3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
5FXXA 2BAYA 2YU2A 5FPUA 2YQLA 3GV4A 5TDWA 4I7DA 3PDQA 3RVHA 5D1MB 1T1HA 5F3EA 2YU1A 4QU1A 2YSJA 2G43A 5FZOB 2VJFB 3ZPVE 3O37A 2XEUA 5TABA 3KV4A 3PUAA 3PU8A 2LXPC 3PHDA 2ECGA 2EA6A 5J3XA 5FP8A 4CCJA 4LJNA 5F32A 4AUQB 4WZ0A 1ZBDB 2DX8A 2YPDA 3MHSA 4YBMA 5TDRA 1RMDA 3O34A 2VD7A 5FUNA 5FZIA 5FP4A 4L58A 4BHWA 5B78A 3C6WA 2VJEA 5FEYA 2ECIA 2MD7B 4V3LC 5FYMA 3MHHA 4WZ3B 2E6SA 3C5KA 4UF0A 4BXFA 5A3PA 5JG6A 4UI9B 5A3TA 2XB1A 3UYJA 5FZOA 1XWHA 5FYCA 3ZPV1 5FYTA 3T6RA 5KH3A 5FZFA 4GNGA 5G04B 4IGPA 2VPDA 5FZ3A 2EGPA 5FPLA 4PTBA 5FXWA 2MIQA 2CKLB 2YHOA 4TN7A 4IC3A 2YBPA 3U4SA 2QICA 4LXLA 2YREA 2VP7A 5FY8A 1X4JA 2MNYA 5F2WA 5D1LB 3ZNIA 4EYUA 4I7CA 2Y1MA 2CSYA 2IDAA 5F5CA 4CCLA 2KREA 4A4CA 5KR7A 4B7YC 2LGGA 2YHNA 2NAAA 2I50A 3LDBA 4C9ZA 4FK5A 4AI9A 2WWUA 5FP9A 5FZBA 4CSWA 2HDPA 3N9PA 4XDOA 4V2VA 5FPVA 4QF3A 2GP3A 3O7AA 3LQJA 2G6QA 2OXQC 5LKTA 5F5IA 5FYBA 5ANQA 5LKXA 5B75A 3M62A 3RPGB 4YABA 2OS2A 3OPWA 4O64A 3SOUA 1X4IA 4WA6A 2OX0A 3SHBA 3PU3A 2KR4A 4GJZA 5ISLA 2YSMA 5FYZA 4DIQA 3EB6A 4QF2A 2L0BA 4GNDA 4QX8A 3M99A 5FZDA 2VPGA 3M63A 4X3GA 4F52B 2LV9A 5A80A 5A1FA 4QWNA 5FZ1A 4GD4A 2XDVA 3KVAA 5A3WA 5A7WB 3ZTGA 5LKZA 3PURA 3K3NA 2H0DB 5AITA 5B77A 3N9LA 4D6QA 3LQHA 1FP0A 4D6SA 1WENA 3O36A 4XDPA 4R8PK 2AN6A 2VPBA 2FSAA 3ZVZB 5H1TA 2YT5A 2YBSA 2KGGA 2LQ6A 1FBVA 5A3NA 4HOOA 3ZLIA 4Y3OA 4GNFA 5KH7A 4UP5A 2LDRA 2CT2A 5IVVA 4LLBA 5F3IA 4ZUXU 4CCGX 2CSZA 4DO0A 2C2VS 1JM7B 5F3CA 2P5BA 2E6RA 5A7WA 5IVYA 2L43A 5C11A 2ECVA 5FV3A 4YBSA 4HONA 3SOXA 1N87A 1LDKC 1F62A 5FPBA 5FB1A 3NG2A 1WE9A 2ECJA 2YBKA 1WEOA 4CA1A 5FZ0A 2MD8C 2LGLA 4AP4A 2OQ7A 2RSDA 2VJFA 1MM3A 5DINA 4CCMA 2M3HA 2PUYA 1WGMA 3T7LA 4URAA 5E6HA 4P5OB 2XUEA 5FYVA 4QXCA 5FP7A 4MVTA 3HCTA 5FYIA 2JMDA 4CCNA 2G45A 2KWNA 5FWEA 2KWKA 3LD8A 4XI1A 2LGVA 4QXBA 4EZHA 1MM2A 2QJ0A 4I7BA 2M6MA 2FUUA 3PUQA 2L5UA 3QZVA 4V3KC 3O70A 1WILA 3LRQA 2M85A 5FPAA 4B86C 4QX7A 2JMJA 5FYYA 2YU4A 3DPLR 4MSXA 2K4DA 4S3OB 1WEUA 3N9QA 2UZGA 2EODA 1E4UA 4LK9A 5F5AA 1WESA 2Q8CA 4V2WA 5TBNA 2MUMA 2ZETC 4L7XA 4CCKA 5FJHA 5IVCA 5FZ7A 1WEWA 4UP0A 3KV6A 4D6RA 5AIUA 2CKLA 4PPEA 2PXJA 3O35A 1G25A 4LADB 4YC9A 4CCOA 1WEPA 5K4LA 4LIUA 1VRBA 5D1KB 3KV5A 3DQVR 1VFYA 2YW8A 5DKAA 4LIVA 5A1LA 2F6NA 1VD4A 5FZAA 2LXHC 3AVSA 2OQ6A 5FXVA 4AVXA 5FZEA 2LGKA 5LY2A 4GB0A 4GAZA 3HCUA 1X4UA 3HCSA 5FZKA 4CUGA 2YYRA 4EZ4A 2VPEA 3L1ZB 5FY4A 2KE1A 2MA6A 5FZ8A 2ECNA 4ASKA 3NJYA 5F39A 1WIMA 1WEEA 5FY7A 3K2OA 1DVPA 3LQIA 2KIZA 5FZ6A 5FYHA 5LW9A 1HYIA 5G0FA 4W4UA 2MT5A 5FZCA 4AYCB 3FL2A 2H0DA 2K17A 4Y33A 2KWOA 1WEVA 3N9MA 4R7EA 4FO9A 2Q8DA 2K1JA 4YBTA 3ZVYA 5CEHA 2VJEB 3GL6A 5FZLA 4Q6FA 3V43A 4UF0B 3RPGC 5H1VA 5FYSA 1Z60A 2LN0A 3ZPOA 5F3GA 3EB5A 5IVJA 5FUPA 5H1UA 4Y4RA 4NN2A 1JM7A 3AVRA 2QIZA 4AYCA 4N4FA 5FYUA 2PNXA 2L75A 3HTKC 2K16A 3PUSA 2OT7A 2KFTA 5B8DA 3OPTA 1LDJB 5FY0A 5FJKA 1VYXA 4YATA 2JMIA 4ZQLA 5H9MA 5FZGA 4QXHA 5I3LA 4AAPA 2YQMA 4GNEA 5FBJA 3AL6A 4NUBA 2WWJA 5FWJA 5A7QA 1WFKA 4BU2A 5G05B 2FUIA 3KNVA 5C13A 5LCWB 2F6JA 2XMLA 1HYJA 4E4HA 3K3OA 5LWBA 5FP3A 4N3WA 5B79A 5FXZA 4BBQA 1Z2QA 2W2IA 5FZHA 3KQIA 2KU3A 5FB0A 2RI7A 5TRBA 4A49A 5IWFA 2C2LA 2Y43A 5F2SA 3VK6A 2KWJA 2VNFA 4A4BA 5KH9A 1K2FA 4YADA 5LY1A 5FZ4A 4IGQA 3O33A 4C8DA 3RTRB 3U5OA 2ECWA 1V87A 4FIPA 3N9NA 2GP5A 3U5MA 5A7SA 3DXTA 5B76A 2KYUA 2LRIC 3IHPA 5FERA 5IVBA 3L11A 2D8SA 3N9OA 2MA5A 3U5PA 2YURA 2F42A 4GJYA 2M1RA 1CHCA 1JOCA 5FY5A 3SOWA 1BORA 4IC2A 3U78A 5IVFA 4YAXA 4A0CD 2Y1NA 2YUCA 3AL5A 2MNZA 4IGOA 2Q8EA 3KV9A 2JRJA 4FJCA 5FZMA 1WEQA 2XXZA 4ZDTA 3I2DA 3U5NA 1IYMA 4WZ2A 2ECTA 5LKUA 1Z6UA 3ZYQA 4R2YA 5FY1A 4BISA 5A7NA 3DXUA 5A7PA 4S3OC 3L1XA 2L80A 5FY9A 1WEMA 4LKAA 4TKPB 3ASLA 3KVBA 2HYED 5FZ9A 5EYAF 4LITA 5A7OA 2KGIA 1U6GB 5IW0A 3PTRB 5IVEA 5F37A
chains in the Genus database with same CATH superfamily
4BQ1A 4WW0A 3AAEB 1W6OA 3WW3A 2NTXA 2XM1A 2XY8B 4P09A 4DEVA 5C3RA 4IW3A 3MK7C 3ONXA 2YU1A 3FUQA 4ZU7A 4ZXKA 3KV4A 3PU8A 2LXPC 4DMVA 4ORFA 3H3ZA 2AYHA 1MS9A 5FP8A 2WFF2 3WDWA 5KXDA 3FJSA 4K40A 4L58A 3C6WA 4EYYR 5HXSA 3HNMA 3CKDA 4LBNA 3U37A 2PHRA 1I6XA 3O1VA 3MO4A 2WMOA 4I50E 5G04B 1GOFA 5H9SA 3SEPA 3I9WA 4Q4V3 2W95A 2KR2A 1W9SA 3NRUA 2VW2A 3J26N 2FZ2A 3PUWF 4YVSB 1X4JA 3ZN4A 5D1LB 4EYUA 1RIRA 2V09A 1IAPA 3WCRA 3SFEA 2NAAA 2ORZA 4FK5A 3VBOB 1Z7S1 4QX8B 4KWLA 1DQ4A 2RR11 1MIWA 4Z1VA 1CAVA 1JNZA 3VGIA 1NYWA 2Z42A 2E63A 2MAWA 2CA5A 2P3IA 1D1CA 5HYAA 4MYEA 1FOD1 3TEXA 2ES0A 1VBB3 2GDFA 5BNNA 5F6LB 2BU9A 1OXZA 2ID4A 1WENA 1GWLA 1C3HA 1G9FA 4YW4A 4AXPA 5JDMA 4ZKTB 4XMIA 4BQYA 2WS92 4OLLA 4YGEA 3B9IA 3Q8EA 2L8KA 4UR9A 3VDCA 4AFMA 1ZKEA 4AFBA 4IV3B 1QDCA 2IFWA 2KM2A 2E6RA 5L3BB 5ABJA 4PJNA 2ECVA 1UCUA 4RQPA 4ZS2A 5H6QB 1KITA 1B35C 1MS0A 3Q8FA 1AR61 1QOSA 2ZHMA 4DUWA 3IMNA 3ETUA 1SFPA 3J7MA 3I97A 5A70A 4FOWA 5GLUA 1PMHX 1OXCA 2PN5A 5FL0A 1BCXA 5FMDA 1DP0A 5LEKA 4WVMA 2ZM2A 1MM3A 1MZ5A 1AJOA 3LCPA 3MDPA 4L0PA 5BXXA 1AYN2 1T72A 2JMDA 4CCNA 4L99A 2WMNA 4YGDA 4NR1A 1NY72 2W46A 2OVUA 3RPQA 