV9A 2OT7A 4FK5A 3NJYA 4URAA 2FUUA 2LQ6A 4X3GA 1WEQA 3U5OA 5F3GA 5FZLA 4W4UA 5K4LA 1N87A 4CUGA 2G45A 4UP5A 3U78A 5FPAA 5G04B 4FJCA 3PHDA 1WILA 2JRJA 4A49A 2Q8EA 2KWJA 4LXLA 2C2LA 4IC3A 4EZHA 4L58A 3PTRB 5FPBA 5D1KB 1Z2QA 4Y33A 5FY8A 1X4IA 3K2OA 4I7CA 4Y3OA 5C13A 4QXHA 1WIMA 2YURA 3L11A 3DXTA 1WEPA 2BAYA 3I2DA 4LK9A 2ECVA 3ZLIA 1IYMA 5J3XA 1ZBDB 5F3IA 2QJ0A 1E4UA 4N4FA 5FY0A 3O70A 3MHSA 4YABA 5CEHA 1MM2A 2XB1A 3KVBA 1JOCA 5FERA 3DXUA 3O33A 4GNGA 4BHWA 3GV4A 1X4UA 4D6SA 5IVYA 5KH9A 1X4JA 5H1TA 2PXJA 4C9ZA 4QX7A 3M99A 5KR7A 4B86C 4DO0A 2KFTA 2YU4A 5A3TA 5IVCA 2MT5A 4V2VA 5F5CA 2WWUA 5FZEA 5G0FA 2D8SA 4WA6A 1VRBA 4EZ4A 3ZNIA 3N9OA 5B75A 2MNZA 5IWFA 5I3LA 3ZYQA 3KV5A 2YU2A 4V2WA 2F6NA 5FYIA 5FWEA 2EODA 5FJHA 2H0DB 4WZ2A 3RPGB 5FP4A 1WEWA 2ECTA 2I50A 1XWHA 5FZ4A 4CCGX 5FPLA 2PNXA 4GB0A 3OPTA 1HYJA 2YPDA 3PUAA 2LGGA 3ZVZB 2CSZA 4HOOA 3PDQA 2Y43A 5FYSA 2QICA 4GNFA 1WESA 5FP7A 5IVVA 2YBSA 5FZBA 1VFYA 5KH7A 5FZ7A 4FIPA 2LXPC 5EYAF 2JMIA 2Y1NA 3KV4A 2DX8A 5FB0A 4TKPB 2KR4A 5FZAA 5A7OA 5FXZA 4LADB 5LW9A 3PUQA 2L43A 2VPGA 2YHNA 2E6SA 5FYMA 3U5MA 5FEYA 4LITA 5FYZA 5B77A 5FP8A 1V87A 4QX8A 5FZFA 3N9MA 3L1XA 3U4SA 4Q6FA 5IVFA 5FPUA 4CCJA 5A3WA 4R8PK 3SOUA 5LKUA 1WEVA 2VPDA 1WEUA 3LQHA 1U6GB 4BU2A 2UZGA 2MIQA 5FZ8A 2H0DA 3KNVA 2LDRA 3ZPVE 5A1LA 5FZGA 3K3NA 4MSXA 3O7AA 2KWOA 2YUCA 4E4HA 2ECNA 4LJNA 4R2YA 2EGPA 2RI7A 4GAZA 3AVRA 5B8DA 4UP0A 5AITA 5FY1A 1DVPA 3N9PA 2G6QA 3IHPA 1WEMA 2YSJA 5FUNA 5KH3A 2WWJA 5A7WB 5A3PA 2KREA 2XDVA 3HCSA 2OXQC 4B7YC 4UF0B 4A0CD 2ECIA 4UI9B 3PUSA 4LIUA 2CSYA 4AYCB 2Q8CA 1MM3A 5TDWA 2K17A 2YQMA 5FZKA 5TDRA 5DKAA 5IVJA 3AVSA 2IDAA 2KE1A 2KWKA 4GNDA 4I7DA 3ZPOA 4XDPA 2XUEA 4WZ3B 5FYVA 2VD7A 5D1LB 4C8DA 4S3OC 5B79A 3O34A 5F39A 1G25A 1Z6UA 3QZVA 5FBJA 5AIUA 5F2SA 4TN7A 2KU3A 4AAPA 1WE9A 5F37A 5IVBA 2KGIA 5FYHA 2MNYA 2C2VS 2OQ7A 4A4CA 3LDBA 2VJEB 1WGMA 2YBKA 4QU1A 3KV6A 5A7WA 3RTRB 2K4DA 3HCTA 4UF0A 3M62A 4HONA 4CA1A 4S3OB 3O36A 2Y1MA 2MUMA 3ZTGA 4AYCA 3ZVYA 4GNEA 4QXBA 4YAXA 2LGKA 2VPBA 2ZETC 4QXCA 2VNFA 2XMLA 5A7QA 4CSWA 4IGPA 5LKTA 3SOWA 1Z60A 4AI9A 2HDPA 2LXHC 5A7PA 3DPLR
chains in the Genus database with same CATH superfamily
1UCUA 2VKJA 4PFOA 4IGQA 4N9HA 5LG3A 1EYBA 2RR13 3P6BA 1XYPA 3RYRA 3NV2A 3MHHA 4BZ4A 4LPLA 2W1UA 2XJTA 3KVAA 3IAQA 2F42A 3OPWA 1VBE2 2QE3A 2YGLA 1WR6A 3ZOIA 1DQ0A 2JDKA 1LODA 4JBWF 1FOD1 4XTPA 2JD9A 1LGCA 2DSMA 1FMVA 4OLLA 4E27A 2JG8C 3USUB 5BXXA 4Q4W2 2XJ7A 1LDKC 5H9QA 3PLQA 1HN0A 2LOPA 4GJZA 1QSDA 3TAYA 4FI9A 1CPNA 1QGLA 2GP3A 5DZGA 5FZOB 5L9BA 5JSOA 1IBKT 3R6NA 4HPKB 3JD71 1ZBA2 4BA6A 1JU4A 3FN9A 1ODMA 5K7PA 1EZ3A 4I02A 3ACIA 3P4QA 4DXSA 1ASJ2 2GNBA 4H63H 4GB33 5FZ1A 2BRTA 4QGLA 2HLEA 1LOCA 2C0SA 1MZ5A 1PK6C 3KF3A 1SPPB 2W39A 3FZ3A 4LOTA 3LEKA 3H3LA 5FL0A 4BHPA 1KDMA 4Q4V3 3O1VA 4XXAA 4HWIB 5F3CA 4P9IA 3OTOT 3KD4A 4XJWA 3AKRA 1D1BA 3U5NA 1H1IA 2YYRA 5GM0A 1M7KA 3HT1A 2NYYA 1UIJA 1GYKA 5JDBA 3VKMA 4ZDTA 3ZSEA 3U5PA 2ZGRA 2BJSA 5FY9A 3OG2A 2DFBA 4DR1T 1CHUA 5IFPA 3CKDA 3KQRA 2H6BA 2UU8A 1E1HB 1CJPA 1E5HA 1OF4A 1STMA 4YM2A 4LBMA 1BORA 1WA6X 2ZOEB 1X33A 4P9XA 1RUI3 2GN3A 5LY1A 2NWBA 3RGBA 1QJU3 5H9MA 4UFHA 2XEUA 3TLVA 1XPWA 1OD3A 4QPYA 2YDEA 3RIFA 2E7TA 2VULA 2WN2A 1W0BA 3POFA 4URAA 2N9DA 3R4UA 1NCQC 1HX6A 3FC0A 1OEDB 3MLJA 2G9FA 4V1Av 4Z1VA 4A49A 2A3DA 1X9BA 4YGEA 5JOXA 3MEPA 1BVVA 4R9DA 1RMU1 1OD5A 3IKWA 3W21A 4ERRA 3GHNA 3AXJB 2VCCA 1WBLA 4PT6A 4P00B 1IBMT 3DUIA 2BS3A 3N7KA 3P4WA 3O0WA 1GWMA 1VBB2 3Q2MA 4YHHT 4CP1A 2FDJA 3O4XE 3DPRA 5ABJC 1WYCA 4XVHA 1HS7A 5FAXA 1T98A 1HKDA 4KL1A 4UEMA 5KH9A 5FVKA 1PO22 1S0JA 2XJUA 4JAAA 3CK6A 4P5HA 4V2VA 2CV6A 2IUWA 3RPQA 4KMQA 4UELA 2GNTA 5IWFA 5I3LA 1LGNA 3MYXA 2VMCA 4W50A 2ARXA 2GDFA 3GZEA 3JAEA 3B93A 3RZZA 1DBNA 3SCFA 4AGRA 3DYOA 4XEZA 3WG1A 4YNIA 2WFPA 1MMDA 3PTYA 2LSIA 2O0OA 2YBSA 5LMNT 5EIYB 3LB9A 1VBA1 3RIAA 4L0PA 3O1MA 5IK5A 3PMSA 1ZZ6A 4PLMA 4LITA 1S4CA 4B8EA 5DJQC 3N9MA 5H9SA 3FBYA 3HOBA 2SLIA 5DAQA 1JTZX 2Y64A 2R072 4XF0A 2FMDA 1ZNPA 3LQHA 3JC6D 4TLFA 4CDXB 3ZPVE 4NJ4A 3TKLB 4LFCT 4MO3M 5AQUB 3PJYA 4BJ0A 2EGPA 5LRSA 1MZEA 2P34A 3FJUB 2KXPB 4JRLA 3IHPA 5A3PA 3ANWB 4AISA 3WY6A 3ZR6A 4CE8A 2WP9A 3GMIA 2HBTA 4UBHA 3LVQE 4XMAA 1BK1A 2X9HA 1F35A 4P02B 4E4ZA 5AQTB 3RX6A 4QXCB 3GZTB 4L2NA 4Q2FA 2VKHA 4Q0PA 3VZOA 4LBOA 3HBKA 3R4SA 1EV11 1ULDA 3NKZA 3AA6B 2D5UA 4MHCA 4L9IA 2L7PA 1POV0 5FREA 3D5OA 1Z0HA 3NVCA 3OBTA 4YVWA 1AL21 4CU8A 2K4DA 5KXBA 1WW4A 1R093 4AYCA 3ZVYA 1ND2C 3ZN5A 2LGKA 4Q4Y2 1J3QA 3ZSJA 5JDNA 2VUCA 3V43A 2J47A 4CA9A 4KGQA 4PBPA 2KLQA 4HFEA 5T52A 4ATEA 3KFWX 3ZC1A 5LY2A 2Y6HA 1CHCA 4P9JA 3FZLB 3DPRC 2WO2A 5B78A 3HNMA 2YREA 2BVMA 3AE4A 1YLLA 5IW0A 2EXUA 4QD2A 4AKLA 2XLGA 3VK6A 1XNRT 2CWOA 5JG6A 2XWJB 1VBC2 2PLV3 3NRYA 3K46A 1B35A 3AXDA 1TME3 1WMDA 4GJYA 3CQGB 3PLWA 1HXS3 2VH9A 4A41A 