2VXRA 1J3PA 3L39A 5KHGA 5FYYA 3BIEA 3TRSB 4YSYA 5GM0A 1QF3A 4OYJA 4XCBA 2EODA 4PI2A 1HN0A 4NHKA 4Q27A 5LATA 4O4JE 2G0UA 2MUMA 3LFMA 1JS9A 3KDSE 3OF1A 4KBMB 4K8RB 2IC1A 2XH6A 4GMP1 2NR4A 4PK4A 1LCLA 2LROA 2HJIA 5H9QA 1VLNA 2Y64A 4M3CF 5SVIA 4IEZA 3T30A 3O1TA 1REFA 3S4UA 1JYTA 4AIUA 5JVVA 4E9KA 3ZSJA 4YTNA 2UY9A 3KCYA 4WVZA 4L5GA 4HWIB 3NQHA 4BA9A 3ZMOA 3LEKA 4WM8A 3HMYA 4QQ4A 5ADXL 1GP6A 4JDOA 4BQ2A 4JI0T 5LYJE 1Y01A 1C28A 5HXCA 2WN3A 2QQVA 3C4WA 4EV6A 4OHFA 4Q4X2 3AECA 4AVVA 3W20A 3JD72 1UURA 4R7EA 2OZJA 4YBTA 1VIWB 5CZKA 3DN7A 1OH3A 2WAOA 2E6VA 4O2AE 3MICA 5J1GA 1QWRA 4FVVA 4ADZA 1SLBA 3GJBA 3CKHA 3WZ1A 3Q8CA 3C7HA 3V65A 4BMEA 1X9PA 1JM7A 3ZMZB 2FHRA 2L75A 4LO4B 3EQEA 5FMCA 1LHNA 2V1DB 5EYYA 3J7NA 4XPVA 4JGZC 3NV1A 3MZKB 4ILBA 1SFYA 5K3QA 2B0OE 5FWJA 3I2IA 2Q9QA 1RJ7A 1S0CA 5LCWB 3UT0A 3AAIA 1KS5A 4D7SA 4M1PA 3MJXA 2YFZA 5JR7B 5FB0A 5FPXA 4ZZ5A 2SPCA 4OI4A 3V5SA 3E6BA 4JV4A 2CBIA 3PLQA 4H2AA 4PW8A 4BE3A 3AP4A 3RTRB 2P9BA 3U5MA 3T2QA 1ZRCA 1UNBA 3HR0A 1VBA1 4JQTA 1NA1A 5IVBA 5AQUB 5HV4A 2AC1A 2XQRA 3O4XE 3E6CC 1GOGA 1BORA 4JDNA 4LUMA 4B29A 5DAVA 2R0FA 4EJRA 2R1BA 3EDUA 4AI0A 2A6VA 2J1DG 4JCKA 2LLYA 2VMDA 2ECTA 3CJXA 2OPKA 3VBUC 4MALA 2VBBA 2BKOA 3U75A 4QD2A 1SLAA 2DFCA 5J98B 5F37A 2CXFA 4C1XA 5L36A 2RPAA 4PT6A 3E22E 1POV0 1AJKA 5CBLA 1RUF2 1VMFA 4LF4T 3PUAA 4DRVA 2YC2A 3CX6B 3AYAA 4A7KA 2IAKA 1AXKA 3LE0A 3TB0A 4EV0A 2V4VA 3NKZA 5FEYA 4P00B 4BQ5A 1I5ZA 5C71A 3PUHA 2W67A 2VZQA 4CDQC 4CDXA 3THPA 3JBG2 1KDMA 4HK9A 4IGPA 2WZPP 3K77A 5EZWA 4COFA 3AB3B 1W28A 3M70A 3AKTA 2R061 5FLHA 3TAYA 2MIQA 5EK2A 3O0XA 3B7MA 1EY2A 2OPWA 1XRUA 3UU8A 3K1SA 3VZMA 4CP9A 1PO22 3AYDA 5F6KA 4E7SA 2Q9QC 4CCEA 4V1Av 2KWIB 3AEEA 1E5SA 1OMIA 3VUOA 2ET1A 3WNMA 5FPVA 3LSDA 4QF3A 3OUJA 4LOTA 1HRV2 1WLDA 1PK6A 5C5TA 2VU9A 3KHCA 3AKRA 3N2OA 3VHNA 2VZSA 4TSVA 2C4XA 1OQEA 3UULA 2CRWA 2ERFA 1ACCA 3SHBA 3WY6A 4FTBA 2YPJA 4QF2A 4JEUB 1R091 2A6ZA 2ZX3A 1F9KA 2WQ8A 2L0BA 3FBMA 4K0UA 4ZS3A 2RM22 3VD9A 4YFSA 3K3NA 1IS6A 5GONE 3CIHA 4TNWA 1FP0A 1S1AA 5H9PA 3SH3A 2WWVA 4XFIA 3MLJA 1NCRB 2CT2A 2LTNA 1C5HA 2ZX1A 3AA1B 4U31A 1Q43A 2ES3A 4GYRA 4HN9A 3HJRA 4BYYA 3E08A 2UWCA 3SH4A 5CJ5A 2WNUA 2Q30A 4ET7A 3ZYPA 2JB4A 4AGVA 3VL8A 4XJAA 2OQ7A 2WM9A 3ZMNA 1WGMA 2A70A 4NN0A 3P50A 1UIJA 3MACA 3JAEA 2CONA 5BNPB 4ZI7E 2W39A 4QGMA 2WY2A 4HWHA 2IXJA 2M6IA 3RFRA 3WF1A 3ZOIA 2VZ3A 2OWAA 5E89A 1RUG2 4D69A 4S3OB 4CDXC 2JMKA 4XFGA 5TBNA 4IEUA 1TE1B 2PFVA 3OKQA 2CKLA 3O35A 1F5JA 4HKAA 1KNPA 4QX2A 2AZ5A 1ASJ1 4OHWA 3DPRA 3NNJA 2JXAA 2JM3A 2A7AA 4EEDA 2D3PA 4DBQA 2RG4A 1HTJF 3NZPA 3ZJ1A 2Y0IA 1H6XA 5EQUA 5FXVA 3ZC0A 2W87A 4XQWA 4YW6A 4CZZB 4QHBA 4LBMA 5DQ0A 1BEV1 3VD5A 3UUNA 4Z82A 2MA6A 1Q56A 4IL7A 2QNKA 5F39A 3GN5A 2BJSA 3POSA 3R4SA 3L2YA 4BJNA 1DVPA 1OF3A 4AFAA 5IK7A 1JXNA 3RSJA 1FPN2 1NKGA 2FD4A 4RGKA 1YQ3A 3NBXX 2XJVA 3E1F1 3HPNA 2H7OA 3ZXLA 5C70A 1C8M1 4MO3M 2LRKA 2GU9A 1ENRA 2D5FA 1EAH2 5CA0E 2NZ9A 2Y6JA 2O0OA 3FBZA 1DQ1A 1F5FA 4RS5A 5FYSA 4W6XA 4Q0VA 5DDJ3 3VHLA 1BZWA 1G9AA 1WGPA 3RIUC 3AX4A 2BYVE 3RZHA 1GNZA 3LQCA 4E4SA 5FJKA 1SCRA 1CIWA 2HPLA 3GBWA 4I2OA 2LJLA 4ZHQE 1N3PA 2YQMA 3VZJA 3KNVA 4EROA 1VBC3 2F6JA 5IUXA 5D1IA 3I9YA 4CN6A 3MDBC 3RQ0A 3ZYBA 2VZTA 2RI7A 1FMD2 1W3XA 5JOYA 2C5KT 2JX9A 1S0BA 2BOJA 4KMQA 2JUNA 4YADA 5J7MA 5LBEA 4UV8B 1O7FA 4GQ7A 5CU1A 3ZT5A 2FDIA 2BFUL 3ZSTA 5GALA 3HNYM 3UTKA 1SBDA 4YY3T 3CLPA 3AE8A 3R4UA 1VBD3 1B35B 2BDRA 3TN91 4RR3A 5G04L 2RJ2A 3O1SA 2WT2A 3HN1A 2RMU2 3T1MA 1F31A 4UBHA 2WKKA 2XAFB 2CRBA 3BOPA 1W6OB 4KWJA 1RUD2 2ZTNA 3QC9A 2JDMA 3DPRC 3LDQB 5AFUL 1YKHB 4ARYA 5CADA 4O9GA 2WIIB 2WBKA 2YKSA 5JOXA 1P8JA 5JXJA 1URXA 1XNAA 1E5IA 4J25A 1DZRA 4BH9A 3RF1A 4MV2A 1SFNA 5L73A 2YSJA 2WDRA 1Y3TA 2Z5WA 4AEDA 1HJFA 2WDBA 2DDUA 4QXCB 3BI3A 4WZ0A 1AF9A 1LRHA 4BQXA 4IV1A 3CF6E 2BGCA 4CP2A 4XJ8A 4M3CE 5EXOA 3LJCA 2VL4A 4FXKB 4BXFA 5JG6A 2XB1A 2BBAA 2Y6GA 1GSLA 3POEA 1PNFA 4RFT0 4HVRA 1CAWA 1JUHA 4UWDA 4MGTA 3HN3A 3I2JA 2W61A 4OYUA 1CAVB 1C4RA 4DR7T 1YFXA 4QQPA 1ULEA 3H7HA 2P6HA 2X9WA 2WSSV 3BKZA 2IC9A 2VUDA 1VR3A 4XDQA 3T2OA 5ABEA 4C9ZA 2E5LT 5D8AA 2ORXA 5FZBA 2Y8DA 3GYDA 4XDOA 3RZZA 2J1EA 3RI9A 2FFWA 2OXQC 3FZFB 1HQLA 3P6BA 5DG1A 3SCHA 1UYYA 3U4XA 1PVC1 4GWNA 1VOMA 2PHTA 4JRAA 4O64A 4WA6A 2V6YB 4N53C 5FYZA 4HXCA 1YFYA 4DINB 4XILA 4DV2T 4A3XA 2X68A 2VKOA 2GSYA 3P3NA 2D0UA 4MGIE 2VZUA 4UOJA 5K0UA 2VPVA 3LQHA 4JGZB 4O4IE 1JZ7A 2FSAA 4RR3C 4FPJA 1ULGA 3I3DA 2EHOC 4HOOA 3SKJE 3MW3A 2SLIA 3S0MA 5BPXA 1C1FA 4ZUXU 2IIUA 3ZSSA 1R082 1UMIA 3O1PA 3DKWA 1L0VA 1ND2C 4RL7A 1PGW1 5HCMA 4PLOA 2CL2A 4K20A 3WNLA 2B1EA 1O4YA 4MZUA 1D4M1 3ONJA 5CAZA 2OW4A 5JDNA 2V7LA 4W65A 1GLHA 1X7NA 4LF9T 4AKGA 3JCFA 3SFDA 4P5OB 5JMOA 2Q1ZB 1OI6A 5BNOA 1XOYA 4U3CA 4U74A 3ALQA 5DAXA 5C9AB 1RHI2 4EIWA 1X9TA 3OJAA 4X65T 2XLFA 3N4MA 1AR82 4XJUA 3WV6A 2F4LA 3VBUB 4Z90A 4AKIA 5EZYE 2YU4A 1ZRRA 2L9QA 4Y26A 5LRRA 3P4SA 3AMHA 4LLOA 4D6RA 4E4DX 1PVXA 3U3IA 3L3PA 1W8OA 1VRBA 1OEDA 1K5JA 2OKXA 2E9XC 2ZBJA 4IQPA 3OY8A 3RI5A 3FHIB 1V6OA 3OD4A 4HSJA 3FX3A 2YDSA 4EN7B 4G9SB 1RUE3 5D8AC 1CVNA 2YYRA 1W99A 2UXBT 3PL0A 2D6OX 3AZVA 1HRI2 5DUVA 1D1BA 3LA7A 4CDQB 1WEEA 1NXD1 3DUIA 2BS2A 1O3SA 3LQIA 1MMDA 5FYHA 4OUMA 2ZCWA 1ZEEA 4I0UA 1HV1A 4IL4A 3TLUA 1OFSA 3O1IA 5LBCA 3MF9A 4META 2ZEXA 1OQDA 3OTFA 4I4TE 5ACA3 5H1VA 1OD3A 2BBJA 4GH4A 2Q9QB 3P7IA 4U2YA 3EABA 5BR8T 4NN2A 5FIXA 1LU2A 3PJYA 2WB5A 1DGRN 2Y6LA 1V9DA 2ZHKA 2W62A 5B8DA 5FY0A 4R9DA 3L9JT 1G9BA 1ZHCA 4P9XA 1ZX5A 2WS91 3LWCA 4ARXA 2BW8A 2FUIA 1W2NA 2B5HA 3Q5WA 2RVAA 2X0LB 3RZJA 1LU1A 3LA3A 1O3XA 1GOHA 4ASLA 4BMBA 5BNOC 2HWB2 2XJUA 3ETVA 2V5CA 5L7OB 4OULA 3MBWA 4IGQA 4YM2A 4OQ9A 4C8DA 1SMVA 1OWAA 1SCSA 3GM8A 2D8SA 3N9OA 2PQSA 4S2GA 2EXUA 1AYN1 2B7YA 1EPZA 4ATEA 3CQGB 2ZX2A 3H50A 2IMLA 2X53S 1NY71 4YW1A 2W0GA 3I2DA 2P3KA 1IYMA 5LKUA 3WDUA 2VAUA 4NAMA 4QB2A 3L1XA 2L80A 3RYKA 3JUEA 2LSKA 4LBQD 3T2PA 3KVBA 4Q4W2 3CX7B 1AJ3A 4BJ0A 5FPUA 5JR2A 4NXNT 1JZ5A 1RUI3 3ACLA 1FJGT 5F3EA 3N7LA 4NVPA 4COUA 1LOAA 2AR6A 5HXVA 1TMF3 4QU1A 2KWHA 4CDXB 4EN0A 5GLWA 5J3XA 1F35A 2JPFA 4UV9B 3FC0A 4H9PC 1AX1A 2Y6FA 2UUBT 3LJUX 1W8UA 3URFA 3K4DA 4CP9B 2QFEA 5FYCA 3T6RA 1SLLA 2BVMA 2YK0A 1WD4A 2VPDA 5AQVB 1NEKA 3IPVA 3D6EA 1UX4A 1ZBE1 4H9RC 3WOGA 4HFCA 2WA3A 4Q4X1 3LPGA 3QACA 3JD71 2QCSB 4FOQA 1D4VB 4CA9A 5JDHA 1W6QA 4XW3A 2MNYA 4Q0UA 3M2MA 3QB5A 3RNSA 4A4CA 3IEEA 1BK0A 5L9RA 4AI9A 2XQ8A 5FP9A 1RJ8A 2UURA 3LQJA 2MEV3 2Q5TA 4EWEA 1G9DA 4XJ9A 3KT1A 4WVVA 4R9CA 4MH0E 4LBOA 1PO13 4DB5A 2X29A 5LA0A 2QKDA 2H6CA 2VOWA 4EEBA 5FZDA 1PHMA 4XYXA 4GD4A 4AI8A 4P5YA 2AE9A 1AL22 2ZGMA 2LSYA 5FMBA 2CGOA 2LQ6A 5FQ0A 1FI2A 5F3JA 2K9AA 5C3JA 4C1WA 3GZEA 1T6BX 5CB7A 1W6NA 3W21A 3M7KA 1FT9A 3WG4A 4K8FA 4ILCA 2UWBA 2I0MA 4AGRA 3AJYA 5CGMA 3U11A 3EJKA 2RR13 2VB6A 2IVIB 1F62A 4DEQA 3IDAA 3UGHA 1XSRA 2VOTA 4CA1A 1OC1A 2QQMA 3I1AA 4LE4A 3AA0B 1UD1A 4DPNA 5DINA 2L9LA 3KQ4B 4YG6A 2HN2A 2G45A 3MZHA 4QXBA 4QH5A 1HW5A 3DPRB 2PLV2 1RUF1 1OPOA 2VURA 1WR6A 5AQFB 1WYBA 2I74A 4QHOA 1QJX2 1VBE2 4FPYA 3CJIA 4CI2B 2JG8C 5L9BA 1QGLA 2K48A 5AIUA 5C8CA 2PXJA 3C51A 2HLEA 4LNVA 5GZFA 3WHUA 2MHFA 3VHRA 5CA6A 2YW8A 1GNHA 3FHNA 5DZFA 2AACA 1ENQA 3B13A 1GMMA 2WQZC 2W4XA 2BS3A 3RLFF 3ES1A 1XWMA 4HWDA 4PFPA 4CUGA 1HQWA 5LBQB 1TEIA 1N32T 4ZXLA 2KNDA 3PUVF 2YXSA 4P9GA 1PO21 5KX5E 5EJ3A 1J58A 3WG1A 2ZX0A 1Q8OA 1LAJA 3J8F1 2HPJA 3BQLA 4IGUA 3FBLA 4CQIA 2C1FA 5E1RA 2XQXA 2R7EB 2Q8DA 5A33A 3LEIA 5SVXA 3BPZA 3D0SA 3VB9A 5L3EB 3LKJA 1BVVA 5IVJA 1AR71 4I02A 3H8UA 3AVRA 4YJ2E 3H37A 1XNTA 4Z0RA 2LT3A 1POV1 3LZZA 5LZ6A 4X66T 2PHXA 4LBLA 4E27A 2BNOA 5JSRA 2DCKA 2JMIA 5HWYA 3PMEA 1GZWB 4GB33 1QUUA 3WP5A 5HCHA 1U12A 2HWE2 4XUNA 5FREA 4N53B 4HVOA 2WNEA 1BR0A 3EMRA 4LPLA 3H8XA 4NRPA 4Z2WA 1RMU1 3Q5EA 3NNGA 4M01A 2Y60A 4DV4T 5BY5A 1UZWA 2VMIA 4KU7A 4A49A 4RR3B 2KWJA 4A4BA 2EHOB 5LY1A 4YLZA 3C2UA 4M4PA 1JYVA 3FWEA 5L3CB 1RUH1 2ECWA 4G63A 3NW4A 1X8EA 3R6NA 4NHXA 1ND2B 4XF4A 1TZOA 4GJYA 2CWMA 1C57A 3TYJA 4Q0PA 3RYFE 3MIFA 5F5WA 1UX7A 4X62T 2YINA 2XXZA 2QDNA 5F8PA 3L09A 4WYVA 4JVAA 2FCUA 3IBPA 1VBB2 3ZMVB 1TNRA 3GJAA 1QH6A 1UOJA 1YYNA 5LOVE 3VBHC 4CZSA 2HYED 2WZR2 1LNSA 1YQ4A 3M4FA 4LFBT 1L7QA 3RVHA 3UESA 3PJAJ 4PDWA 3TLTA 1W8FA 2JDZA 1NUKA 2P57A 1AX0A 2VUAA 2XVKA 3HOBA 3ZM8A 5AFEA 1ZBDB 2C0SA 4CEWC 3MUZ1 4Z91A 1PIV2 2GH8A 4XFAA 1IOAA 5LG4A 5FYMA 3VZNA 3NJVA 4LA2A 1GQPA 4UI9B 5A3TA 1XNCA 2E9XB 2W0XA 3V0BA 2Y0OA 3OBZA 1XWHA 3ZT7A 1JBCA 1Q5OA 5DQWA 1W2TA 4R4ZA 4PI0A 5FVKA 2R041 4XF0A 4I43B 1FPN1 5D8AB 1U0AA 5FPLA 4PJJA 5M0TA 1LKNA 5CNAA 5T50A 4FPCA 2J1RA 4J1XA 2W52A 3ZFEC 5FY8A 3H1WA 1D2QA 2KREA 2L7PA 2DCFA 4XC9A 3HQUA 4P14A 3LDBA 4MSVA 2ZGKA 4DIDB 1MMGA 1PNGA 4ZHNA 1G73A 2CGPA 2ZZQA 2CGNA 2NMNA 4XQ4A 4XVHA 1H2LA 5C8YE 3VBRA 2OS2A 3PUIA 3SOUA 5HXRA 1PGL1 2KR4A 3RYCE 1LOBA 3MPPG 4IDZA 4DIQA 3VDDC 2V72A 1CX4A 5KHKA 3OPZA 3WG3A 2QUOA 4RSUA 3CWZB 1SHWB 2HWD2 1JMUB 2XDVA 1FMD1 5JPNB 2EALA 1QLBA 4ASMB 3RIFA 4XDPA 2LAUA 4UFJA 4NUUA 5JZGA 4A44A 4O8SA 4ISSA 2GMMA 2UYBA 1H8TA 5AC93 1W0NA 4LJHA 4W6WA 2CSZA 4DO0A 5A7WA 1L3JA 1MZEA 2L43A 2BS4A 3VBSC 2EIEA 3ST7A 4IESA 3LK2B 1QQP3 2QQKA 4KGGA 2EXHA 3W59A 3EHKA 1RUD1 2BP6A 3QNUA 1LHWA 2VZ1A 5CFBA 3IZOA 1Z7S2 4ZU4A 3ZYHA 3ZPYA 3VZOA 5DJQC 1MEC3 1B7TA 2KWKA 3P1IA 4LORA 4EZHA 1DHKB 2WU2A 1WILA 3KQRA 3ZO0B 1K3IA 1FOD2 4QX7A 4P9LA 5LEJA 2UYAA 4R9BA 1FXZA 1J3QA 3KS7A 3Q2MA 1EV13 3P4QA 1XPWA 2CWSA 3WAKA 1WEPA 3UU4A 1HB3A 1W6MB 4N43A 4N8MA 5FVLA 3R84B 2RS11 2QJVA 2E26A 1X9BA 1VRH3 2QE3A 3VZLA 1VCTA 3P5BA 2EF6A 3AVSA 1H6YA 1RVF3 2E9QA 4UVBB 2Z4FA 1AR62 1O91A 2VVEA 2ACZA 3RPUA 2XPKA 4TZ4C 3RH3A 1MS3A 3I3BA 2K46A 3VBRC 5FKYA 1LHUA 3ILFA 2CRRA 2RS31 1J5WA 3FANA 4B3ST 2VQUA 5LBBA 3O12A 2ZM8A 1JTZX 1WEVA 4FT8A 5JZGC 2ZABA 3BTZA 1QHDA 3EB5A 4M3CB 4CP1A 3ESLA 3R4DB 3CNAA 1H8TC 1Z0HA 1X8MA 4QQHA 3MIDA 2RP4A 4B4QA 3BU0A 4EOZB 2A71A 3SS1A 1SPPB 4TN7B 1JU3A 3GZTB 1HS7A 2PHUA 3HA4A 5GJ6A 2D3RA 3M3IA 1KK7A 4DNDA 2LSGA 5FP3A 4P5HA 1R081 3LSEA 1ZA7A 5I0RA 1FAYA 2HEWF 1QJEA 1S2KA 5EJZB 3B02A 4DV1T 1NAEA 2CHOA 4QQLA 3WSOA 3VKHA 2VNFA 4BA6A 5KH9A 