2IIUA 1UK5A 1PMIA 4H7LA 4PPEA 1WLTA 3AE7A 2Y6LA 2AUYA 1XU1A 2XVKA 3AC0A 4NRQA 2W1SA 5I0UA 2L5UA 1UQXA 3SHBA 2XZEA 2WYSA 4UW5A 2QTWB 2ZGUA 2NW7A 5E0OA 2DF7A 1G9DA 3UL2A 4ASLA 4UFLA 2UUAT 2OX0A 5FVLA 3Q8AA 1H8TA 4Z8BA 1URXA 2VC9A 2DBIA 2JIGA 5EP9A 5EZWA 4AW7A 1AR71 1IS6A 1DYPA 2IMLA 4F52B 5BMVE 2HWE1 5JCTA 2CEAA 1UMHA 4XW3A 5TSWA 3VBRC 5LMUT 3A5XA 2V4AA 2V7LA 5JUVA 2OPWA 2R7EB 5AQHB 3LKJA 3T2QA 2PFVA 3LK42 1IQDC 4EYUA 5TBNA 1WA4A 1VR3A 2E2AA 2X67A 2VQ0A 2VVNA 3O7OA 3WT3A 2RSDA 4Y22B 1H2MA 5FYBA 3RNSA 3UGGA 1HB2A 2LRIC 2ID4A 4LFBT 5JVVA 3OPCA 4D6QA 2QFEA 5JIAA 2O8OA 4PJJA 3ZYBA 4A45A 3ZMSB 5ETWA 1BBT2 2VGDA 1W8WA 2JQ9A 4YVWC 4XF1A 1QF3A 3QB5A 1ENSA 2PBIA 4AQFA 4CUGA 4YW6A 1PM4A 2AE9A 4DXRA 3HAGA 1RXFA 2RS12 5EHDA 2RS33 2BNMA 4IEOA 5KXJA 2C2LA 3LSEA 5FY8A 2LRPA 2XL9A 2L3LA 3WG2A 1YC61 1NCQB 2IXLA 1W6PA 2I0MA 2LM2A 3BVCA 4AKRB 4GH4C 2E5LT 1F15A 1W6OA 1H30A 3FHNA 1R1A1 3IA3A 3DXUA 3OGJA 1LECA 1ZRIA 3TN93 1KFYA 1X4JA 2O1QA 1GZ9A 4GKKT 4YW1A 4RR3C 2DVFA 2BS2A 4K1YA 5G0FA 2IUBA 4AWDA 1DU3D 3WP4A 5B75A 5ABJB 4Y5SA 2WMOA 4DVDA 3T0AA 4XCBA 4ZONA 2LALA 2XKPA 1HV0A 2VVSA 2ZPXA 5J3UA 2WAOA 5IAXA 4YFSA 2EA7A 1WESA 3WQBA 4GWIA 2P9BA 2B0OE 4C1XA 5LA2A 2W91A 5E89A 5A7OA 5FXZA 1AZDA 3ZXEA 5FYZA 1W8ZA 2RHPA 1H8TC 3H7YA 1VRH3 3C7GA 1LR5A 5JMCA 2E6VA 2XJVA 2OUHA 5FPUA 4M1PA 2B4KA 4QPWA 1OH4A 1OC1A 1LNSA 4DV4T 2CSGA 1Z7S2 3ZR5A 4S2GA 4MSXA 2KWOA 3ZO0B 2VOKA 1YQ2A 2ATFA 3FZHB 3VGIA 3SKJE 2W46A 5H9RA 4PK5A 5SVIA 5KH3A 5BNPC 3B69A 3IDCB 2OXQC 5A3OA 4B7YC 4PK4A 3ZN4A 4PF1A 2RR12 5TDRA 1DGRN 4K6BA 5HCBA 4HXCA 4YGDA 4NHYA 4GNDA 1GP4A 2P57A 2HEWF 4ARXA 2FDFA 1LULA 3E6CC 1LJ7A 5LYJE 1V6OA 5F39A 1QQP1 4U33A 5AVPA 4LF9T 3ZXAC 1BZWA 1R64A 2FMYA 3WNLA 2BERA 3OPZA 1WCSA 4P08A 4WVVA 4LOSA 4QHOA 1HRI1 2VVDA 3KV6A 2WIIB 3RMYA 2LKHA 2Y1MA 5EQUA 1RUH1 1K3IA 1DLCA 1POV3 2VPBA 2ZETC 1QJX1 1FPN3 3VV1A 4Z90A 4Z92B 4I2OA 4BK4A 3ES4A 5GZGA 3DPLR 1CPMA 1VBD2 4LE4A 4JI7T 4YWAA 1ND2B 4WV8A 5ACA3 2XJPA 4H14A 4QQ2A 1XQNA 3AK0A 5CKQA 1C5IA 1V9U1 1LHOA 1H8VA 3V0AB 2PHFA 1RXGA 1X79A 4DIQA 1YUDA 4O4IE 1RUG2 4PHZA 3LFIA 2HWC1 4FPCA 3SEEA 2FD4A 5JDQA 2V6YA 1RINA 3U75A 5LWBA 3VD4A 4OHYA 1HQLA 1W6NA 2KT9A 3UESA 2ZEZA 1J1JA 4AXOA 2R041 4NIQA 2QQJA 5IUXA 3SISA 2YT5A 4BCUA 4OI4A 3RKGA 1NCRB 1YHFA 1CAUB 4GIQA 1N3OA 1RUI2 4AI0A 3GZUC 5C71A 3AP4A 4QQOA 4EJRA 3RYIE 4CDUA 5J2UE 5FZIA 2WFF1 2WB5A 2WA3A 2WR9A 2VCBA 4OFGA 4DUVA 4DUXA 5HCAA 3DQVR 3PUZF 1S0IA 2V7MA 2ZZJA 2VCMA 4WBOA 1HNXT 4H9QC 2HWE3 3NQHA 3AZWA 3WNXA 1YFYA 2FBWA 4AAXA 3T4VA 2GZWA 4XHXA 5LNKA 4B4QA 5LHHB 4KI5M 1G73A 2XP0A 3BODA 1UO9A 2YFUA 4GD4A 4BLJA 4ZI3D 5LBMA 2DNXA 2C9AA 3I4IA 1ND3B 1D4M3 1LHNA 2KGGA 4ZHNA 2BFUL 2E51A 4A4BA 2VZ1A 3RRCA 2WZ8A 5AQVB 2G43A 4C1WA 5KHJA 5FXWA 2VB6A 1SHWB 2J1RA 1DQ6A 2EIGA 4KH9A 4ZZCA 1LCLA 1UAIA 4RHV1 1OFSA 4OX9T 1F4HA 2WDBA 3VR9A 2ZS6B 4YZ5A 2JM3A 2X0YA 3NJYA 2AREA 2HWB3 2OUJA 2YB7A 1ULGA 1UZ0A 2FDGA 1JZ2A 4LTAA 1NOVA 3I3BA 1COV1 3UGHA 4QDSA 4N43C 4WZCA 4QX1A 1LOBA 4HVQA 3QB5K 3FLPA 2EIEA 5C3SA 4D0QA 4PIYA 4XUTA 3FXEB 4ZXLA 4FQZA 3S6PA 3A23A 2WZPP 4DV0T 1MS4A 4B3RT 4KU7A 5GJ6A 3OYZA 3RYHE 2AR6A 1OHFA 4LA3A 1W3VA 2E32A 2RM23 2WZR2 2VZTA 3ZM8A 5F1RA 5GKAC 1M62A 4PF5A 5A3TA 4WM8B 1O4YA 1NA1A 3AMNA 2A6XA 4PNIA 4QX8B 1ZRRA 4GH4B 4WA6A 1CQ9A 4JTNA 1BR2A 1TMF2 1EAH3 3ZYQA 2E31A 4O4JE 5K9YA 5IAVA 4JGZA 1RVF1 1GQGA 2WDVA 1QJY1 1UX4A 4RR3B 2PNXA 2BUKA 3KZ4C 4GMP0 1JYTA 4HOOA 2JENA 1R1ZA 5FP7A 1MS0A 2W0GA 3ZYKA 3LCPA 4GMP1 1VFYA 4UFKA 4FIPA 2XJSA 4AYUA 2EXHA 4FQ4A 3RS6A 4XE9A 5C9AA 1RUOA 3I2FA 3UQ7A 5FL1A 3EAMA 1QHDA 2Y6GA 1XU2A 5LBEA 5JPNB 2LE8A 2V72A 4MHRA 2PAKA 1OBNA 5DPNA 1W8HA 2XQXA 4YVSB 1WEUA 2PFWA 2ZX3A 2XAJB 5HXHA 1JU3A 1R092 4BMEA 3ZXJA 2HN2A 5LB6A 4UP0A 4HEAA 2JG9A 4XBQA 5HXMA 4GYSA 4M0HA 4NUUA 5BUVA 4M3CE 5JRCB 1WCKA 4J1XA 1UXZA 4QXBB 5DUUA 4LULA 3VD3A 2R062 1YI9A 3MLLA 4XDPA 1VOMA 2XUEA 3RQ0A 4YM3A 1UKRA 3WDUA 5BNPB 5D1LB 2DCYA 3ME2A 2KR2A 2QBXA 2VY0A 3I7DA 2LLYA 1CAXA 2AGSA 4JRAA 1Z6UA 2PLV2 5T3NA 5F2SA 5HXVA 3VHOA 4YZ3A 3V56A 2WKKA 5JIUA 2BG9E 3AKPA 3KGLA 2VJEB 2YBKA 4QU1A 1UX6A 2TUNA 1IGOA 2HWF3 4UF0A 1MIWA 3RYFE 2XSBA 1PVXA 3CO2A 2DHRA 2V6XA 2MEV2 4R9AA 1WCQA 3UFEA 5IK4A 3FAOA 3JBG1 3WF1A 4CEWA 1N47A 2K0GA 5LK5A 1X8EA 3WDWA 2XQ3A 3WV6A 2N1GA 1O4ZA 3BQIA 1WGPA 3LOBA 3D0SA 4LBQB 2YPJA 1NXD1 3ZT6A 1XNQT 3UT5E 2WQYA 3UQ4A 4UFJA 5HWXA 4QQPA 2EIDA 3I2OA 2D3RA 1QY4A 3LPFA 3V65A 2VL4A 2AYHA 1AJ3A 2P5BA 3INAA 5FB1A 3H1MA 4IC2A 5C8WA 1W0NA 5C4WA 5DAXA 3T0BA 4LF8T 1GICA 3OCPA 2RS53 4JGZC 5KXEA 1AF9A 2A72A 4XUNA 2ZEWA 5K0UA 3ZN0B 2BWCA 5ABFB 2C6SA 4QM8A 4XBNA 4BYYA 3LK3B 4IDOA 2JDYA 1L0VA 4CDQA 1MNEA 3V64A 1XXNA 2VURA 1TNRA 1LU1A 2YDRA 1Q8SA 2OXBA 5C9AC 5FY7A 4M4RA 1LHVA 3AFGA 3H9AA 2P4EA 5I8YA 3KINB 2WNUA 3POEA 3KB5A 1YXWA 2TBVA 2A75A 3K4DA 