1XU1A 3AXJA 2CAVA 2N2NA 2WU5A 4JI1T 3KT4A 3LGRA 5A7SA 4QX1A 2K0GA 3WQ0A 1BQPA 3D8CA 4PNIA 5CB4E 2RS51 4JEHB 3U78A 4YAXA 1I6ZA 2FJAA 1HXS2 4AI3A 3TOJA 4BZ4A 5JIAA 2V7IA 4LKDA 5LBFA 5T5PA 5LK7B 5J37A 5GKAC 1CR7A 4LHKA 2O1QA 2O14A 3AMPA 3IB3A 2XAQB 1H4GA 2J4GA 1UN1A 4F7ZA 4FI9A 2V7JA 4UFIA 3ZYGA 1WEMA 4FFIA 4LKAA 2UXDT 3ASLA 5A7OA 4Y5TA 1U6GB 1UY2A 4RGAA 3C3VA 4LMJA 2DWKA 3EVYA 3GV4A 2Y6XA 2HH9A 3PDQA 1E57A 2FDKA 2CWYA 1YO8A 2B9UA 4XAEA 2DBIA 3ZPVE 3B3QE 5TABA 3PHDA 5AFBA 1ZREA 4JKKA 5JAXA 2JG8B 4JI6T 3NV3A 2B8MA 1JZ6A 1UW8A 4TWHA 4YBMA 2E7TA 4GYSA 2Q1MA 1JZ3A 3M3OA 2E7AA 1JOBA 1VP6A 3LEGA 2XB6C 3OUHA 3OCPA 3AXEA 3WT3A 1BJQA 3K75B 1W6QB 2E6SA 2JICA 3QUJA 5B4XA 1V9U3 2CV6A 1VBA2 2GC1A 4H63V 3N7KA 3FLPA 3NV4A 4MADA 3LEMA 4TTGA 4PTBA 1CQ9A 5FXWA 1NZIA 4IC3A 1IJ5A 1HDKA 2PTMA 3OGJA 4A7YA 4O9EA 4FAHA 2Y6HA 1UY3A 5J09A 2VNGA 4JI3T 3NMBA 2IFRA 2WUHA 2ZGNA 1NQJA 2ZKLA 2WP9A 1A3KA 4ZI3D 4QPGA 3HEIA 5EFUA 3B9CA 1R1A1 1SG3A 2YV8A 3DL3A 3POWA 1E7PA 2X09A 5LKXA 4D94A 4COVA 1IQAA 3WNXA 1S35A 2A3DA 5J36A 2IUBA 4XAAA 1KFYA 2J1UA 1MQTC 4GNDA 1IPJA 3O47A 4X3GA 2ZAAA 5FZ1A 3H1MA 5A3WA 2WCAA 4NAOA 5LKZA 4KG0A 3SWHA 3VHOA 2WNVC 3HL6A 2YT5A 1AR93 3UETA 1OURA 5DUUA 5KH7A 5JDGA 3A4UA 3WUDA 1WW6A 4XXAA 1Z8UA 3SHRA 4QX5A 3DEMA 4KX6A 3J7LA 3W5NA 2WN2A 4PCRA 4YZ2A 4EGWA 1LDKC 3KGLA 4NOTA 1E5RA 2W92A 5GZGA 5DDJ2 2MD8C 3EI0A 5L19A 2LGLA 4AP4A 2QGSA 4CVUA 3MIEA 4HLTA 2L3LA 1YJLA 2XUEA 5FMOL 3S7EA 3WP3A 1M62A 1DGWX 1AYM3 1UY4A 3NO8A 2JWPA 2JECA 1DZTA 4AQFA 3LD8A 5LB7B 2M6MA 4V3KC 2ZHNA 4IEOA 3O70A 3LRQA 5FPAA 1R092 5T5LA 4OZXA 5IHRA 2DCZA 4QPWA 5AQPB 1WESA 1WCRA 3VBHB 5I0DA 4UP0A 2HWF3 4JI4T 3AAAB 2R16A 1VALA 4HVQA 4Q4Y3 5D1KB 3JC6C 3AYCA 1RITA 3AKSA 3EDVA 1RUJ3 2BVVA 2X0HA 2BV4A 2VNVA 2JE9A 3N2KE 4GB0A 4DOUA 4QPGC 4CEWB 1D0YA 2C9KA 5FZKA 2XQAA 4XBNA 2VK9A 5A33B 3NVCA 2XP0A 3KF5A 1NE4A 3ZFFA 1CESA 3I0QA 5HXHA 1QJY1 2GMEA 2V4AA 2CCQA 1NX9A 3O9XA 1W8ZA 5G0FA 5FPZA 1ND3A 1JODA 1XDPA 3APBA 1OA3A 2H0DA 2VZVA 4P0AA 3ZFEB 2WFF3 2DVBA 3HWJA 5LJMA 4NE9A 3GGLA 4GWMA 4HPKB 2D2SA 4Y20A 2DV9A 2XL7A 4Q8LA 1EYBA 4I09A 2DU1A 3OPTA 1AL21 1ASJ2 2GMPA 2WZ8A 3P4PA 3MFCA 1MIVA 1MR5A 1WFKA 1RYYA 3VDDB 3SQOA 3HNBM 4IE6A 2W2IA 4C91A 2XZEA 4HEAA 2BZBA 3WF3A 2DCYA 1ODMA 4DNYA 2C2LA 2UU9T 1BEV2 1HX6A 2UU8A 1K5MB 1XC6A 2GAUA 2PAMA 1UAIA 1LGCA 1F4AA 4AQFC 2D5UA 1W90A 3G6JB 2IXKA 2P3YA 3O1JA 3MF6A 4JDMA 3UNPA 2JDUA 4F6RC 5CKMA 4AWDA 4QWNB 2NWBA 3VBSB 1JN2P 4X1IE 1CHCA 3FE5A 4JLEA 4WBBA 1C8M2 1NCQC 1DLLA 5LNKA 4Y22B 4L11A 2YUCA 1LEDA 2CLYC 4QM9A 1OHFA 5CA1E 3IDBB 3SNMA 1U5IA 2ZJCA 5CVRA 3RG0A 2WS93 2JRKA 1XMOT 2ZXQA 4BISA 1QJU3 4RHV1 4H55A 2XQ6A 1CX1A 3IMMA 1CHUA 1Q8VA 5EYAF 4BM8A 1XMQT 2HEVF 5IVEA 2JENA 4PF5A 2YQLA 1GICA 4AE2A 2F4PA 2DVDA 4DUYT 5FL1A 1REEA 3JZVA 1T1HA 2NW9A 3USUB 1S0DA 3ZFFC 1RUNA 1DYPA 1GWMA 5DAQA 1HX1B 3GALA 3A0KA 3GNEA 3MGUA 3CX8B 5KBFA 2XJTA 4Q5OA 4CU9A 2ADDA 4Q1RA 3MHSA 1RMDA 4QM8A 3PIGA 2G9ZA 2DF7A 1JYIA 5LHGB 4OK0A 3MHHA 4BJMA 1GZCA 2PAKA 4CUAA 1K42A 2C26A 3ZXJA 2WL1A 4XIOA 5FZ3A 1W9TA 3RHWA 3FM8C 4Y5SA 3THTA 2FZ1A 3LVQE 1H2MA 5DAWA 1XE0A 1OVSA 4TUYE 2EA7A 4R8HA 3VBRB 1GANA 1EPWA 1W2AX 4I7CA 2Y1MA 2P4EA 2RDQA 2FJEA 2VMHA 1GKBA 3TLSA 3AE5A 3C64A 4HBNA 4CPBD 3V64A 4UAPA 5DZEA 5JREA 5T54A 3WUCA 3GZAA 2HBTA 2P37A 2C24A 3M62A 3MYXA 5JZGB 4QX3A 4MGYE 2W68A 4A41A 2OUHA 4GJZA 2YOEA 2I07B 2D98A 3AEBA 4LF7T 3MPBA 4YW2A 3SKVA 1RUE2 3IWZA 4XFFA 5A7WB 3S6PA 4DR1T 1Q8PA 3ZTGA 4Q4V1 3N9LA 4Q0SA 4L2NA 2VULA 2WFPA 5JXGA 3VKNA 4TX5A 1W9YA 4BQ4A 1IS5A 3JD73 4Y3OA 3QBQA 3AMNA 1CGPA 5LA1A 4ZY9A 2WO2A 1XNKA 2C2VS 4J6GA 3RI8A 4AVCA 2JQKA 1S0EA 2BZDA 5AQGB 3ZXDA 2KSRA 1X33A 1NOVA 4HFDA 3DV8A 4YW3A 1W6PB 1XE8A 3MLLA 4D3WA 3WHTA 2DI4A 1NQDA 2B46X 3RDIA 2YBKA 1NG0A 1QH7A 3AEGA 3S5AA 4TWDA 1VBB1 2B45X 3WNPA 4URAA 2VCAA 3NNLA 5C4WA 3WP4A 2A73B 1W0BA 3HCTA 3PJAA 2WZR1 4ZI2C 4PIXA 1PVC2 2VMFA 5J2TE 2DFBA 2YDRA 1UZVA 2VCCA 5GLVA 4KBZA 2CXLA 2J47A 4R9AA 2UXCT 1W9FA 4A45A 4DV3T 2H0VA 3AXDA 2GC3A 1MS4A 4K21A 2VVNA 3UGGA 4KI5M 1F2NA 2ZGTA 2W00A 4I01A 2X8KA 1ZRIA 2A3XA 4HL0A 4YFWA 4CRQA 4QPIA 1QIQA 1G25A 1AXZA 3TLWA 4JGYA 2VG9A 2X05A 4ZOLE 1UZYA 3WDTA 3ETQA 1HV0A 4EN9B 2FD8A 4LULA 3KF3A 4MXWB 1DYKA 2UUCT 3A21A 2ARAA 2PMWB 3NWIA 1COV3 2XOYA 5LY2A 2K5BB 2ZGRA 1O6UA 1OH4A 5DABA 3T4VA 3DDTA 3AMQA 2YFUA 1G8XA 1D4M2 2IVJA 3OBVE 3SXWA 3LG7A 3K2OA 4XBLA 3M3QA 2W2UA 2XJPA 1W0AA 5LJNA 1Y9QA 2IW5B 1IZ3A 2DCTA 2CHNA 3PNAA 2K17A 4HKLA 3RMXA 4P08A 3ZVYA 1ZZ7A 2XASB 3GL6A 2X51A 4HFHA 1TMF2 3V56A 4CPBA 2WZIA 1W0OA 2MOZA 2NLRA 5A32B 3LBXA 2R073 4Y4RA 2UXNB 4C0HA 4CEYA 4U33A 3P4RA 1M06G 2W9XA 1SA0E 2QYWA 3T1HT 2PNXA 3VD4A 2HWD1 3JBG3 2KFTA 3LDRA 3T8OA 3DYOA 4YHHT 2OV9A 4AI6A 3LOBA 2M13A 5FZGA 5BYNA 2XJSA 5A6QA 1WUVA 4O4HE 1FMWA 2VCBA 2BWAA 1MQTB 5AQQB 2BVLA 5C6CA 4XBFB 3BYWA 4AQGA 2RJKA 3PMSA 4L97A 4XXPA 5C4WC 2WNVB 2R6QA 2LOSA 3ACGA 1XJAA 3FXDB 2JE8A 1HRV3 4GKKT 4DUZT 2W66A 2BERA 5LGTB 5LMUT 3E2DA 2X5IC 1CUNA 5FERA 5FLJA 4Z0OA 2F42A 1W3VA 3OYXA 3FFQA 2LEHA 1QOTA 1VAKA 3QH7A 3VD7A 4FCAA 2RM23 2EXJA 4JQRA 3GF6A 3PIJA 4QPIC 3OSDA 4NWVA 3ZEFB 2XAHB 2LALA 3N7JA 3U5NA 4JGYC 1N47A 1NWMX 1ULOA 3MFAA 2LHRA 4PJYA 4QH4A 3DXUA 3T0DA 4ILUA 3A5XA 1CAUB 4K3UA 4HFVA 1YW0A 4YJ3E 4LITA 3I2HA 3N9PA 2I45A 1LGBA 2YEVC 1V6NA 2M67A 4WM7C 3MEPA 3AK0A 1Z78A 2FUPA 1CAXA 4YTMA 2VJFB 4B4PA 4DR6T 2XJQA 1QNWA 2ZLYA 1X50A 1RXFA 4C0BA 1CZVA 4CDUA 4LJNA 3ZR6A 2DX8A 4JI7T 4X6QB 1US2A 1ODNA 3ZDVA 2MD7B 4V3LC 3ILRA 2JG9B 1GQEA 4B1MA 5K7PA 2CXDA 2IDOB 1QXPA 2FCVA 2XOZA 4PLNA 4O62A 1RUG3 4E4ZA 4QPGB 1R64A 3DP7A 4H7LA 1JZ8A 2XBO3 4L0RA 1GZ9A 2YBPA 3THDA 4P9JA 3LIHA 2XGXA 1CJPA 2W63A 4DV7T 2B39A 3O1RA 3ZMSB 1YI7A 5LHIB 1G6NA 5L2LA 3VKLA 1DG6A 2IQJA 2B76A 2FQPA 1ULCA 1LEMA 3P3PA 4Y1VA 3I0OA 3T2TA 1QKQA 2QA7A 5CISA 4SBVA 1LOFA 3VBFA 4NPLA 3PE0A 2YG0A 3CVRA 4XJWA 1JHJA 2VPGA 5A1AA 3PURA 3FJUB 2ATFA 1FPN3 2J1AA 2XUMA 5A6XA 2MPKA 2VPBA 1BVP1 2KXPB 2KGGA 3AFGA 4B4RA 3KT7A 1KGYA 2H3RA 1EAH3 1IHMA 4BXSV 1A8DA 3M3EA 2CNAA 1SBFA 1ZBE2 5IVYA 1ULDA 1YEWA 3Q1DA 5FV3A 5BNNC 4BK5A 3ZFGA 4HONA 3J9SA 4CP0A 1HXS1 2BG9A 1UY1A 1J84A 2ARXA 2W91A 3KBTA 4L8QA 2ECJA 4Z92B 1W04A 2V8SV 1HJGA 4XF3A 4OQ8A 4NIDA 3AE6A 3WW1A 4UBGA 1F15A 5ABJC 1X82A 1NCQB 2VGDA 4RQPC 4Z8XA 2WR9A 3BTYA 2CLYB 1IBKT 4U2AA 2FUUA 4AQYT 1NLSA 5DAPA 5SVYA 3H9AA 1O5UA 3H3UA 2A75A 4XIKA 4A4AA 4OHYA 1XNBA 2WDVA 3ACHA 1E4UA 2DVFA 4AYUA 4LBJA 4I55E 4V2WA 4X6RB 4F83A 1L7RA 4FXGB 3W58A 4CI3B 2ZX4A 3KSCA 3ZSLA 2RV9A 1WZXA 2R1DA 2XQ9A 4XUTA 4HGAA 1GR3A 4YVSA 1Z0PA 2CE7A 4S2FA 2RMU3 3ZFFB 2E51A 2BQPA 3KZ4C 1UYPA 1RUD3 3A23A 3VBOA 3M65A 4BWOA 5AQOB 2BVBA 1G7YA 3ASIA 2X9YA 4DY5A 2WS3A 1IPSA 4JKMA 2ZEWA 1XXNA 4XUOA 1HNXT 3ZR5A 4S2DA 1DQ2A 1DYOA 4QDRA 2VZPA 3UQ7A 1HNWT 3R05A 2WLQA 4W4UA 2MT5A 2YUEA 2R32A 5C5UA 4XURA 1ZBA3 3ECQA 3UJOA 1S55A 2VJEB 1TME2 2WJSA 5A6YA 1JI6A 4AKLA 1H1IA 4UF0B 4XUQA 4WM8C 1H1MA 2DLRA 2LKHA 2XQ4A 4X8PA 3OB8A 1ZZCA 4U7YA 2GNTA 3AE1A 4YRDA 4YM3A 1DQ5A 4LE3A 5E88A 3WDVA 1GUIA 1ZA4A 2ODVA 1LGNA 3I4IA 1G86A 3FL7A 3ZFGC 4YATA 4YW5A 5CKNA 2BG9C 3ELNA 2QQIA 1JOJA 5LWBA 3AEDA 4IDPA 5FXZA 2JDHA 4URTA 4KHPT 1UYXA 2MKEA 1ZZ8A 1MNEA 1N1VA 1OVPA 5TRBA 3HKCE 4IEXA 1J5ET 2DUOA 3NL1A 4AKHA 3AP7A 1YUDA 4ITCA 4UXNB 2RR4A 4IEWA 3AYEA 5DDJ1 1A8MA 4LLFA 3FHAA 5FOJB 3ZC1A 3J8F2 2V5DA 5JOWA 4LO6B 2JDAA 2KYUA 5I0UA 2JQHA 1LULA 1VAMA 3U5PA 4IUGA 5G05L 2R6GF 1Y64B 4AZZA 3M3ZB 3V0AB 2DWGA 5IVFA 2AREA 2VVFA 3OGVA 4HFSA 3AP9A 3ZN0B 1IJ6A 3HBKA 3B57A 5JTGA 1VBC1 3FUOA 4E2GA 5IYYA 2PJQA 1AR72 1UUSA 4B6XA 4JHTA 3O0WA 1Z6UA 4OI2A 1NA1C 5A7PA 4DUXA 2BNNA 1R083 4TKPB 1MS8A 2AUYA 1QMJA 4TZDA 5AQSB 5IW0A 4M00A 4QB1A 1W2UA 3GBGA 4J1WA 2BAYA 3RRWA 1SQ4A 4OI0A 2VKDA 4X5TA 1RMU2 3AZZA 3SH5A 1LHOA 3ME2A 5DXDA 1VBD1 1Y9GA 3LOIA 4L9IA 4Q8KA 1YIPA 5FO7B 5F32A 3RZGA 4NRMA 3IHRA 2YPDA 5TDRA 5FUNA 5FP4A 4COZA 2AEYA 3H8RA 1RUH2 2D8UA 5FZOA 1RHI3 1AR83 4H9DA 3P8CD 2E32A 1S0FA 2WO1A 3S5QA 2WBLA 2ZHLA 3NWKA 4KUMB 3ZXKA 4H3WA 4XOGA 1C5IA 3CK6A 3J4UH 2CSGA 3E5XA 4JBWF 1OLMA 3LA2A 4MGQA 4B7YC 4XF9A 2HN1A 2I50A 3I49A 1DGWA 1BBT2 1CN1A 5HCJA 3I2KA 4AVAA 2W1QA 4L9BA 5FO8B 3O7AA 2XVLA 5LKTA 2VXJA 5ANQA 3ZN5A 2JDPA 4IE4A 4AGGA 2RE9A 3T3YA 3RQWA 1KDKA 3C8XA 1HRI3 4ES9A 5A3MA 1OKQA 4K9SA 2E31A 4I0AA 2YVRA 4CU7A 1PK6C 3Q5XA 2VQAA 3I59A 3CMLA 3AM2A 2E7QA 4CN4A 2R042 2EICA 4CCGX 5JUVA 3EB7A 4KBBA 3CL1A 4MUVA 1JHNA 2D9DA 3SOXA 4MHCA 5APAA 2PBIA 3OYWB 4MGSA 4QXHB 2XWJB 5B4NA 4H9NC 1WEOA 2IHR1 4YT0A 5JSPA 5LGNB 1QJZA 2X5IB 5FZ0A 4P1NA 4KGQA 1RGSA 2GH2A 1LENA 1BKZA 4DFSA 3I54A 5J1XA 4QGNA 2ZM6T 4IHJE 2DTYA 4E8DA 4DR3T 4MVTA 2GNMA 4TV9E 1GWKA 2JDYA 3ANWB 4QPIB 2QJ0A 2HBUA 3I2OA 4DV0T 3PUQA 2L5UA 3QZVA 1PGL2 4ZPIA 2WNUC 3LF7A 2HWB3 1AL0G 4QKNA 3KM5A 1BLZA 5M4YA 1J1LA 4SLIA 1N34T 1UCXA 4EN6B 2XLAA 3ACIA 4BB3A 5FZ7A 1XYOA 3G06A 2E53A 3UL2A 3F31A 4LADB 3KFWX 4EB6E 4WM7B 1UU4A 1W8WA 4NRQA 2Q1FA 1W2OA 4XABA 5DZGA 1ZOYA 1F4HA 3LDKA 1CPMA 4LIVA 1BMV2 1YCIA 4IE5A 3OBRA 3FBYA 2C0ZA 4B3NA 4AK3A 4YZ1A 2BOIA 1HF8A 5LB6A 1WYCA 2VWAA 1IBMT 2UXXB 3WNKA 4MHUA 2VPEA 2LHNA 4LF5T 2ZGQA 1H8VA 1N3QA 2JDKA 4Q4W3 3FHQA 3F57A 4ONUA 3WW2A 1VJ2A 1KNZA 3A7MA 4H9QC 4YG0A 2Y26A 4Y33A 1TNFA 4TXWA 3N9MA 2WQYA 1Y43B 1SLTA 4D8MA 4Q6FA 3ZIXA 2BRTA 4FPOB 4XUPA 3O1HA 2LN0A 3M7AA 1NCRA 4JAAA 4BCUA 4MOAA 1AVBA 2LSIA 3RS6A 4LQRA 3D4KA 3RYPA 4F1PA 2HWC3 1RUE1 3DCQA 2O8QA 2VZRA 5LK5A 2YYOA 1O4TA 2OT7A 2ZM0A 2ZOEB 4XACA 1US3A 1UU6A 3AP6A 5DG2A 3E6DA 4ZQLA 4A97A 2RS12 4B3TT 4P9WA 4LFAT 5I3LA 4BU2A 1LOCA 2GNBA 1MVEA 1QDOA 2VVSA 5A3UA 4RS5C 4QGLA 4CTEA 3EYPA 3JAFA 3VU7H 5IWAT 3Q9OA 3CZJA 5BNPA 1OF4A 2Y33A 3RIAA 2VL8A 5IJRA 5ACA1 2XHEB 5FZ4A 5I8YA 2XSBA 2XJ7A 2RS32 2A6XA 1KEXA 2JJ6A 1FX5A 1PX4A 4DRRA 3L11A 1BYHA 3MLKA 4OI1A 4CE8A 5BNNB 3CEWA 3O0VA 3ROUA 3HKDE 1M4WA 1XQNA 1LTEA 5J2UE 2Y1NA 2MNZA 1NT0A 5IK5A 2JRJA 4FJCA 3UUBA 5FFOC 3T0BA 4AR2A 2X0YA 2VY0A 1YQ5A 5ABJB 3I3QA 4GK5E 3UUXB 5FY9A 1PZ9A 3USSA 4RQPB 1DFQA 2JEMA 1XYPA 1ALYA 2VNRA 4CDWA 2ILMA 5EK4A 2YU2A 4O4LE 4UT5A 1WMDA 2FJDA 3X29B 4IEYA 2TUNA 