1H4GA 4DQAA 1OI6A 4AVXA 2JUNA 3V5UA 3P3NA 5G05B 3GBFA 4PQQA 5H1UA 2VVFA 3G6JB 1JNZA 2A2FX 4IESA 4YSXA 1BJQA 4I3PA 4XZCA 5HEHA 1K5MB 5EJ1B 2EA6A 3ZVXA 3LEIA 4YGBA 4XCAA 2WS3A 2VUDA 3PJQA 2RS32 4J2CA 3NW4A 4NIDA 5EFUA 3FL2A 1UX7A 2Q8DA 1ZEEA 3ZYPA 2VG9A 1ULOA 1YQ5A 3MIGA 1DQ1A 3LSVA 3AKTA 2XSAA 2WABA 4S2FA 1UZWA 5BPXA 5DN2A 2MKEA 5BNQA 3VZNA 2Z69A 1SBFA 3DL3A 5JZGB 2E9XC 5DDJ2 5JPMB 1RUE3 3PHMA 1WRDA 3O1SA 1KXGA 3RYCE 2V5YA 3BQLA 3ZFGA 5ABHA 4KQ7A 1Y3TA 2EXIA 3AMMA 3I59B 2XAQB 2GSYA 2KKYA 1G86A 4W4UA 5LA9A 3OEBA 5IFTA 1N87A 2G45A 2ACXA 4LBKA 1WLXA 3WCRA 1Y4WA 2BFUS 4FJCA 5CKMA 2HYKA 3NZQA 3S5QA 5HCFA 4CP0A 4CEWC 5JSRA 5D1KB 5JSPA 4I3GA 3FBZA 1X4IA 3VKLA 5E88A 2YURA 5JH7E 1U5XA 4YSZA 1YNAA 5F3IA 4Q1RA 2V7IA 4N43B 3O70A 4IE5A 4OUEA 3RC3A 2XKOA 4AKHA 3BK9A 1LEMA 2ODUA 2PXJA 4PLNA 1NLSA 4XFBA 1IPJA 4RYDA 4HSJA 1S94A 2ZGLA 2ORZA 4H9SE 2ZA9A 1JZ8A 5JDHA 1DQ2A 2WWUA 5FZEA 4X1YE 2GC3A 3VBFA 2VTXJ 3A22A 5C4WC 1AR61 3TNQA 4V2WA 4U7YA 3ZYMA 2LRKA 3MICA 3RPGB 2I50A 4MGIE 3IWZA 2WYFA 5HXRA 2YOEA 3GJBA 4B3TT 3DYPA 5DAPA 1O5UA 2CSZA 1AL0G 2XQ8A 2VQUA 2WDQA 4J25A 5KH7A 3RMXA 4H9PC 2Y1NA 2TEPA 1HJFA 5FB0A 1OF3A 2QDRA 1K45A 3UJOA 2YHNA 3CPZA 3IIIA 3OYWA 1N1SA 1MEC1 3D82A 1T6GC 4X1IE 2RMU1 5B77A 1S0EA 2CMRA 3MK7C 3MIEA 4Q6FA 1O7FA 3IPVA 1U6GB 4L92A 1NLRA 1V6MA 1YFWA 3KSCA 1V00A 3AVRA 1FPN2 5M4YA 2VNGA 5I0DA 2YSJA 1HLCA 2KXLA 1VMJA 1EY2A 1A3KA 3LG7A 1XDPA 3I2GA 2JEMA 2Q8CA 2WS92 2KWHA 2FZ2A 3KCCA 2I6HA 3C8XA 3DKQA 4MLKA 3I9WA 4AVTA 2IFWA 4XTMA 1FAYA 2I74A 3MZHA 3MFCA 4Z07A 4OHZA 4HVOA 1AHSA 4C8DA 1AYN3 4H2AA 3UK9A 3AP5A 1XE0A 1BR4A 3ZMVB 3H37A 1BK0A 5FBJA 2PHWA 4TN7A 1UWWA 2OPKA 1VBE1 2KGIA 1IJ6A 1HRV1 4DBQA 1Z0PA 3NWKA 1FATA 3DN7A 3SRZA 4R9CA 1ULCA 5JXIA 2E9QA 3PVEA 4LBLA 3HCTA 4Y5TA 4Q4W1 3O47A 2BS4A 1ZREA 1AX1A 3LVRE 1GP5A 3OBRA 1WW5A 3BCWA 2G4IA 4DEQA 2VNFA 4LHKA 5LKTA 3ELNA 2HDPA 1UXXX 1VAVA 4OCTA 2HH7A 5HXEA 4FI5A 3WX5A 3QK6A 3F95A 2JMDA 4AHXA 2QIZA 2J4GA 4HFSA 2DBNA 3VU7H 1ZBA1 1NG0A 1OLME 3N5LA 2X53S 2G0UA 5FJKA 3NVOA 4DINB 3T1HT 1M06G 2BWAA 4CPBD 4IE6A 5FMOS 1QKQA 3ECQA 4IL9A 3UT0A 2JMJA 3HCUA 4E2QA 2WNEA 1KITA 1RUJ3 2QQVA 1IS4A 2EXKA 1ACCA 2JKXA 2E6RA 5F8PA 4AQTA 4BQYA 1JZ3A 1UMZA 4CN6A 1V6LA 4JI5T 1IPSA 1BR1A 3M3IA 2L75A 1QLBA 2M6BA 2QQMA 3PV0F 2CDOA 4V3KC 2W63A 4LHSA 2UWBA 5J36A 2GP5A 3EB6A 4QKBA 1OPMA 5HBAA 4F3JA 4XILA 3AEAA 3HIFA 3LFMA 3FHAA 5FYCA 4JLEA 4QWNA 3OJAA 3UU4A 5LG4A 2UXDT 1LRZA 5L2LA 1C3HA 2ET1A 2HWB2 1AYM3 4ZS3A 2XAGB 2RR4A 1VYXA 1ENXA 2HJIA 1JOJA 4JZRA 4ZHQE 4QX5A 4BMBA 3VBOB 4M01A 4JDNA 2AXDS 4N9IA 1E5RA 4BA9A 3N9NA 5A6XA 1QMJA 1VCTA 4B4PA 5FMDA 1PIV3 1JM7A 4CTEA 2ZACA 3IN9A 4DRVA 2WSSV 2X68A 3JC6C 3CU7A 1LOGA 2VM9A 3FM8C 3DKWA 1VBB1 2NM1A 3KCYA 2JIWA 3VL9A 1IS5A 4TWHA 4NAOA 4K9SA 4ZZ5A 1RUC1 4EWDA 5KWRA 1GKBA 3WP5A 1ZV4X 3ENRA 3AM2A 4DXZA 3WDXA 3TLWA 1PO21 5FUIA 3JQWA 1EAH2 3NKTA 3P4PA 1AR93 1WMEA 4LUKA 3RI8A 4HN1A 1FT9A 2E9XB 4IGUA 1PX3A 2E63A 5FMNA 2E7AA 4HL0A 3RGLA 3AE6A 2FDKA 3T2OA 2W2UA 4MGTA 4XAEA 1B09A 2JB4A 4CCEA 5FQ0A 4GWJA 3S7IA 1VE0A 4DFSA 3VBHA 2CHHA 2Y33A 1KS5A 3M8LA 2CXDA 3AJYA 3HN3A 1MMGA 3I2DA 2BAYA 2CGNA 4JKLA 4RD7A 3C3VA 2CAVA 4YW5A 2QZ3A 3H7JA 5CEHA 3O1TA 2ZM6T 1PNGA 3ZFFA 1JOCA 4YG3A 5FERA 3ZXFA 3WNPA 4CP9B 3SC7X 1PGL2 1ZHCA 3AEEA 1CAVA 4UVBB 2VE1A 3DYMA 5KR7A 1HNWT 1TEIA 4COYA 2FJAA 4FOWA 3WDYA 1YCIA 2Y34A 2EHOD 3RHWA 3UUBA 4YLZA 4ISTA 1HNZT 1JUHA 2R071 2CRBA 2MYSA 4MXWB 2JRKA 3W9AA 5JR9A 3FLTA 3PUWF 2CGOA 4PJLA 3BUCA 2FJDA 1OXZA 3U14A 3M3CA 2J1SA 2GC0A 1MBMA 1PM7A 1IG0A 2BTVC 4AFMA 2LGGA 3UKNA 1JHJA 2VPVA 1GU3A 2WU2A 1MZ6A 5A32A 1O3TA 1QXJA 5C8CC 4DOUA 1S2KA 1E7PA 5EJZB 1UOBA 2KR4A 2EF6A 1S2EA 2E53A 3JUEA 1E5SA 1SLBA 3IMMA 4L0RA 3KQ4B 4PFPA 1RHI3 4EN6B 4E4SA 2DCKA 4XJ8A 4R8PK 1MPXA 4A6OA 3R84B 3ILNA 4EN8B 3K3NA 5LCWL 2FCTA 3IDBB 3BN6A 4E4HA 1PZ8A 2QGSA 3CMGA 1JOBA 1KNPA 4A4AA 3N9PA 4JGYC 4CEYA 1LHUA 3JZVA 2XDVA 3HCSA 1CAWA 5C3OA 1GQEA 3VHNA 4C91A 5C2TA 2ES3A 1PGW1 2XPJA 3NAPC 1UURA 2W08A 3MO4A 4FTEA 4WZ3B 4CQIA 2OKXA 3RYKA 4WW0A 5KDMC 5L36A 1Q8QA 3HR0A 4B6XA 2RVAA 4EWEA 3MBWA 4GZ9A 1N34T 1R082 4AI3A 1XJAA 2RS52 3ATGA 4AQSA 1REEA 3JAFA 3VBUA 4YAXA 1YIFA 3QOPA 4GALA 1YKEB 4XABA 3PUXF 4AK3A 2GAUA 2R0FA 4AI9A 3HI2A 2LXHC 3KLSA 2W52A 5HV4A 4FBFA 4LO4B 4X1KE 2YEVC 1HYIA 1DIWA 5FR3A 4IV3A 4KI0F 4YBMA 4ZXKA 5KHHA 3ZXLA 5FO9B 4MGQA 2PG8A 2WNVC 1ASJ3 1QH7A 2YHOA 2MD8C 4HFCA 4Y4RA 5JR9C 4CUAA 3CWZB 4K1ZA 5L47A 2W95A 2BZDA 1UPIA 1IHMA 4MG2A 1F4AA 3URFA 2LT3A 5FZ3A 2R49A 1RUD1 1S0BA 2D6MA 3O1OA 5IT6A 4DV2T 1UMIA 2YDSA 1W9RA 4FFIA 2A5ZA 4LBNA 4EROA 2YGMA 3TEXA 4EAHA 3LGRA 1FX5A 2LEHA 4QPIA 3FUQA 3BOPA 4QB6A 3USUA 2W00A 3VKHA 2X5IC 2Z42A 2UXXB 4IREA 4QF2A 2ZCWA 2ZGOA 2XBO3 3AJZA 3Q5WA 2VPEA 1BBT1 1CZVA 2K46A 1KNRA 1BVP1 5CAZA 4Z91A 4YZ4A 3KWVA 5DQ0A 