4WVMB 2NYYA 1CZSA 2VCMA 2V26A 4HFEA 1PGSA 2CY6A 3BOWA 3W5MA 4ILAA 1AHSA 4BHWA 3PVBB 2JMHA 4HMZA 2ECIA 4UFMA 5J3UA 3E5QA 2IXIA 3ZPV1 4AEDC 4AEJA 2NTYA 1B09A 2PLV3 3AZWA 1VMHA 3L2HA 4XHXA 2RS52 2C6SA 1QJX3 1VBE3 4D0QA 1CWPA 3MHZA 4XCAA 1POQA 4DMIA 4IV1C 1G9CA 1RUI1 5CFCA 1QXJA 2JD9A 1HNZT 4LHNA 4ISTA 1TMF1 1MBMA 1ZZ9A 4DV5T 5SVIB 1FMVA 2HWF2 1YWKA 3CBNA 3MI8A 1IG0A 5JRCA 5HBAA 4LHSA 1LESA 4WM8B 4TYSA 4XZCA 1X4IA 4ZXEA 4COWA 4Y1ZA 3B94A 3GHMA 1IZNB 3VDBA 3M99A 4PF1A 3JQWA 5A1FA 3OG2A 2E33A 1U5YA 3AEFA 1H9WA 3KVAA 1B35A 4H9OC 1SACA 5FRAA 5AITA 4ANJA 3RKOA 3ZFGB 4NROA 2MYSA 4I3GA 3ZVZB 2BG9B 4WBOA 3U10A 5L3FB 4O61A 3FLTA 3V5UA 1YFWA 3JUUA 4B3RT 4OMDA 1JM7B 1ULFA 2YN6A 3Q8BA 2XJRA 4NXMT 2MEV1 3KLSA 1U5PA 4AI2A 2W47A 4AI1A 4YBSA 4XTPA 4EE2A 5K0UC 4M0NA 4EWAA 1ONAA 4N7UA 3JADA 5EPAA 1PO11 4CDWC 3NG2A 1WE9A 4UELA 3OVUA 4V1PA 4IIJE 2HWE3 1E5HA 1DF0A 1JYWA 4B1LA 5JOZA 5E6HA 1R1A2 2XTLA 2LE8A 4JTNA 4AF9A 4QXCA 3I7DA 1A78A 2CDPA 2QQNA 1OD5A 4RGGA 4XAXB 1FV3A 5FWEA 5HEJA 4CUBA 4HT1T 2A72A 2IUWA 1D0HA 5EJ1B 3RGLA 1NA1B 1UXZA 4ZZBA 1OLQA 3NRXA 2I6HA 5HEGA 4CCKA 2D93A 4PLMA 4KMCA 1D1AA 3NRYA 1OA2A 3N2GE 4JHZA 5CFCC 5T52A 3CMGA 2W3JA 5FZAA 2D6LX 2LXHC 1CIYA 4UW3A 3EBRA 1OPMA 1S0JA 1ZRDA 3OEAA 2Q9QD 4GOUA 3VKGA 5L9VA 3HCUA 1RUC3 3BTAA 1IGOA 4JRLA 3TEWA 3HCSA 5LP6E 4EZ4A 3MXZA 2ARBA 4ZU5A 4LMLA 3L1ZB 1H4HA 3ZMTB 3LB9A 4MXVA 1D0ZA 1U5XA 2WZR3 2ODUA 5FZ8A 3CZUA 2QRXA 2V6YA 5FKBA 2QTWB 1OEDC 2ZPXA 3IF8B 1QJU2 5LMNT 3EUHA 2YGLA 3HR9A 4AW7A 5FZ6A 3KDEC 1SBEA 4LBKA 1JYNA 3ZKUA 2TNFA 4JGZA 4R52A 2XAJB 1UGOA 4UFHA 1WCUA 4LEJA 4FPFA 1PIV3 5EP9A 3KHBA 3POGA 4JV5T 3I3EA 2FMYA 2EGMA 4YM1A 4MGZE 2D6NA 1AZDA 2V73A 3DGTA 3OTOT 4G3YC 1RB8G 1L7LA 4YM0A 2WWJA 5A7QA 4NHLA 1GV9A 2ZEYA 2D43A 2RDSA 3K3OA 4GH4C 1W06A 5IFTA 4BBQA 2VBPA 5KHIA 3B93A 3DF0A 1V70A 3KWVA 2FDHA 1PK6B 3NSTA 2Y43A 3HI2A 3VLBB 2OLTA 3VK6A 5C9AA 1HIXA 5IAVA 3O33A 1QJY2 3J7HA 3VBUA 1WW4A 1YQ2A 5D21A 1HR0T 1OUSA 1G8WA 2P1BA 2YURA 2Y34A 3EXUA 5FY5A 2JJ9A 1GNYA 4OFZA 2GC0A 2DBNA 1FATA 5AVPA 2H6BA 4GB31 3LSVA 2HWD3 5LHHB 1LECA 5DMYA 1MIYA 1UIKA 5LRSA 4JKLA 4F8HA 2Y48B 4WZ2A 4YGBA 5FY1A 3ACFA 3I2FA 4B8EA 5BNQA 4TWTA 1S4CA 2A3YA 1YQCA 5C3QA 2C5JA 4UEMA 1X36A 4P02B 1T8BA 3BQKA 4LMKA 4CU8A 2WNUB 4JI8T 2VH9A 2Y6KA 4LT5A 4FQZA 5T55A 1OLRA 4CDQA 1HB1A 5FZOB 2XEUA 5AQHB 3RWKX 5AQMB 4OUEA 2UUAT 1Z7S3 4CYDA 3LIGA 1UOGA 4HETA 3CQOA 5B78A 1T6GC 4A56A 1JUIA 3PVNA 4NJ4A 5E0OA 3ENRA 3LAGA 5E8AA 3UYJA 1WD3A 4XHBA 3POYA 5KH3A 3T0AA 2C9AA 2XOMA 1OSGA 2K9ZA 1GQGA 5I0TA 1FOD3 5KWRA 4DS0A 2Z6EA 3A7QA 1J59A 2EGPA 1O3TA 1F8VA 2CKLB 4XQDA 3IN9A 3U4SA 4LXLA 4N9IA 2YREA 1TME1 2G19A 2YC4A 5F2WA 2XM2A 3ZXGA 1JNRA 1HN1A 3RZMA 4RHV2 4LBQA 2HEYF 2YHNA 1H0BA 4KH9A 3WW4A 1N33T 4LUKA 4WV8A 4V2VA 1MVQA 1XNRT 3OBAA 2XQ3A 2XHNA 1AR63 5JH7E 3IKWA 5JCTA 3UQ4A 1T2XA 3TKLB 1ZRFA 5L7OA 3GN5B 2H88A 5C9AC 3I59B 4G2AA 4WNKA 4IDOA 3ZKYA 1KJRA 1D0GA 1COV2 2D6PA 4F52B 2LV9A 2DUQA 1N1SA 4PQ9A 4NIIA 4OHXA 5B77A 3CHXA 3O36A 4M4RA 5GZEA 4U2ZA 1TQ5A 2D44A 4YWAA 3RZLA 2OUJA 4FP2A 3DTOA 5JR9A 4RS5B 2EIDA 1YXRA 4LLBA 4AFCA 4K0KT 1K12A 3ON7A 2VASA 3IDCB 1VB4A 1J3RA 2BBVA 1S0GA 1RUOA 4QB6A 3UU3A 1RC6A 1HLCA 1YXWA 2BEOA 4QH1A 3HD8B 2RDRA 5FPBA 4DXSA 5FB1A 5SV8A 2NN8A 3U07A 2R072 3C7EA 4GMP3 4KU8A 4CUCA 1MNDA 2DJAA 2LSJA 3T7LA 4UFLA 1O8SA 4RA0A 2D3SA 4DXZA 4AKRB 3OGSA 5FR3A 4IREA 2B4KA 1STMA 4CXYA 4XI1A 2OA2A 2YC0A 4MFRA 4WZXA 2DWRA 3OGGA 5AC91 5LA9A 2M85A 5AQIB 4BK4A 2R0HA 3N9QA 4Q4V2 1UX6A 1QQP1 5IVCA 5ERLA 2CHHA 4IE7A 4W50A 3HKBE 2EIGA 2WYFA 3LFIA 1HXS3 3BODA 3RKGA 3WP6A 4GKJT 4FOVA 4HANA 3AKQA 2PA7A 2YB7A 4GXLA 2CYFA 2LKGA 3CJIC 3AEAA 2LGKA 3RYIE 1MEC1 3ILNA 5SV5A 2DUPA 4GAZA 4AEMA 5EHDA 2QQLA 5C8CC 4LFCT 2VMCA 1ZP0A 4Z2AA 1V6MA 2ET7A 3WEZA 2KE1A 2ECNA 2IWGB 1ZVFA 5L7OC 3VKFC 2BFUS 4AEDB 4OX9T 1OFNA 4NPPA 3RIUA 1BBT1 2GNDA 3R0RA 4YZ4A 3H0OA 1EV11 4X20E 3IDEA 4IV1B 4UIGA 4KG8A 3TLVA 2YDEA 3POBA 5IYZE 4Y1XA 1VRH1 3ABVA 1IBLT 4XF1A 2EHOD 5JR9C 1RVF1 5JDQA 5H1UA 1KS4A 3T1YT 1CAWB 2WWSA 1VBA3 4QAWA 4AYCA 5FAXA 1JH5A 5A6ZA 1KRIA 3GA8A 5JDBA 3ZSEA 4AAPA 3J7Yq 4E4HA 4NPRA 2WSVA 5JMCA 4YZ3A 3QCWA 3VN4A 3SEEA 5I8TA 4OGEA 2PHLA 2XBO2 3KQIA 2KU3A 3HAGA 4AHWA 1WW5A 1HG2A 2LM9A 1R8IA 4OHZA 4LR4A 2WAAA 2XOCA 3H7YA 3C98B 4I0WB 3AE3A 4XE9A 2IXLA 3RRCA 1D0XA 1UK5A 3UU5A 4A2UA 3UFEA 2IXCA 5K0UB 3WQ1A 1TG7A 4UXAA 4CDWB 1JOPA 3AL5A 4H14A 2PHDA 1WMXA 3KV9A 1H7CA 2YMZA 5FZMA 1D2SA 2F6BA 1ZYBA 3PUZF 3O1OA 1UZ0A 2QZ2A 2E9XD 1WA4A 1EUUA 3IAQA 4AXOA 1IS3A 2F17A 5HXEA 4P0BA 5A3OA 1X79A 2PHWA 1DIWA 5FXXA 2R063 5JXHA 4Q29A 3D0TA 1UZZA 3Q5DA 4GKXA 3LDYA 4N9HA 5GZDA 3WQBA 1BMV1 3SISA 3ZYLA 4U36A 4Y1YA 3ZSKA 2JIGA 4FOYA 2F4VT 2WNOA 3O1MA 1UL9A 3WX5A 5CG8A 2EAAA 5BNOB 4LA3A 4YVWA 5FZIA 5CFCB 1MMAA 4EXTA 4A7ZA 3SRZA 1KEYA 3C5KA 4PDWC 2JIWA 3AE2A 5FO9B 1BR4A 1ZZBA 2G4IA 4QKDA 1R093 1IG3A 1GFF2 3HIFA 3AC0A 3WVJA 2RJLA 3A22A 2KKXA 3Q9DA 2E8IA 1V00A 5JRCB 1GZWA 3EAMA 1NXMA 4HG6B 3POJA 1OEDB 4N53A 1H2KA 1EZ3A 2BTVC 4CCLA 3OY8B 3RYRA 1UPIA 3ZVXA 3JXSA 4CSWA 2WWUA 1JZ2A 1OOPA 2B42B 1DBNA 2GP3A 3I2GA 5KDMC 3IM0A 3TEYA 2CBJA 4E2SA 4XZPA 1YQ8A 5DPNA 1Q8SA 3VZKA 2EHOA 1V9U1 4YABA 3OPWA 4QKBA 4NPMA 3KGZA 4A6SA 2Z79A 5ISLA 2CWOA 3GMIA 4DVDA 4HWFA 1ND2A 2X67A 3QK6A 1H9PA 3OBTA 4UFKA 3RZKA 4D6SA 3CQXC 2BWCA 5JIUA 1DQ6A 1W8HA 3BCWA 3GDBA 5C3PA 1FBVA 3ITQA 3ZLIA 4GNFA 3D5OA 3K4AA 4GH4B 2V7KA 2A5ZA 3EHZA 3VRAA 1N36T 4FPEA 1KFXL 5F3CA 4YGCA 2P5BA 4WZFA 5IK8A 2XSAA 1ZBA2 4DBRA 2FBWA 5JSOA 5KXEA 3I3MA 4FI5A 2HH7A 5HI0A 2JIJA 3MV11 1ASJ3 1I9RA 2LOPA 5LBMA 3R6SA 2ZGSA 4XEZA 4YZ5A 3NZQA 5EYXA 1PMJX 3FMGA 2Y38A 1UQXA 4GWIA 3DKQA 3AFKA 3ABZA 1LOEA 3GHNA 1AR91 2VMEA 5C7GA 3MIBA 2DNXA 3RC3A 2VTXJ 4YVWC 5C3SA 1BEV3 1JYCA 2E9XA 4DR4T 2VTFA 5JPMB 4MSXA 3DPLR 3P4WA 2I59A 1GQHA 3DYPA 4BQWA 5LA6E 2WINB 1WCKA 3N36A 5FJHA 3KV6A 4IDNA 2XHKA 4CCOA 1C8M3 5HEUA 4DR2T 4LIUA 1YRZA 5T5OA 4PBPA 5F5QA 1LVKA 2DSMA 5A1LA 2V6XA 1I3HA 2VNOA 2FDJA 3HT2A 1UXXX 1AYM1 4NWWA 1UOBA 4GALA 1OOPC 4PK6A 4YLHA 4U7IA 2FJBA 5I91A 4N43C 4ASKA 1R1ZA 3IT8A 1WKYA 4YHJA 3KD4A 2KIZA 5H6RB 4Y4YA 4EN8B 5JXIA 2HWF1 4LKEA 3FL2A 4LTAA 1MZFA 3QB5K 4XFCA 2NPIA 4W8JA 3O7OA 3UKNA 4Q4Y1 3H8OA 4ISQA 3V43A 4Q1PA 2DVGA 4BLJA 3RRDA 1WBFA 1SUMB 4QPYA 2DYCA 2A6YA 1Z60A 2KLQA 5F3GA 4Z07A 1I5PA 1RUJ1 3VD3A 4FFGA 5JWPA 3WD5A 1FNYA 1BK1A 3HTKC 4DXTA 2K16A 2VQTA 3IPVB 4AHYA 1VYXA 2LW8A 3TN93 5BUVA 3ZIWA 4W6YA 5DUXA 5LASA 1NAFA 4Y1UA 5FBJA 3HKEE 5C3OA 3H3AA 2XQ7A 4S2HA 3UU6A 3ZJ2A 3D0JA 1S0IA 4QQOA 5CFDA 5HV0A 3WI3A 1ZV4X 3FB2A 5IWFA 2BNMA 2WFF1 3TNQA 3MUY1 2ZMKA 1XU2A 4E8CA 2VOXA 3IHPA 3AE7A 1ENXA 4Y24A 2MA5A 4A3ZA 2M1RA 4IERA 2BBHA 1Y4WA 5LCWL 5JQGE 2CDOA 5F1RA 1S94A 4BPZA 3BVCA 2W1SA 3INAA 5L47A 4OUSA 1W6MA 5FQ0B 4K1YA 4H63H 4O7XA 1W6NB 1UU5A 4R2YA 3FEHA 4CCDA 3POIA 2VZOA 2VO5A 3LK42 3OPCA 4GIWA 4IETA 2YDQA 2VKHA 1IKPA 4QKFA 3SUBA 3LPFA 4HE8A 4A42A 3OUIA 3O37A 4BLIA 2W08A 4GZ9A 2XKPA 2EA6A 2PFWA 2VOVA 4NUVA 5FLIA 1HFAA 2D5HA 3B5MA 3FZ3A 2VD7A 4XMAA 4QXBB 4AQ6A 1JYXA 4PHZA 1LODA 1UKGA 3QOFA 4WZ3B 1PVC3 3MIHA 1FV2A 4PIYA 1QJU1 3AA6B 4M3CA 4QQ2A 1VPHA 1W39A 4LBQB 3E5UA 3SCFA 3CJIB 3HQXA 2KT9A 2FMDA 1SPPA 5C8CB 2YHOA 3GBFA 4TN7A 5FBZA 4O2BE 4ZONA 1VBC2 3MV01 1WCSA 2H0BA 3W15B 3RMYA 2IDAA 2D40A 5KR7A 2LGGA 5FKCA 1OBNA 4HFBA 2P6CA 2HDPA 4I0BA 2LRLA 4AQSA 4YSXA 2KINB 5CFDC 3E97A 2Z69A 4TV8E 5B75A 2BDEA 3NJZA 4X1KE 1O4ZA 2OX0A 3BK9A 1D4M3 5JR9B 1H30A 1VBD2 3EB6A 3M63A 3ZMUB 3WAJA 3FXEB 3FZKB 4I3PA 4BIFA 4NMIA 1SDWA 2A6WA 5A3NA 2YY1A 1GP5A 2A9UA 1YIFA 5AQNB 5IVVA 3BU7A 2QQUA 1SEFA 4LF8T 2W1UA 3ZN6A 3UKVA 4COYA 2G1MA 1O5LA 1V6IA 2IZWA 1V6KA 1YQ6A 3AB0A 1KNRA 2HWC2 2RSDA 2KXLA 1T7SA 1FEWA 4FFHA 2NMOA 2JG8A 2OA5A 3ES4A 3WDXA 1KD7A 2CPTA 5HXMA 3ONLC 1I94T 2NM1A 2XONA 4I7BA 1WCDJ 4F3JA 5HPOA 3AMMA 3MKDA 5ABGA 3VV1A 4PAGA 3UV9A 5FUIA 4B86C 5CIRA 1CD3G 3ZKRA 1WEUA 1JZ4A 3M3CA 3U14A 2PHFA 2ZETC 1WEWA 4OMCA 1LKXA 4PPEA 3K4ZA 5L3GB 4YC9A 3VKOA 4NHMA 1W9RA 3KV5A 1Q3EA 3RGBA 2F6NA 1TVGA 3T09A 2WYSA 4LOSA 5LGUB 2OQ6A 1M7KA 2H89A 4AVXA 1JW6A 4RYDA 2GALA 5TAOA 4P9YA 4DQAA 1C8NA 3NKTA 1DCSA 5IATA 3SCGA 1WWYA 3I8TA 2P3JA 5KMGP 4PDWB 1WIMA 4DY3A 4JTOA 2Q4SA 5FCCA 2BUKA 4YPJA 2VKJA 2YZ4A 2C5IT 3DJBA 3WNOA 5L4HA 4AYCB 1REDA 2CM0A 4EQVA 2AENA 2KWOA 4K1ZA 4FO9A 5ABFA 5CEHA 4GIQA 3GWHA 2QDRA 1O3RA 1SDDB 2J7MA 4NIAA 2CMRA 5E16A 3POFA 3V0BB 5LXTE 4UVAB 3VR8A 2Q8OA 3X1DA 2IC6A 5FUPA 5K8SA 1COV1 1ND3C 2VUCA 4TNVA 1AYN3 2EXKA 4YFZA 1QY4A 5L3DB 2ARCA 5G05B 1VCSA 5C13A 2XMLA 5GZCA 4FFFA 3GCWA 3ZX7A 4ZI3C 5B79A 3F95A 1Z2QA 3UFGA 5FZHA 1LRZA 2TBVA 5HEOA 5KHJA 1OKOA 5JLVA 2WDQA 2XQ5A 4YG3A 2ZMAA 3IBMA 2AEZA 2R071 4FIPA 1FNZA 2GP5A 2H7VC 3T08A 2VW0A 3FLRA 3BTXA 2BKPA 5AQLB 3K3QC 3JBG1 3SOWA 3VBHA 4E2QA 2KD7A 2W5FA 1MZ6A 1C1LA 2AH2A 4A0CD 3AZYA 5LCYA 5I0SA 5BMVE 1GYKA 5J0ZA 1H8TB 1WMEA 4CN1A 1DU3D 3ZYQA 4H7MA 4CXXA 2UY8A 1VE0A 5A7NA 1SHZC 3HT1A 3C4XA 3O1UA 1DLCA 3BQIA 4CEWA 4AVSA 1HRV1 1ZBE3 1J1JA 4Q4X3 2X66A 4YVWB 3WLUA 1UWWA 2KA3A 4DV6T 1HX8A 5GLZA 4AAXA 1Y9MA 3SC7X 2G43A 2CSVA 1A6CA 4AISA 5EK3A 3NJXA 4AEKA 4ZZ8A 2RM21 4YARA 2XL9A 1WRDA 5ACA2 1HB4A 1XNQT 2ZA9A 3ZFEA 2DU0A 4JUYA 3RJRA 3AJZA 4QX7B 4HPKA 2WAUA 4GNGA 3NAPA 4GA9A 2J22A 3CDZB 2NP9A 4BAYB 3KCCA 1OOPB 5T3NA 4DUVA 1GP4A 4N7IA 5CG9A 4IEPA 4N43B 3UGFA 4N90A 3VDDA 3ZCJA 2I2SA 2WSUA 3TNPB 4YSZA 3K48A 3NNMA 3MW2A 5C2TA 1UY0A 5GLTA 3O14A 4OVEA 5I93A 2UWAA 5FYBA 1K5MA 3KMHA 3QH6A 3DWDA 4AL9A 4FAGA 2NQYA 1RUG1 3O5SA 4ATFA 5A80A 4QWNA 4Z8BA 4WBNE 1RUC2 3VBSA 3WF4A 2XBO1 4FTSA 2ZGPA 4Y22A 3FZHB 5H1TA 4N78D 4UP5A 1BXHA 1TME3 2VM9A 3VHPA 2LDRA 5F3IA 3CO2A 1RUF3 4O65A 2XLGA 5IK4A 1XDOA 5F7UA 2A3WA 5C11A 2BG9E 4HK8A 2WO3A 1V0AA 1RUI2 1W05A 1YC61 2OYZA 4XTMA 1N87A 4LO7A 2MNGA 3USUA 1SE7A 5HEHA 4MGKE 4XZUG 2Y8KA 4KWUA 4MLKA 3IA3A 5IHYA 3M1HA 5FDBA 2VOKA 1MM2A 1OA4A 4PIZA 3AXJB 4R4XA 1O59A 1EAH1 2VR4A 1US7B 2JKBA 1PO23 2UZGA 2A2FX 1IQDC 3J8F3 5F5AA 3NAPC 3MA9A 1MPXA 3ZYJB 1N3OA 4BIOA 3RJ2X 3MIGA 2O8OA 3SMHA 1UO9A 3DQVR 1GZTA 1JU4A 3PLWA 1QEXA 4OCTA 2MEV2 2WT1A 1AR73 