1SBEA 4OUSA 5FZOA 3O14A 1B35B 4HPKA 3SMHA 2MOZA 4HG6B 2RS11 1VD4A 2X51A 2SBAA 5FLIA 1HR0T 4A56A 3PURA 4E8CA 2A6ZA 2HEYF 1SPPA 3ACFA 5FYTA 1SA0E 3MIHA 2PHLA 3AL5A 1D2QA 4NUBA 1BEV3 2PUYA 2VL8A 2VZUA 3WXPA 1DLLA 4QQLA 1F2NA 1S0CA 3RJRA 4QKNA 2FFWA 3MHZA 3U5OA 5F3GA 4AQYT 2A7AA 2DJAA 3VBUC 2WNOA 4AVAA 1RUF2 1OUXA 3ZT7A 2JRJA 2WWVA 5SVYA 2DDUA 2C5DA 3UV9A 4COZA 4LXLA 5DUXA 3ZSKA 1C1LA 4P9YA 1OUSA 4FP3A 3K2OA 4I7CA 1N1TA 1UOGA 2JQQA 2X0HA 2WQ8A 2JDUA 4N4FA 1XZYA 2VMFA 2VASA 4WBNE 1FOD2 4JYAT 4N7IA 4JTOA 4I09A 3AAEB 5IVYA 1VB4A 4KUMB 1SCRA 2VO5A 4ZU5A 1GOHA 3I97A 1F8VA 1OEDA 4DY5A 1LESA 2WLQA 2XR4A 1UYXA 4N7UA 4JI6T 1KFXL 5CA0E 3D0JA 5L3CB 4B7KA 5E8AA 2ZM0A 5I0RA 5AQQB 2YXSA 3ETPA 1Z7S1 5JXGA 1LOFA 1YQ8A 1C1FA 5CG8A 3AXJA 2V5DA 4IL4A 1OQDA 4JDOA 1XMQT 2WN3A 3NV3A 2YPDA 4V1PA 2VUAA 4CZZB 5JDMA 3FLRA 5AVAA 4Q5OA 5LHIB 1QIQA 3PVBB 3CJXA 4LADB 4UXAA 1AYN2 2RR11 3ES1A 3WR0A 2XAFB 1J5ET 3THDA 4XF3A 1ENRA 3ZMOA 4A3ZA 2B46X 4W65A 4YG6A 4KBZA 4CXYA 4TXWA 5C8CB 1KQRA 2X9YA 2QCSB 2XB6C 2ZJCA 2LM3A 2MIQA 3POWA 2NMOA 2XOZA 3B94A 2WDRA 3O7AA 4HWHA 2E33A 4GULA 4PLOA 4HFHA 2RV9A 1AXKA 2EICA 1WBFA 4I0UA 1ULPA 4BIOA 2XQ5A 1DVPA 2D0TA 4BK5A 4WZXA 1W03A 2JKBA 5LGTB 3O1JA 4DV3T 4WVMB 1MMAA 3NBXX 1I5ZA 4Q25A 4EB6E 4XHBA 1ZRCA 4BDVB 4Q4Y3 2YQMA 5FZKA 2FCUA 3HPNA 1T2XA 4Q0UA 5FNVE 3M70A 4AKGA 1G8WA 5KXDA 2VTFA 1X50A 4JGYB 5JXJA 2RJKA 4GB31 4CDXA 4EV6A 1QOSA 5IJRA 1RUJ2 1VMHA 3PL0A 2JDPA 5F37A 4Q4V1 1YJKA 3S0MA 4ZI3C 2KWIB 2HKXA 1GOGA 3ST7A 1YQCA 3ZCIA 1W0OA 3C98B 4U36A 3ANWA 1V70A 2Q9QD 2KD7A 3M62A 1VBC3 2CY6A 5EPAA 1SLCA 3AEDA 3NNLA 3MV11 1VLNA 3B5LB 1CR7A 3POBA 3WD5A 4QXCA 4XF4A 2FDHA 4IGPA 4CVUA 2VQET 3BYWA 2MAWA 4BISA 4ATFA 3O1PA 4CZSA 2JQKA 3QC9A 3WP6A 4CCOA 4GKYA 4AGGA 5DINA 2E5VA 2ZXQA 5LCYA 5A7NA 3KHBA 2XQAA 1RUI1 4YW7A 3HBZA 4EYYR 1QJU1 2D93A 4IT4A 3POSA 1T8BA 5HEUA 1OQ1A 4PDWB 1ZZ7A 3RYPA 4OZXA 1K12A 3VDBA 1D0XA 2CT2A 1AJOA 1OLQA 1FMD3 1D0ZA 3B5MA 3EHKA 4ZQLA 3OTFA 2WNVB 4ASMB 3B13A 2VW2A 4HKAA 3NJZA 3VZJA 5AQSB 5T50A 1VBA2 5CFCB 1X7NA 1RJ7A 2RP4A 4U7IA 2M6MA 3KCXA 5CADA 5LKZA 4Q4X3 4BJNA 2CYFA 5SVXA 5AC93 5J0ZA 2LSKA 4QGMA 4RGGA 1V9DA 2Y48B 1KJRA 2XG3A 4EIWA 2FHRA 3A8YC 2PHRA 3UJQA 4GWNA 3MDBC 2KMFA 1IKPA 3LA2A 4XF9A 1KJLA 3TLTA 3OD0A 2G9GA 1AR92 2NP9A 4HSLA 4KHZF 5JXHA 1W28A 3N2GE 3U1XA 4UI9L 2B5HA 2D5FA 1JNRA 3M3QA 2L80A 1C57A 4XACA 3OBAA 1XNAA 1G9CA 4E2GA 5FPVA 3HN1A 1GR3A 4ILBA 3FFQA 2ZABA 3IBPA 2ACZA 4XETA 4BOWA 1LKNA 4I01A 3K3OA 1YFXA 4BQ2A 2Y26A 5A33B 3ZFEB 2P3YA 3MIFA 2VZ3A 5AQRB 3C4WA 2QDNA 2L9QA 1ZYBA 4QDRA 1O3RA 2LV9A 3MV01 5L73A 2CHNA 2BU9A 1MQTC 4AZZA 1L3JA 5F5WA 2GMPA 3RZLA 5FKYA 4LUMA 2J1VA 5B2GB 3ALQA 4B3MT 4Y22A 1WWYA 4O4HE 1BCXA 5E16A 2XHKA 5D21A 3CDZB 3LIGA 4Y3OA 4U72A 4MUVA 3EUHA 1S1AA 3WQ7A 4MOAA 4A44A 2WT2A 3ZLIA 1LAJA 4AI2A 3SFDA 4LHLA 2NTYA 2HYXA 2G9ZA 3T4HB 1S35A 4K7JA 4A7YA 1D0GA 3P7IA 3QOFA 3N2KE 4GNGA 4BHWA 1PX4A 1HW5A 4AEJA 1MS9A 5CBLA 5D2AA 1SACA 1H2KA 2X66A 2QZ2A 1YWKA 3TLSA 4Z82A 1QJEA 2VVEA 2XASB 3BI3A 4XOGA 1OVPA 3HMYA 4OI2A 2DTYA 3A7MA 4IDQA 1R091 4H9RC 1UNBA 1NCQA 1WEWA 2ECTA 3ZN6B 3C7OA 1LVFA 2EXJA 1HYJA 3C4ZA 1UY4A 1WCRA 4Q27A 1HF8A 1S0GA 2E26A 4K8FA 2YUEA 3VZMA 4X6QB 1KD7A 2VNOA 3KV4A 2A1XA 2VW0A 2JDZA 5F3JA 5FZAA 2W9XA 4YSYA 2ZAAA 2L43A 2VPGA 1AR72 2Z5WA 2DTWA 5LJNA 3HNBM 1TVGA 2WT1A 4QM9A 4NHLA 1QJZA 3WG4A 3RZHA 3OUIA 3L1XA 4FPFA 5ABJA 5A3WA 3GDBA 2PLV1 2FD8A 5GLVA 2DL1A 4L5GA 3WAJA 2YUCA 4LJNA 1Q43A 1NA1B 3VRBA 4TUYE 1TME1 3WNMA 4AEMA 1AJKA 4ES9A 1HXS1 3LEMA 4OYUA 2WBKA 1ZRFA 4TWFA 3EHZA 3MUZ1 3I3EA 2MEV1 4RS5C 1YQ4A 2V7KA 1JZ5A 2JPFA 1SQ4A 3JB4C 1JZ6A 3I3QA 5DKAA 4ZEYA 4QHBA 2KSRA 4MZUA 3VDCA 4F6RC 3J7MA 3I49A 3NO8A 4JI8T 1VBD3 4E7ZA 2R16A 1T72A 4NWVA 1PNFA 1PO13 4B3NA 1W0AA 4IV1C 4WM7C 5CA6A 3QZVA 2H0VA 2FUPA 2J1EA 5SV8A 5G04L 5EYXA 1NLQA 4QGNA 1YFUA 2IC6A 4YYOA 1ST8A 2VTXA 4ADZA 2D44A 3H8UA 3J8F3 1PZ9A 1RUG3 2NMNA 2VOVA 3CIHA 3ZCJA 2JJ6A 5BNNC 3LK2B 2BVLA 1SEFA 4NHMA 1OKQA 1Z60A 5JDLA 1AVBA 3FZMB 1R1A2 1YQ6A 4H9DA 1LOEA 2L0BA 4HZFA 1F5FA 3RG0A 4AVVA 2CWSA 3FZFB 4JV4A 3B9IA 3SCHA 2ZKLA 4E8DA 3LQIA 3X1DA 2XBO2 2ZM2A 2VXRA 4IEQA 2RJLA 1KRIA 1CAXB 2IC1A 2BDRA 4COUA 3KT1A 1XBFA 3ASIA 3SFEA 2J1AA 4EXTA 1WMFA 3C7EA 3LQJA 2XVLA 3VHRA 4LO5B 2YK0A 2BNNA 2GN7A 3H0OA 5F32A 2RS31 2ETEA 1I6ZA 1DCSA 2V7JA 1ND2A 4K0UA 2C5JA 1F62A 2D0UA 4MYEA 1POQA 2B7YA 2LSYA 3V0AA 2YN6A 1TG7A 3VDDC 4XFFA 2FSAA 3Q9DA 1BEV2 3BKZA 3PMEA 3LDQB 3AMHA 4TZ4C 3TN91 4DR3T 3PVNA 1T6BX 4BQ3A 1W6MB 4FOYA 4LORA 5J7MA 3GALA 4L9BA 4D94A 2PTFA 3N9QA 1W09A 2EALA 3M3EA 3WG3A 4DMVA 5HEGA 3PUGA 1CAUA 5JQGE 4JX0A 2ADDA 3ZEFB 4XPVA 5K0UB 2FQPA 1I9RA 2A3YA 1IBLT 1HG5A 1RMDA 2YBPA 3R05A 3ABVA 4NUVA 1W8TA 5FO7B 2BKOA 2WNUB 4N53C 5HV0A 1RC6A 1O4TA 4TYSA 3ZSTA 2D7FA 1HRI2 2QA7A 1VRH1 5T5OA 2HH9A 