3ZYFA 5JDFA 5FZEA 3H3MA 1YLLA 3FN9A 2JB8A 1HQNA 4HN1A 1RL3A 1POV3 2DHRA 3NVOA 5EIYB 5KXJA 3PHMA 1PO12 1WMFA 2DTWA 2J42A 1K5MC 4HSLA 1W8TA 5KC6A 3ZT6A 4FP3A 3PTYA 4KNCA 5T5JA 2VE1A 3RYHE 2M6BA 1RMU3 4B7KA 2EAKA 1LR5A 2WZEA 4TLGA 5AQTB 3VDAA 2Q0AA 3BB6A 2MPFA 2OIIA 4L92A 4BHPA 2K1JA 4FBFA 3BPSA 5FZLA 2RMU1 4LMFA 4OHVA 3RPGC 1ZZ6A 3ZPOA 3NV2A 1RUH3 1WA6X 5HCAA 2P17A 2LRPA 2RR12 4MG2A 2GC2A 5CFDB 4LHLA 2SBAA 4FSJA 4LO5B 3D82A 1W6PA 1H2NA 1NZCA 4H9SE 4GNEA 2EIBA 2JD4A 3JCIA 2CU5A 4XETA 4UW6A 4AHZA 4KL1A 4MX3A 2HYKA 2V7MA 4CEYC 2VECA 2PYTA 4GMP0 3BIWE 2J1SA 4LK6A 4OYKA 1ZBA1 1BBT3 1YJKA 1N1YA 5JI9A 3CPZA 2VQET 2J1TA 1UF2C 1Y7BA 3KINB 1W0PA 3LK3B 4HFIA 3N9NA 5B76A 4JZRA 4QDSA 4NO4A 2XR4A 2VTXA 3OD0A 2EXIA 2X10A 3LVRE 2ZZJA 4A6OA 5FOBB 1RTVA 2LS6A 2LUWA 3DECA 3L8RA 5KXBA 2VUJA 5HAXA 1H1AA 3JC6D 4JYAT 2PAEA 4MXWA 2FDGA 2R043 2AXDS 3N3HA 2XWBB 2PELA 5TDWA 1S2BA 2HHHT 2ZGOA 2D97A 1EP0A 5C33A 5D1MB 1APNA 4AVTA 3ZXEA 1UOFA 3SITA 3C4ZA 2VVDA 4JC1A 4INDA 1EUTA 3EO6A 3K8PC 5A3LA 2XG3A 1PM7A 3OYZA 4BDVB 4AUQB 3N5LA 1WW7A 2BGPA 3NNFA 3FFZA 1PX3A 1DCQA 4NIHA 4FQ4A 1J1TA 4BQ3A 1QXRA 5A3PA 2ZEZA 4Q26A 3T1LA 1IKQA 1FIOA 1UMHA 5FYTA 5A32A 5FZFA 2QVAA 3PDYA 4FJOA 3AE9A 2ZS6B 4CCCA 1WLCA 4GB32 4IEVA 4LKFA 4CDUC 4GK0E 1WR0A 1FMD3 1OLME 2QICA 1UKRA 5BV6A 3IAPA 2ACXA 2VW1A 3TEZA 4OGCA 4NIQA 2CSYA 5F5CA 1UYZA 2VMGA 1MQTA 2XKOA 4XFHA 1NENA 5FMOS 2YROA 5HCFA 3AKPA 4LK7A 5TSWA 2D0TA 2G6QA 4YXDA 1S2EA 2K24A 2WNVA 3ATGA 3FZLB 3UK9A 1RHI1 3PU3A 1AR81 2HYXA 1XBFA 3IIIA 2YSMA 4GKYA 1ZNPA 2E61A 4QX8A 3OGRA 1ND3B 1AUYA 3ZN6B 2DL1A 2H0DB 4D6QA 2MTQA 1CPNA 4B7EA 1YKEB 2AN6A 1N1TA 3HQRA 3BGAA 2VC9A 5CKQA 2DCJA 1LOFC 4RN5A 2WC2A 4E7ZA 2QQPA 3VBFC 3WF2A 2YGMA 4CU6A 4GULA 4JX0A 4Y20B 5HWXA 1SLIA 2QBXA 2K3WA 4F8AA 4DZGA 3AA7B 1CAUA 2VJXA 4Q0QA 2VQFT 4CI1B 3UT5E 1YHFA 2G9GA 4G4FA 2ZKNA 4W4ZA 3ZXAC 2WABA 1LHVA 1V6JA 3C50A 3H1YA 1HRI1 2W94A 2RS13 3UJQA 4IV3A 1VAVA 4X8NA 2VJFA 2ZGUA 2M3HA 5D2AA 1YD8G 1QU0A 3MW4A 3B5LB 4QDQA 5FYVA 4EWDA 4UW5A 4A98A 4QX0A 5FYIA 1KQRA 2KWNA 4AFDA 1T98A 2LGVA 3TBDA 1YI9A 3VR9A 2JG9A 1UX5A 1W8NA 4QHZA 5FTTC 1PZ8A 2RS33 1MMNA 4PJMA 5K9YA 2NW8A 4RD7A 2FDFA 3PV0F 2ZGLA 3CQCB 4KHZF 1U5ZA 5DKAA 2ZAHA 4PQQA 1QOOA 1VD4A 1W09A 3KBUA 4KWKA 1PZ7A 5ANNA 5AVAA 1UPSA 3RC8A 3ZYMA 1A34A 1X4UA 3WF0A 1OQ1A 3UUMA 5ABFB 5FY4A 4HKWA 2HWB1 1VB2A 4YVSC 1ST8A 3WG2A 5FY7A 2BPA2 2NOXA 2CEAA 1O3QA 1KF6A 1WLXA 3KCXA 1BHGA 5LW9A 5IUQA 4DMWA 3PJQA 1XZYA 3VBOC 5FZCA 5KC5A 3B69A 1AXYA 3JB8A 1DDLA 5IT6A 1HB2A 2R062 2TEPA 4Q25A 3BUCA 5AC92 5AQKB 3N35A 5F9TA 2WT0A 3U1XA 5EWSA 3WCSA 2JE7A 1E1HB 1XSQA 1IPKA 3WNNA 2HKXA 1QSDA 1FYUA 2RA1A 3U0ZA 1QQP2 2N7GA 3PUXF 5KXCA 4YSFA 4PJLA 2RDNA 2MBGA 2RS53 4XBQA 4DR5T 2ZMLA 4Q4W1 5H9MA 4PFOA 3ZDSA 3AL6A 3VRBA 4D7TA 2OXBA 4FPGA 1HYJA 2P34A 1OUXA 3OOXA 4N3WA 1ULPA 2A1XA 3QLQA 4IV3C 1MEC2 5L4EA 4M0HA 1NCQA 4XFBA 3FZMB 3BN6A 1NLQA 2PTFA 2RHPA 4ZI2D 4KP3C 1ZM1A 5ETWA 1V87A 1DU2A 3Q8AA 2HWC1 1LJ7A 3IIAA 2JQQA 2JG9C 2VQ0A 3DXTA 1DGRA 4HTEA 1MS5A 1EV12 2WO7A 3WINE 4OZOA 4IE0A 1MS1A 1JOCA 1D7PM 4FPLA 3GCXA 4IC2A 4KQ7A 2GN3A 1VRH2 1YNAA 3PUYF 2Q8EA 3K46A 2ADEA 5IFPA 3AZXA 2LM2A 5J48A 1RVF2 3CIRA 2XAGB 2FBEA 5AQJB 4JI2T 5H9RA 1W03A 5DN2A 5JI7A 5EV7A 4HWCA 5FK7A 2NW7A 2KGIA 3PTRB 5ABHA 2YHJA 5FK8A 4AQ2A 4I7DA 3RX6A 3T4HB 3AP5A 4D7YA 3QD6A 1KXGA 4KI0F 4FTEA 3J9X1 2ECGA 1GBGA 3NAPB 1KFUL 5C4WB 2N9DA 4CCJA 3GZUC 1R1A3 3GXUA 3S57A 4ZEYA 4JI5T 4NIGA 3O34A 1XE7A 2QQWA 2VJEA 3T9KA 1PMIA 2R30A 3NKGA 1LB2A 4UF0A 3K51A 2B9VA 3WXPA 4WZCA 2WA4A 3ZN1B 5DUWA 2CAUA 4DXRA 4NHYA 3S7IA 1Q8QA 3A8YC 3ORJA 4OFGA 1GU3A 4HKOA 2VBDA 4ISRA 3RWNA 1XB9A 2Z2SB 5J96B 2VP7A 4JGYB 4YW7A 3PUGA 3ZNIA 1PM4A 4J2CA 1WFDA 2XQYA 1RXGA 1AX2A 4LO8A 2QQOA 3S30A 4HZFA 4UI9L 3RQUA 4IL9A 4YTPA 1E2AA 2BGOA 1OEDE 5JVDE 5F5IA 5LG3A 4ERRA 3RPGB 4LKSA 3C7FA 5HCBA 3CU7A 2PLV1 1WLWA 2WRAA 3THCA 1QJX1 2JKXA 1VBE1 1NLRA 2NP0A 2J1VA 3V0AA 4A5XA 4QU2A 5AQRB 3WR0A 4R8PK 1VMJA 2FCTA 2YBSA 3TWIA 4ZZCA 4YYOA 2R49A 1QNYA 2D7FA 3LBXB 2G9FA 4CEYB 4XJZA 1BR1A 4IDQA 2K2SA 5KHHA 2WQ4A 3M8LA 3F2EA 4MBQA 3C7GA 2ETEA 4P9IA 1LVFA 1K45A 2PG8A 4PBOA 4ES8A 3N7MA 1XYNA 1XNDA 1J83A 2D6MA 2KZ7B 4CCMA 3ZYRA 1QJFA 3C7OA 1KJLA 2PUYA 2W1WA 4YNIA 2EVXA 1U4QA 4GWJA 4K7JA 2JQ9A 4MLOA 5FP7A 1CJDA 3TN92 2P2KA 5FMNA 4UVCB 4K6BA 1DQ0A 1RINA 1SLCA 1V9U2 2PQQA 1CZTA 2C5DA 4QT6A 3VKMA 2WLPA 4IXLA 2JMJA 4BOWA 4X1YE 2WZHA 1LOGA 2K4DA 4AG4A 1QJY3 3BALA 4I30A 4LK9A 3G7DA 3ZSMA 1HKDA 2Q8CA 4LF6T 4L7XA 1WBLA 3H7JA 2QQJA 4TWFA 5K4LA 3E0ZA 4CXWA 1VFYA 3PVEA 2CTVA 1V6LA 2HWE1 3ETPA 2OZ6A 4AOCA 2X9HA 4UW4A 3KB5A 5CYYA 2E5VA 1YFUA 5DQVA 1ENSA 4RFRB 3H3LA 2E2AA 3B00A 3ZYKA 4FPKA 3SLIA 1AL23 2DURA 3NJYA 1HG5A 3JB4C 1SZBA 4PK5A 4C90A 3H42B 5I8SA 2D6KA 1CAXB 2LM3A 3JQXA 1UMZA 1HCIA 2DVAA 5FNVE 1HYIA 1IS4A 4Y5Z0 4QMAA 4CDUB 2ZMNA 1AR92 4TLFA 4B3MT 2QZ3A 2XVGA 2ENRA 3D3AA 1O8PA 3FAOA 1DZQA 2IXHA 4FPHA 4IT4A 2QVSB 5JDLA 2QIZA 4EAHA 4AVBA 4N4FA 5FYUA 1RUC1 3WQ7A 2KKYA 3PUSA 3ZYIB 4MHRA 1LDJB