5BNOC 4K40A 2J1TA 3HQXA 1RUH2 2YFZA 3FZKB 2DCFA 2F6BA 3J7NA 4IDNA 3J7HA 3LIHA 4IHJE 1QJX2 1UY1A 3L8RA 1RJ8A 2WZR3 5K4LA 5LBBA 1RB8G 5CU1A 2JDMA 4BQXA 3DECA 1WILA 3VBRA 4IEXA 4IXLA 1JYNA 1N1YA 3H1WA 1TMF3 2X9XA 3GN5B 3F57A 3TOJA 2ZX2A 1MQTB 2ENRA 3RIUC 5FMCA 1IYMA 5JWPA 3BPSA 2ZM8A 2VQFT 2QJ0A 1E4UA 4H55A 1HB3A 3RC8A 3H3UA 1RL3A 2NR4A 5JLVA 3SHRA 3DEMA 4AQGA 2EIBA 1OLMA 4Y20B 4M00A 2W92A 2R6QA 3JB8A 3WDTA 4DR2T 1X4UA 3THPA 3W5MA 2R6GF 4AE2A 1SBDA 2BVVA 3Q9OA 3EDUA 3KF5A 3ZIWA 1MS3A 4DS0A 5F7UA 1H9PA 4B1MA 2IHR1 3W5NA 2YU4A 1OFNA 4IEWA 3WSOA 2XQYA 1GWLA 1GSLA 1KFUL 1F9KA 2VOWA 2R042 2Y38A 5LATA 3KV5A 2YU2A 2GMMA 4AHYA 2Q5TA 5FP4A 1POV1 4FCAA 1UU6A 3A0NA 4Z0OA 2BBAA 1NX9A 1FPN1 2DLRA 4Q0QA 4DEVA 4X62T 4NIHA 4PJMA 3LSDA 2WFF2 3DF0A 3LOIA 4AI8A 5L7OB 1UIKA 5IK8A 5ACA1 4AKIA 1LHWA 4WM8A 3WOGA 2R063 4QX8A 4GH4A 1ZZ9A 1YYNA 1ONAA 3CZJA 3USSA 3P1IA 2C26A 1ENQA 4YFZA 1W90A 4CU7A 2W62A 2ZX0A 5DZFA 1OA2A 5FZGA 1I3HA 4RR3A 3WZ1A 2D97A 3B57A 4R2YA 3JADA 1IKQA 5ERLA 2AH2A 1NCRC 5KXCA 2G6QA 3VKGA 2A6VA 4YZ1A 2LUWA 5I8SA 4HT1T 1ODNA 4NPPA 2MEV3 2DWKA 5IVJA 3H3ZA 1S0DA 3Q8BA 3HKCE 4KG8A 3I3DA 4I7DA 3JXSA 3ZN1B 2CL2A 1V6IA 4JKMA 2XPKA 4Y24A 4S3OC 4RS5B 1BLZA 2CM0A 4TZDA 5AQNB 3ROUA 3SH3A 2WQZC 3MIDA 1COV2 2XONA 4ZS2A 4NIAA 1JHNA 5JTGA 1FMD2 1XNDA 3PUVF 3RTRB 4BQ5A 2GNMA 1PHMA 3OY8B 2H0BA 1ND3C 5JRCA 4CI1B 1TE1B 4IV1B 1W8NA 4LQRA 4GNEA 4WM7B 1OOPC 5T5LA 4QXBA 1DZRA 2LHNA 4ZZ8A 1MACA 5L9VA 3D0TA 4HGAA 4IEPA 2R32A 1OQEA 2PMWB 1E2AA 3CJIC 3LF7A 5BNPA 4Q4X2 3WF2A 1D4M1 5AC92 3P50A 1N3QA 4DUWA 5GLTA 2WLPA 2YINA 3CX8B 1LTEA 5BNNB 5FXVA 3WEZA 2JD4A 1A34A 3P3PA 2GC1A 5FZ9A 2ZAHA 2VJEA 2OA2A 1NY72 3C6WA 5B76A 4YBTA 2VBPA 2DUPA 5L3DB 2CPTA 3QACA 4FT8A 3EB5A 4OYKA 4TNWA 4QPGB 2HWB1 4UT5A 3RDIA 1RVF2 1QJY2 1QNWA 1LENA 5FUPA 3ACGA 1HV1A 5IWAT 2AN6A 5IATA 4LBQA 4I7BA 4KBBA 4HFIA 1W0PA 1GQPA 3WI3A 1RGSA 3K4ZA 3AYCA 5FLJA 3DP7A 3NZPA 2VZQA 2EHOC 4IEVA 4LT5A 2L9LA 2WZEA 1WUVA 4WM8C 5F6KA 4R8HA 4FTSA 5FZMA 2FUIA 4JC1A 2RE9A 2XQ4A 3ETQA 2UY9A 2D9DA 2RM21 3QH6A 2XQ6A 5DDJ3 5F5AA 4YADA 5ABFA 2MA6A 3VDDB 4BQWA 1LDJB 3L1ZB 1Q8PA 4FPGA 1BKZA 2WAUA 2W0XA 2WMNA 1EAH1 4EN0A 5FV3A 2YV8A 3ZMUB 4MALA 5FP3A 2EVXA 3NNFA 5LCWB 1QU0A 2OW4A 1LU2A 3UULA 3ZXDA 3OGVA 5ANNA 4AXPA 2W5FA 3H50A 1D4VB 3SWHA 3ESLA 4Q8KA 2YHJA 3T0DA 4RQPB 2UXBT 5FBZA 1DU2A 4D3WA 4XFAA 1AXZA 4YVSC 3PVOA 2LS6A 1K5MA 4L97A 3WQ1A 2VZSA 4OI1A 2PHDA 4LJHA 3NWIA 3QUJA 4CDWC 4ILCA 4GOUA 1YD8G 2PAMA 4YY3T 4N53B 5HEOA 4JV5T 1KEXA 2JDAA 3FMGA 1U4QA 3JBG2 3HA4A 1CIWA 2VAUA 5BNOB 1ZZCA 2Q8EA 4LMLA 4TLGA 1N33T 2OZ6A 4L58A 3PTRB 1UW8A 5B4NA 4AFDA 3EYPA 5JZGA 4ES8A 1TQ5A 2Q1MA 1NAFA 2QQUA 3RH3A 4NRPA 2CNAA 1WLDA 2XOCA 3O33A 4PQ9A 4XBLA 4LF4T 3K51A 1GWKA 1SLTA 4C9ZA 1XNBA 3NV4A 2ARAA 4QX2A 4GWMA 1U0AA 3MACA 4YTMA 4OZOA 1FNZA 2IXJA 1ZM1A 4D7YA 3UNPA 2ZHKA 4EZ4A 2YROA 3UU6A 4X20E 2A70A 3VHLA 5HCHA 2HWF1 3U07A 2RJ2A 2H0DB 3LE0A 2QQLA 4P5YA 2SPCA 2N7GA 2UXNB 2BKNA 3B00A 2VJXA 3O1RA 1US3A 4N43A 2D6PA 5FZBA 4WYVA 2LXPC 2Y6FA 3UU8A 5FPXA 4TKPB 4JHTA 3E2DA 4HK9A 2WS93 4LO6B 1KF6A 1PO12 1GV9A 4NIGA 4FOQA 1AX0A 4B29A 1S0FA 2AZ5A 1W9WA 2Y8KA 3L3PA 4JI1T 1XRUA 3RWNA 3SOUA 1NXMA 5LKUA 1WEVA 2K2SA 1GZWB 1OEDE 3IMNA 1H1MA 3J8F2 2DFCA 3LEGA 1XOYA 3OSDA 1JN2P 3L2YA 1I94T 5FY1A 3IBMA 5L3EB 4CN4A 2RS51 5KHGA 5A7WB 2NW9A 4XUPA 3C64A 4A0CD 3PUSA 4K20A 4ITCA 2CSYA 2D2SA 4E4DX 1MM3A 2WBLA 2XH6A 3NNGA 3E1F1 2OIIA 2AEZA 3AVSA 4OK0A 2D3SA 3SEPA 4K3UA 2LSJA 5EK2A 1K5MC 3O0VA 4TNVA 2GMEA 3L2HA 5B4XA 5DQVA 3MLKA 3G06A 4LK6A 3QBQA 1EPWA 3K8PC 2BV4A 2MNYA 3ZT5A 1UZYA 1FJGT 2VOTA 3OGGA 5AQIB 5HYAA 4Q0SA 4TSVA 3MDPA 3H8XA 3WUCA 3K4AA 4S3OB 3L39A 3BALA 4TWDA 2XMLA 4HLTA 2Q30A 1I6XA 4AEDC 2ZEXA 4QQHA 3RRDA 5JZGC 1ULEA 2ILMA 1XC6A 1YIPA 4QAWA 3U4XA 5HAXA 5ISLA 1Y7BA 4BAYB 2C4XA 1OOPB 5A3MA 3WW4A 5A7SA 3CJIB 3WVJA 1RUE1 3AB0A 3VDAA 3WHUA 5A1FA 1W9FA 2CLYC 2Z4FA 3DDTA 4IEZA 5D1MB 4M3CF 3I0OA 2XAHB 4L99A 2VW1A 4XBFB 5FDBA 2DV9A 4LR4A 4H3WA 4QKDA 3LD8A 5JDGA 5TRBA 1DP0A 2DCZA 4YW4A 1L7QA 1VCSA 3IB3A 4F7ZA 2CWYA 1B7TA 2UWAA 1LB2A 4DR6T 1LEDA 1O59A 1US2A 3UGFA 3KM5A 3ZPYA 3KMHA 2RMU2 3AMPA 4GXLA 4K0KT 4CCDA 2CXLA 4INDA 4ZUXU 3L9JT 2V5CA 3C50A 2ZMNA 1REFA 1ZBE3 3ITQA 4LEJA 2LOSA 3AYEA 2K9AA 5C3JA 5CZKA 4DIDB 1OXCA 4MADA 3RPGC 3BPZA 2W68A 5JOZA 1GBGA 3ILFA 1G9BA 2EHOB 4X66T 2K9ZA 1K5JA 2MNGA 4QF3A 5FRAA 4XURA 2KWNA 4JEUB 1UOJA 5A3NA 3BOWA 2QQPA 4BXFA 5CB7A 1UGOA 1HN1A 3PUIA 4F8AA 3GZAA 1Q56A 4AR2A 4YJ3E 2P3JA 3HKBE 4LLBA 1GQHA 4META 2BDEA 3S57A 4A98A 5CVRA 2IXKA 4W8JA 4D8MA 1FMWA 3VZLA 4QXHB 2CA5A 4KGGA 5JAXA 3OEAA 1AXYA 1HRV2 1BQPA 2D5HA 4QPIB 3N9LA 2CSVA 5CFBA 1O3QA 1SZBA 3VBOA 1WLWA 3O12A 4MVTA 3GNEA 2OVUA 2I45A 5FZLA 4EGWA 2WQ4A 3BB6A 3U78A 3RI9A 5FPAA 2D40A 3ZIXA 2CHOA 2CRWA 4XQDA 5EYYA 4Z2WA 1DYOA 3Q8CA 4CDWB 3O1UA 3CVRA 2PA7A 4X64T 1NZIA 1J1TA 4B3ST 4NPLA 1C8M3 4UV9B 3C51A 2NN8A 1O8SA 3LWCA 3J26N 5A3LA 1OPOA 4N8MA 2V4VA 1Z8UA 1AYN1 2BG9C 2Q9QC 3GV4A 2CTVA 2VUJA 3P4SA 2ZMKA 4NHXA 4AVSA 4Y1VA 3CHXA 4ARYA 5CJ5A 2Q1FA 2E9XA 1REDA 2MT5A 3ZMZB 3AE5A 1UCXA 4P14A 3TEYA 2OA5A 3WAKA 2D8UA 3FX3A 1WFDA 3K75B 1MVEA 2EODA 5FMOL 4X65T 3VD9A 1W6QB 4NPRA 1GP6A 3OPTA 1QDCA 2JE9A 3VKNA 5LBCA 5C3RA 2BGOA 4DUZT 2XLAA 5FZ7A 1NWMX 4CP9A 1RYYA 5IHYA 3ZDVA 1H4HA 2L8KA 5FYMA 2ZGNA 4YG0A 2DUOA 3VBSC 3WNNA 3R6SA 2C0ZA 1RTVA 4MXWA 3B02A 2H3RA 4NE9A 1JOPA 3GHMA 1UZZA 4CCJA 3BGAA 3NRUA 3WW1A 4CCCA 5J98B 1CIYA 1RUJ1 5EK4A 2XY8B 2JQHA 1A8MA 5TAOA 5T55A 2O14A 4IE7A 1SE7A 5LASA 2YVRA 4GAZA 3T09A 5JDFA 4AF9A 2KM2A 1R083 2W67A 5KC6A 1W8UA 2WWJA 3CIRA 5D8AC 2KREA 3J7Yq 4O9GA 4ISSA 1G8XA 1GZCA 4UI9B 2RDNA 4W4ZA 2K17A 2BPA2 4A6SA 2HWD3 3HT2A 3ZYIB 2XHEB 5GZFA 5DAVA 4FFHA 1CONA 3DTOA 2A3WA 4KWJA 3ZPOA 1RUC2 3ETUA 1Y01A 4COVA 5J37A 1XE8A 2ES0A 2MBGA 3K1SA 2QNKA 4KNCA 1RIRA 3U11A 3C7HA 3VBOC 5AIUA 2QYWA 1WW7A 1AYM1 3ZKYA 2OQ7A 1ZVFA 4A4CA 3AXEA 3LPGA 3S4UA 3ZMTB 1A8DA 2JMHA 3I3MA 1MIVA 4BB3A 2WT0A 2ERFA 2DVAA 1JYCA 4A3XA 1PIV1 1YW0A 3IT8A 2B76A 1RITA 4PAGA 2ZGSA 3FUOA 4N78D 1AR83 3ONLC 5J2TE 1H6YA 5GZDA 5HCJA 2PYTA 4EEBA 2FDIA 3LBXB 4TX5A 1T1HA 4QDQA 2CCQA 1O5LA 2YZ4A 3IM0A 4AEDB 2NTXA 4U2AA 4ZU7A 1V6NA 1W05A 4YM0A 4P5OB 1SFNA 1JYVA 3NG2A 5J1XA 2PTMA 1QWRA 5IYZE 2K16A 1PVC3 5H1VA 1R8IA 4G2AA 4HFBA 1D7PM 1AR91 3ACHA 3AB3B 5C11A 4AHZA 2BP6A 2XOYA 4RSUA 4NN0A 4WZFA 3AL6A 3VL8A 2QKDA 2CLYB 2BOIA 2W47A 3EI0A 2MHFA 1IPKA 4XAXB 3R0RA 3PE0A 2W3JA 2HYED 5FYYA 4AIUA 1OH3A 1SCSA 3V0BB 4O4LE 2W94A 5FK8A 2WINB 5HWYA 1QUUA 2VECA 4CCKA 3DCQA 1L7RA 3OGSA 1JYIA 2B45X 2CKLB 4KWLA 3OD4A 4E9KA 2Z79A 4MFRA 4OFZA 2RDRA 4MGZE 4NROA 3FB2A 1UYPA 2ECGA 4YRDA 3Q5XA 4ZZBA 4COWA 4PCRA 3IHRA 1Q5OA 2NP0A 4BQ1A 2LGVA 2QQNA 2CGPA 2VZPA 1KDKA 5C70A 4A5XA 5CGMA 2JJ9A 3HKEE 2VJFB 3S5AA 3WNOA 3VUOA 1WFKA 1ULFA 2P3IA 5C7GA 5JMOA 4BIFA 2I07B 4GIWA 1PGW2 2BQPA 3GM8A 1S2BA 2M6IA 4PTBA 4NOTA 2VZRA 2QJVA 1RUF3 4XDOA 3M4FA 4B1LA 1NKGA 1U5ZA 1Y43B 4LLOA 3EVYA 3N36A 4QH4A 4NWWA 3RVHA 1C28A 1NT0A 1QXRA 4Y1YA 4P9GA 3VB9A 5CFDB 4JQTA 4LMJA 3LZZA 1MIYA 4EEDA 4CUBA 1CUNA 3C4XA 3GYDA 2K5BB 4Q29A 1RHI1 2F17A 4W6YA 1FOD3 1TNFA 2W1QA 2VP7A 2FCVA 1HQWA 3GJAA 4H7MA 2OT7A 4S2HA 2LQ6A 4QX7B 4RL7A 5LXTE 4UP5A 5G04B 1Y9GA 2JG8B 3KT4A 2KWJA 5AQOB 5JR7B 1G6NA 2VQAA 5SV5A 4UVCB 4GA9A 4Y33A 5CB4E 4BH9A 1FI2A 3JD73 3FL7A 4M3CB 2J1UA 1ZBDB 1GMMA 3KGZA 2CBIA 4YABA 2XHNA 2XUMA 3ZSMA 1DGWX 3E6BA 4D6SA 4PJYA 1A78A 4ONUA 5H1TA 1JBCA 3M99A 1MS5A 3O1IA 5A1AA 5IYYA 4FOVA 1ALYA 3ZYLA 2Y6KA 1DZTA 4Y1XA 1PK6B 1OT5A 2VCAA 4FVVA 2BG9B 2Q9QB 2D3PA 5CISA 1BYHA 4U3CA 1RUD2 3ZX7A 3AYDA 3JQXA 2Y6XA 3W59A 2ZHLA 1X9TA 3TEWA 3QLQA 4Y1UA 3HQUA 2BYVE 4ISRA 4I55E 1UU5A 3AP7A 3PDQA 3DJBA 3ORJA 1XNCA 1UPSA 2P1BA 5C3PA 1VALA 5LW9A 3FEHA 3ZYJB 4QHZA 1JS9A 1NYWA 4FP2A 1QEXA 3M3OA 5FP8A 4UVAB 2WAAA 3U4SA 3T30A 5LRRA 2VK9A 1ASJ1 3UFGA 1EUTA 3A7QA 1LRHA 1GNHA 3QNUA 5BR8T 5JOWA 4KMCA 3VBSB 3IAPA 2NLRA 2H6CA 1MMNA 4NXNT 3RFRA 4W6WA 4TWTA 3GBWA 5FMBA 5BY5A 2KNDA 1RMU3 1LGBA 5ABGA 5LK7B 3HWJA 4HKWA 2YY1A 2GALA 2LRLA 1F31A 3SITA 2ZTNA 4XUQA 4PI2A 4Y4YA 3VD7A 1UL9A 5C8CA 4O65A 5FYVA 2VD7A 5D8AB 2IXIA 4NMIA 1JZ4A 2CE7A 3CQOA 3ZJ2A 3AAAB 3C2UA 5C5UA 3AZYA 1B35C 2XBO1 3S30A 3IF8B 1WLCA 3LDBA 1VJ2A 4RN5A 4QB2A 4WVMA 1G9FA 1SDDB 3MGUA 4AFAA 1CD3G 5CKNA 2B39A 1YI7A 1J3PA 3SOWA 4LKDA 4JGYA 3WUDA 4LFAT 1OA3A 1QNYA 4X8PA 1SFPA 2DCTA 3BTZA 3FANA 4FPYA 5FOJB 1VBA3 1JMUB 1V0AA 2DI4A 4OGEA 1ZBE2 5I0SA 2X8KA 3NAPA 1W8OA 5L9RA 1WCUA 3GCXA 2CONA 4XUOA 2VMGA 3GL6A 3E0ZA 3NMBA 1BEV1 2X0LB 1IQAA 4FPHA 4FPLA 2CBJA 3B3QE 1UX5A 1IZNB 5T5PA 5LZ6A 4FO9A 5FOBB 3E6DA 3KS7A 5IUQA 1FP0A 4H9NC 2ZKNA 1XB9A 4OQ9A 1GNZA 1OA4A 1Y9QA 1Y9MA 3I54A 2JDNA 3HNYM 4ILUA 1GUIA 2YC0A 3ZSSA 4IETA 3O35A 3CL1A 2ECJA 2W2IA 3BTAA 4XFCA 2R30A 5E6HA 2P6HA 2FBEA 4PDWA 4DMWA 2OYZA 2WZHA 2VMHA 1DGLA 3ZKRA 4YFWA 1EV13 3MIBA 4PI0A 1WEEA 5A6YA 1FBVA 4NAMA 5DMYA 4CCLA 4AQFC 4HWDA 3E08A 4UOJA 2WNVA 1AL23 4EN7B 5CFCA 1N36T 3SLIA 1JODA 4SLIA 1L7LA 4NHKA 3BIEA 3FWEA 4HTEA 1GFF2 2VQTA 3J9SA 1HCIA 1KK7A 1C8M2 2NAAA 3M63A 4ORFA 4V3LC 4KWKA 1WEOA 3IDEA 2H89A 4GB32 1XMOT 4C0BA 5IVEA 5LKXA 4YGCA 4RGKA 1H2LA 4ZI2D 4YATA 4Z0RA 2Z2SB 2J22A 4Q4V2 5DZEA 1T7SA 4Q8LA 3EMRA 4YC9A 4YARA 5ANQA 4FTBA 3DPRB 3S7EA 4NR1A 2ZX4A 2X5IA 5LBFA 4QB1A 4WNKA 2XQ9A 3TLUA 3LJUX 2Q1ZB 1GOFA 2P2KA 2FJBA 4OMDA 4AFCA 3CMLA 4NXMT 1C8NA 3NJXA 4URTA 2DYCA 4Y5Z0 3ETVA 3ONXA 3AEFA 4CXXA 1OVSA 3PHDA 3DGTA 4JI4T 4PW8A 1H9WA 1OURA 5DXDA 3TWIA 1K42A 4IW3A 5ABEA 2ZGMA 4DB5A 2BW8A 1JYWA 4EZHA 2GH8A 1Z2QA 4O2BE 4BQ4A 3GXUA 5C13A 5JREA 1WIMA 4Q4Y1 2X29A 3ZSLA 5J09A 4LK9A 2ECVA 5A33A 2FJEA 5J3XA 1QJU2 2BNOA 4IEYA 3ZFEA 2QVAA 4OI0A 4DZGA 4CXWA 3EB7A 3J4UH 1MS8A 4O9EA 2JECA 4UW4A 1SUMB 1BMV2 2C9KA 1YKHB 1X9PA 3O0XA 2E7QA 5ADXL 1AR73 4O61A 4XZUG 4XFIA 4IE0A 1J84A 1J5WA 2D8SA 4HN9A 4LF5T 1GLHA 1VBC1 3UKVA 2W61A 2XWBB 5FJHA 4WZ2A 1HFAA 3RLFF 1DDLA 1GANA 1IJ5A 4HN0A 3I8TA 3IDAA 4CCGX 1W39A 3HR9A 3VBRB 3O5SA 2HWD2 1FEWA 1CX1A 3AE8A 2HHHT 2JICA 4P9LA 2VNRA 2X05A 4EWAA 3NJVA 2HPJA 1J59A 4HMZA 3PUYF 4PDWC 1FNYA 2O8QA 2ZBJA 5FEYA 1WD4A 3Q5EA 1CESA 4DR7T 3W15B 1KS4A 3NL1A 4Z2AA 1DHKB 5HEJA 1PGSA 2ZGPA 5I0TA 3HEIA 5FZ8A 5A1LA 4ANJA 4S2DA 3ZN6A 2YDQA 5CFCC 4YXDA 3EDVA 1FMD1 5I91A 3AE9A 4M0NA 1BR0A 3OBZA 3PJAJ 1WEMA 5FUNA 1FV3A 2QQIA 4LA2A 4YVWB 1ZZBA 3RZMA 2VR4A 3VKFC 3AA7B 5FIXA 4XJZA 4LIUA 4AYCB 5I8TA 1AR82 5TDWA 4YT0A 4GQ7A 1UU4A 3T08A 2IDAA 4Q4X1 3VKOA 3CF6E 4M4PA 4MGKE 4YJ2E 5GZCA 1WW6A 5AC91 2E61A 4OQ8A 1APNA 4BXSV 1R1A3 2I59A 4R52A 2WWSA 3O34A 1TZOA 1WR0A 1FIOA 1PVC2 1N32T 1NY71 1W9TA 5FYHA 1UYZA 2ZGTA 1YRZA 3VR8A 1WGMA 2H7VC 5DG1A 4CA1A 1HG2A 2K48A 3AA1B 3FBMA 1U5PA 4P0BA 3MPPG 1UD1A 2J7MA 3D4KA 1IOAA 2OV9A 4CSWA 5C5TA 2MPFA 3A4UA 2ARBA 3X29B 1JH5A 5A7PA 4A97A 3GBGA 1WKYA 4G3YC 4QX3A 3ZFEC 4CDUC 4AUQB 4PJNA 2FZ1A 4U74A 4UBGA 3RQUA 5GZEA 3WF4A 3POYA 3KBUA 2M3HA 4AVCA 5CA1E 1HJGA 3I2KA 5APAA 5JI9A 1YXRA 5HXSA 2I2SA 4IEUA 3K3QC 1W06A 2UYAA 1H8TB 1U12A 2VOXA 2V73A 2UXCT 5LGUB 4DUYT 5IK7A 3C5KA 5CNAA 4CCMA 2YW8A 3OF1A 5LA0A 4QKFA 5K8SA 2M13A 4EE2A 2GU9A 1WZXA 5CG9A 5LA6E 2NPIA 3G7DA 3LDRA 3H3MA 2ZHMA 4YM1A 3H3AA 2D6KA 4LKSA 2LM9A 3WW2A 2D6NA 2Y0OA 2MA5A 5T5JA 1W8FA 4JI0T 2X09A 3TBDA 1M4WA 4CN1A 1QQP3 1VAMA 4WVWA 3THCA 3ZYGA 1TME2 3TRSB 1HXS2 1SFYA 5F6LB 4DY3A 1HRI3 3LJCA 3I2HA 3ZYFA 1O3XA 3D3AA 1RUH3 4G63A 1SMVA 1G7YA 1CZTA 3JCFA 1O6UA 4AOCA 4DR4T 1QJX3 5TABA 3ZJ1A 1DG6A 2IVJA 2G1MA 2WZIA 3JD72 2Y8DA 4LKAA 2KIZA 1J3RA 2W1WA 4AP4A 3MZKB 4XDQA 3KV9A 4R9BA 2XL7A 1NAEA 1I5PA 3UYJA 1BXHA 5FZDA 4NIIA 4RFT0 1PZ7A 1V9U3 3EXUA 1W6PB 1W6MA 1A6CA 1NA1C 4NO4A 2LAUA 3PNAA 1W6OB 1UF2C 3AE1A 2XXZA 1DCQA 1CVNA 2HWC3 3UUMA 4FK5A 5AQJB 3T3YA 5IHRA 2BGCA 3E22E 2IVIB 1VAKA 3POJA 3ZXKA 3MF9A 1Q3EA 2BBHA 4JKKA 4ET7A 2R043 1UY2A 4XJAA 2LSGA 1XWMA 2V26A 3POGA 4K21A 3WNKA 1CN1A 2EAKA 3CZUA 3N3HA 3PUHA 4UW6A 1VP6A 2JX9A 5AQLB 1NQJA 4QT6A 4MGSA 4LO8A 2ZZQA 1MM2A 5AFEA 2QUOA 1VBD1 2WFF3 3O1HA 2BGPA 1PO11 2F4PA 4Z8XA 4GYRA 4GKJT 5BYNA 2RDQA 2DWGA 4LLFA 5KC5A 4D7SA 5K3QA 2JG9C 3OUJA 2WU5A 1CGPA 2J62A 3N9OA 4R4ZA 4P09A 2TNFA 2WL1A 3J8F1 4ISQA 3GN5A 2B8MA 3RI5A 1RUG1 3A0KA 5LEKA 1MQTA 1RMU2 1XWHA 5FZ4A 5FPLA 1SLAA 4HFVA 4ZY9A 4FAHA 5D1IA 4U2ZA 5FYSA 2QICA 5SVIB 2UUBT 5IVVA 4Y20A 4YSFA 2BOJA 1FV2A 4DV6T 5FCCA 1XSRA 3TN92 4DNDA 2IZWA 2R1DA 2E6SA 2W87A 1W2NA 4P1NA 2M67A 2K3WA 1W2AX 3MXZA 4RHV3 4UAPA 3SXWA 5KBFA 3WDVA 3RSJA 2JMKA 4OHWA 5IVFA 2A71A 1CJDA 4P0AA 1W9SA 4YTNA 4F8HA 3AECA 3AZXA 3KNVA 4QMAA 2XLFA 2HBUA 1OSGA 3VHPA 1HQNA 3GGLA 1DF0A 5CIRA 2Q4SA 2Y60A 4JVAA 5AITA 1COV3 3E5UA 5KHIA 3J9X1 2Q0AA 3BQKA 4KG0A 4KX6A 5AQFB 4ZPIA 2BEOA 3B01A 5L7OA 3MJXA 1VMFA 5GONE 2XQ7A 4LHNA 1AX2A 3LAGA 4LO7A 2WSUA 1US7B 3AEGA 1ZA4A 1VRH2 1W2OA 3RJ2X 5A6ZA 4UFIA 3WF3A 2JB8A 1OKOA 5AFBA 2MPKA 2UU9T 4L11A 4KWUA 1UYYA 1EPZA 5DQWA 1WE9A 5L19A 4DV7T 3RZGA 5IVBA 1P8JA 3L09A 1X36A 2WCAA 4LK7A 1NEKA 5AQMB 2JE7A 2CU5A 5K0UC 3OOXA 1HX8A 4MSVA 2MUMA 4CDQC 3AKSA 5KHKA 3SUBA 1RVF3 1QJY3 3CLPA 2V6YB 3N4MA 1W99A 3KBTA 1W6NB 2WNUC 2XVGA 2H88A 4HANA 2LTNA 4GMP3 5J48A 1ZOYA 2N2NA 4LKFA 1EP0A 2WO3A 2IWGB 4RS5A 3WQ0A 3RQWA 3K77A 3NSTA 1W9YA 2XJRA 2B9VA 1V6KA 2P6CA 2WSVA 5A80A 1EV12 2WY2A 1RUNA 4UXNB 2RA1A 3EBRA 3OY8A 5H9PA 2AC1A 1AL22 1JW6A 5C33A 2XJQA 4CDUB 4IV1A 4PBOA 2VL0A 4WM7A 3R4DB 3LA3A 1MZFA 3AAIA 3MF6A 3KQIA 4AEKA 2PQQA 2WZR1 5F2WA 5H6RB 2VU9A 3O37A 1GNYA 1JUIA 2GH2A 3T9KA 4LE3A 1TMF1 5DG2A 1LVKA 5BNNA 1J58A 5ACA2 2BZBA 3I1AA 3RWKX 1OWAA 4DBRA 2QQOA 2DWRA 3M65A 1MR5A 2D6LX 4O8SA 5AFUL 2B42B 3ZFGC 3SKVA 2RPAA 3ZPV1 4QPGA 3HD8B 1JYXA 2K1JA 5EV7A 2KYUA 3V5SA 4FPJA 4QH5A 4LIVA 4KBMB 2BKPA 5FO8B 4HFDA 5L3FB 4IUGA 5F5QA 3KDEC 4LMKA 1E57A 3B9CA 4I0BA 3N2OA 3QCWA 2C5IT 4NVPA 5E1RA 5L7OC 4D7TA 1IAPA 3PU8A 3JBG3 4N3WA 3KDSE 1ZX5A 2R1BA 2VBBA 4G4FA 4EQVA 4PIZA 4Q0VA 4XQ4A 4OULA 4EV0A 4X5TA 3NRXA 2ZMLA 2VKOA 4OHVA 2R061 3MKDA 2OS2A 4QXKA 2HWE2 5F5IA 3VDDA 4A7ZA 5LP6E 3UUNA 3VBFC 2MD7B 3VD5A 5L3BB 2FUUA 4WVZA 3LA7A 4F1PA 2QQWA 2XQRA 3Q8FA 3GWHA 4MH0E 4ZOLE 2AACA 4UR9A 1D4M2 5JVDE 1N3PA 2YC2A 3WLUA 5H6QB 5GLZA 4RQPA 2NW8A 4Q26A 3CQCB 4JGZB 4SBVA 2K24A 1DZQA 2VZVA 5EK3A 2ZEYA 3PIJA 3LDKA 5FY0A 2P37A 4AG4A 2Y6JA 2WJSA 1XNTA 3MHSA 2XB1A 3KVBA 2RG4A 5FLHA 3W58A 5C9AB 1IZ3A 2OWAA 3SH5A 4N53A 2D6OX 2XM1A 2HPLA 3IIAA 2KFTA 3RRWA 4FJOA 5IVCA 1H6XA 1QJFA 4OHFA 2IXCA 4P9WA 5BNOA 1MVQA 3N35A 2CDPA 5C6CA 2ZHNA 4O7XA 3BTYA 1HTJF 5FYIA 5FWEA 4XYXA 4IDZA 4AI1A 4IERA 3AYAA 1Z78A 1UN1A 1Y64B 2DURA 3PUAA 2JG9B 2PHUA 3T1LA 3OBVE 2JMIA 3T8OA 2B9UA 1DGWA 4HKOA 4CI2B 3RIUA 4X6RB 2RM22 4HBNA 2V8SV 1V6JA 3U5MA 4QPGC 4NPMA 2CAUA 3WF0A 4LBJA 1XDOA 3HJRA 5FZFA 3ZXGA 2GC2A 4MV2A 1KGYA 2XOMA 4TV8E 1E5IA 2BVBA 1ZKEA 4BU2A 2UZGA 2H0DA 2LDRA 5C3QA 5T54A 3DWDA 1PMHX 2P17A 3AZVA 4FSJA 4EOZB 2LW8A 2UY8A 5JI7A 4ZU4A 4OVEA 3AFKA 5LJMA 1O3SA 3POIA 3MUY1 4UF0B 5HCMA 4W6XA 4G9SB 3CQXC 1DGRA 1CWPA 1WCDJ 2VWAA 3NNMA 3UTKA 2VZOA 4KU8A 4CPBA 4R4XA 4CEWB 1QXPA 2VMDA 3OGRA 1KNZA 1HB4A 3N7LA 4DMIA 1GZWA 1UUSA 4WBBA 1OLRA 3ZC0A 2ODVA 1D1AA 1Q8VA 1N1VA 2A6WA 3RF1A 4Y1ZA 4RFRB 3UKTA 5I93A 4QU2A 4DRRA 3HQRA 4AVBA 5M0TA 2C2VS 5DDJ1 2ZX1A 5A7WA 4YLHA 1AR63 1C5HA 1W3XA 2WO1A 2Y0IA 2UUCT 3ONJA 1GZTA 4Y26A 5A3UA 3FBLA 5GLWA 1UOFA 4RQPC 3OJBA 5LHGB 2JIJA 1NCRA 5C4WB 2DVDA 2GNDA 4I30A 2XM2A 4XC9A 5FXXA 5CYYA 5FYUA 3U37A 2KKXA 2J1DG 2KA3A 4CDQB 3SOLA 1O8PA 3H1YA 1MEC3 1QQP2 5AQPB 2RMU3 3CKHA 3K48A 3PDYA 2Z6EA 5JR2A 3AMQA 4A42A 3UETA 1H0BA 3AEBA 3O9XA 1W04A 1NE4A 3SOXA 4U2YA 2HWF2 1K2FA 3EO6A 3OKQA 1D0HA 1G9AA 4AGVA 5FZCA 1XNKA 4JCKA 2HN1A 2F4LA 4ASKA 4CCNA 3FXDB 5JOYA 5LEJA 4IIJE 1YO8A 3BIWE 3D6EA 4UW3A 1HB1A 3U10A 1ND3A 4D6RA 5FY4A 5FFOC 3GF6A 4JDMA 1OOPA 3TEZA 2EAAA 2LN0A 1I1EA 1U5YA 5J1GA 4I0AA 4QQ4A 2VBDA 2A73B 4BBQA 2CXFA 2YG0A 4J1WA 3CJIA 5FWJA 2Q8OA 3THTA 2PJQA 1V9U2 3MPBA 4E7SA 2WC2A 3FE5A 4L8QA 4BLIA 3GCWA 3P5BA 5FZ0A 2MTQA 2HWC2 3U0ZA 2ET7A 1VBE3 3SS1A 4CU6A 4JHZA 4K8RB 3EQEA 1HRV3 4YHJA 2YU1A 2LKGA 2ECWA 1ZRDA 3CX6B 3ZFGB 2XGXA 4Q4W3 2VMIA 5J96B 1QH6A 1W2UA 2YSMA 2EGMA 1D2SA 3ZKUA 3VBHC 4O64A 3T6RA 5FZ6A 1SHZC 2R0HA 2QQKA 2M1RA 5FKCA 1ZP0A 3PU3A 4LNVA 2ZLYA 4MBQA 1HX1B 4LBQD 1J1LA 3P4RA 3ZFFC 4OMCA 1ZBA3 1X82A 5FZHA 3B7MA 4LMFA 3SNMA 3VLBB 4DV5T 2WS91 2W66A 3M3ZB 2D43A 2EHOA 3RKOA 5LB7B 1CX4A 5LA1A 2DUQA 3MA9A 2DU0A 3IZOA 2OQ6A 4J6GA 3FJSA 4XIOA 3ABZA 3M2MA 5FTTC 3WP3A 1XYNA 4X3GA 3P8CD 4DV1T 1SG3A 3AE3A 4GK0E 1NENA 3I0QA 3D8CA 4FPEA 1NZCA 4HKLA 4MLOA 3AKQA 3TYJA 2WUHA 3DV8A 3H42B 3VBFB 5F9TA 2C5KT 2ZGKA 5FPBA 3AA0B 2PHXA 4GK5E 2H7OA 5L4EA 3SH4A 1UKGA 4AI6A 3EJKA 1JXNA 4QXHA 3DXTA 4AHWA 4I0WB 2QVSB 4DPNA 3F31A 1Q8OA 1RUE2 3FHIB 3APBA 5FPZA 2NOXA 4RHV2 4TTGA 1WYBA 3RZKA 2DVGA 4O2AE 3KHCA 1XE7A 4DXTA 4YVSA 4BE3A 4E2SA 5LGNB 2CWMA 4X8NA 4LKEA 3OYWB 4DO0A 2OZJA 3MW2A 4C90A 4UWDA 2XTLA 3EABA 5F5CA 1UZVA 1H2NA 4CU9A 2PQSA 2WO7A 4I50E 3ZNIA 3GA8A 4CEYC 2MNZA 2IXHA 4CDWA 4NRMA 2IFRA 3IPVB 3BTXA 3WW3A 4GB0A 1S55A 4CRQA 3ON7A 4YW3A 3ZVZB 2WRAA 3F2ZA 4ILAA 4GNFA 1FXZA 3E97A 5EYAF 5KMGP 1NE6A 4UFMA 3PUQA 3T1YT 4XJ9A 3OVUA 1VBB3 2IW5B 2VNVA 3Q1DA 4FPOB 4KP3C 1V87A 3I2IA 4FFGA 1CZSA 1RUC3 1WD3A 3KT7A 4N90A 2VPDA 1PO23 1W6QA 1LOAA 5AQKB 4IDPA 2NZ9A 3W20A 3SCGA 4TN7B 3N7MA 1LKXA 5B8DA 2PHTA 1QDOA 2J42A 4MHUA 3E5QA 4UYBA 4XQWA 4CP2A 2ECIA 2LROA 4H63V 2V1DB 3ZMNA 4U31A 2GK9A 2WM9A 4IV3C 5HPOA 2KE1A 2KWKA 5FK7A 2X9WA 3RPUA 1QOTA 1FYUA 3OYXA 2VKDA 5B79A 1ZBE1 3J7LA 1X8MA 3TNPB 4OUMA 3M7KA 4BWOA 2DVBA 4IL7A 3T1MA 3FHQA 2AEYA 3C7FA 2CRRA 5DAWA 1SDWA 4GKXA 3LDYA 2R073 4A2UA 4HONA 4JI2T 3O36A 3CNAA 1VB2A 4H9OC 5LBQB 5A7QA 4ZI2C 1MNDA 2UYBA 1BHGA 4JEHB 3MW3A 4CUCA 2M85A 5HXCA 4QPIC 2IAKA 3CEWA 3AX4A 2A9UA 1JI6A 1IS3A 1AUYA 3AP6A 2G19A 4XI1A 4OHXA 1IG3A 4QWNB 1PGL1 2AENA 1JZ7A 2YC4A 2KINB 2JE8A 1DQ5A 3PJAA 2ZMAA 1XYOA 2QRXA 2E8IA 4BJMA 3LRQA 4O62A 5L4HA 2IDOB 3LBXA 5EWSA 4AFBA 5LOVE 3OB8A 3PIGA 1C8M1 4AEDA 5HI0A 2F6JA 4AQ2A 2YYOA 4I43B 3MFAA 1VIWB 4RGAA 5FKBA 3TB0A 4YBSA 1JM7B 4FXGB 3UUXB 3T7LA 1SLIA 3ASLA 3NAPB 3U3IA 3JUUA 3I59A 4B7EA 4HVRA 5F3EA 4WZ0A 3T2TA 1D1CA 4EN9B 1PMJX 1U5IA 1ZA7A 2WA4A 2P3KA 4HE8A 2LGLA 1QOOA 4UIGA 3MW4A 2HEVF 3UU3A 4ZI7E 1O91A 3HTKC 4I4TE 4COFA 1WENA 3V0BA 3NV1A 5FP9A 4AL9A 2YQLA 1HIXA 5KX5E 4JQRA 3QD6A 4IGOA 4AQ6A 4A7KA 5AQGB 2CKLA 4Q1PA 4R7EA 4L7XA 3CBNA 5FQ0B 4YW2A 4YPJA 3VBHB 4FFFA 3SQOA 1AYM2 4F83A 4XMIA 2YMZA 2ZGQA 1OEDC 2PN5A 3HVDA 3A21A 5FY5A 4DR5T 1BMV1 4NN2A 3ZFFB 2VJFA 1D0YA 1LOFC 5C8YE 4MGYE 4XXPA 5A6QA 2A3XA 3WCSA 2IQJA 4XJUA 4TV9E 1WEQA 1MS1A 1CAVB 2UURA 4OYJA 4YZ2A 3ZYHA 4IQPA 1PIV2 1R081 3Q8EA 1SLLA 1DQ4A 3BU7A 4IC3A 3OUHA 5JR9B 4ZXEA 1RUD3 5CFDA 4XFHA 5DUVA 3UU5A 2BBVA 3FFZA 3L11A 4DNYA 1WEPA 3JCIA 1WMXA 2HWD1 1ZZ8A 1KEYA 2A6YA 2DU1A 1DYKA 2IC9A 3M1HA 3AZZA 5A32B 1HDKA 4B4RA 1OMIA 1UY3A 3RZJA 4PK6A 4HK8A 4QX7A 2ADEA 4B86C 4UV8B 4QH1A 4CI3B 3HL6A 4XIKA 1BBT3 2JG8A 4PIXA 3ILRA 1VRBA 2X5IB 3H8RA 3Q5DA 2PAEA 3CX7B 5L3GB 1F5JA 2BBJA 3NKGA 4JI3T 2F6NA 2F4VT 4FXKB 2YKSA 3BU0A 1DFQA 3JU9A 4M3CA 2RS13 4QX0A 2JDHA 5EJ3A 4RA0A 4YTPA 4HWFA 4JUYA 3F2EA 1C4RA 2Y43A 3I2JA 4CEYB 5G05L 5GALA 1YEWA 1CAWB 1AR81 2DX8A 2KZ7B 4CDXC 3IEEA 3VN4A 5GLUA 4D69A 4ZKTB 3ACLA 2B1EA 1YJLA 2C1FA 2X10A 2LHRA 1PK6A 4HWCA 2D98A 2BG9A 1NQDA 3H8OA 2Q9QA 2VXJA 2RDSA 3ZDSA 1AR62 2W4XA