3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
1VRBA 5F32A 5FPLA 2VJEB 2KE1A 4IGPA 4S3OB 2OQ6A 4CCMA 2YURA 4TN7A 5J3XA 3N9LA 3ZPV1 5AIUA 3KVBA 5EYAF 5FY0A 4P5OB 2QJ0A 2G45A 3O36A 5FZ8A 2YU1A 5FV3A 3DXTA 5G04B 2CT2A 4GJYA 5A80A 4PPEA 4GAZA 3N9NA 5FWEA 3UYJA 5FYBA 4A0CD 2JMIA 4N4FA 5LKZA 5G05B 5F3GA 5FPBA 4X3GA 5FY8A 2FUIA 5F3CA 1LDKC 3ASLA 1RMDA 1WEEA 4I7BA 2MA6A 4AYCB 5F39A 2YQMA 1E4UA 3SOXA 2D8SA 3KNVA 4FK5A 4MSXA 4QX8A 5LCWB 3T7LA 5FYVA 5F5IA 1WENA 4URAA 1WEUA 5FZOA 4V2WA 3PU3A 3PTRB 5LY2A 2Y43A 2H0DA 4R2YA 1X4JA 3AL5A 4EZHA 3O34A 2MIQA 5JG6A 4IGQA 1WEPA 5A7PA 2YYRA 1X4UA 2KWOA 2M3HA 2LDRA 2YHOA 2ECGA 4GNEA 3LQHA 5H9MA 3ZVZB 5FZIA 4IC2A 4Y33A 3O37A 4YC9A 5F2SA 2XMLA 5F37A 2RI7A 5FZKA 5FXZA 1WEVA 2MNYA 3ZYQA 2L0BA 2I50A 2EGPA 3C6WA 2K17A 2W2IA 2ECJA 4UP0A 2K1JA 4CCOA 4CCLA 4CCNA 2OQ7A 3AVRA 4LITA 4L58A 5A3PA 3EB5A 2YSMA 4FJCA 2VPEA 4ZDTA 4QF2A 3RVHA 2FSAA 1CHCA 5FYTA 2EA6A 5FZBA 2WWUA 2XDVA 5FZLA 4CCGX 2HYED 2H0DB 5LKXA 5F5CA 4LLBA 2LGKA 2MNZA 4UP5A 4YAXA 4BU2A 1WILA 4L7XA 4LKAA 5A7WB 5LW9A 2ECWA 5D1KB 2WWJA 5TDRA 4YATA 2MA5A 4CCJA 5IVCA 5FXWA 2Q8DA 3U5NA 1JM7A 5FY5A 2ECTA 5FY1A 4UF0B 2UZGA 2K16A 5F5AA 3IHPA 5KR7A 2DX8A 4UF0A 2G6QA 2RSDA 3O7AA 2KYUA 5B8DA 4LXLA 4QXCA 2MUMA 2LRIC 1HYIA 1WIMA 5C11A 1Z6UA 1JOCA 4CUGA 4GNDA 3RPGC 3N9MA 5B75A 5FZ3A 3U5OA 2ZETC 5IVJA 5A7SA 5E6HA 4EZ4A 1VYXA 5A7WA 2MD7B 2OS2A 4CA1A 3C5KA 4DO0A 2YBPA 1ZBDB 3EB6A 1FBVA 4WZ2A 5TRBA 3N9OA 5DKAA 3LRQA 2M1RA 4D6RA 2ECVA 4AUQB 4LADB 1V87A 2HDPA 5FZ1A 2BAYA 4PTBA 4D6SA 2M6MA 3V43A 5FP4A 4GNGA 5FB1A 5B79A 5FZHA 3DPLR 2G43A 3ZTGA 2VP7A 4ZQLA 3ZPOA 3DXUA 3PUAA 2KGGA 5I3LA 5D1MB 4LIVA 2LXPC 2VPGA 4LIUA 4V2VA 5FY7A 5A7NA 4MVTA 2C2VS 2JMDA 3L1ZB 3HCSA 3K3NA 4UI9B 4W4UA 5FP3A 5FB0A 3SOUA 4AP4A 2GP3A 3L1XA 2YHNA 5FYZA 2Q8CA 5FZFA 5A1FA 3LDBA 5FUNA 1VFYA 5ANQA 5KH3A 4QXHA 4FO9A 4A4CA 2E6SA 4IGOA 2YREA 2KFTA 4A49A 5FYIA 3OPWA 3PU8A 4E4HA 4GD4A 3KV9A 4BHWA 2PXJA 5FZMA 5FEYA 2L80A 4LJNA 5F3EA 5KH9A 4QU1A 2CKLB 4WA6A 2KGIA 2GP5A 2FUUA 4YBTA 5A3WA 4WZ3B 4GNFA 5LY1A 4R8PK 2CKLA 4YBSA 4QX7A 2Y1NA 5FPAA 5FERA 3SHBA 3LQIA 1XWHA 2ECIA 4GJZA 2VNFA 5LKTA 4R7EA 5FYCA 4YADA 5FY9A 2LGLA 2XXZA 3ZLIA 3KVAA 2YQLA 4NUBA 5FZ4A 2YBKA 4Y4RA 5FYYA 4XDPA 1F62A 2MD8C 2JRJA 5FZ6A 5H1VA 1FP0A 4C8DA 4HOOA 3O70A 2YU2A 2C2LA 2YBSA 3K2OA 2LN0A 5FP7A 4YABA 3N9QA 2KWKA 4C9ZA 2XB1A 2Q8EA 1VD4A 3HCUA 4ASKA 2YUCA 5FZEA 5F2WA 2YSJA 4NN2A 3K3OA 3I2DA 3NJYA 5FY4A 1K2FA 3AVSA 2P5BA 2KR4A 4WZ0A 5IWFA 3L11A 1WE9A 3SOWA 5C13A 2NAAA 4QXBA 5FZDA 5LKUA 5FZ9A 3ZVYA 5FYHA 5IVBA 2M85A 4AVXA 3T6RA 5FYMA 4F52B 4EYUA 5FJKA 5CEHA 5D1LB 5FYSA 2XEUA 3QZVA 2CSYA 3LD8A 4O64A 5FPUA 2Y1MA 1BORA 3PURA 2K4DA 3KV6A 2JMJA 3O35A 4B7YC 3U4SA 1WEMA 4AYCA 3GV4A 5B76A 4DIQA 3N9PA 2ECNA 1DVPA 4S3OC 5TDWA 1WEOA 2LXHC 4HONA 2KWNA 1WEQA 5FP8A 5FZ0A 4CCKA 1HYJA 2VJEA 2YPDA 5FZ7A 5FBJA 5B77A 2IDAA 1N87A 4D6QA 2VD7A 3NG2A 2F6NA 4BXFA 5A3NA 1MM2A 4LK9A 2LGVA 4A4BA 5KH7A 5IVVA 3PUSA 3M99A 2YW8A 2QIZA 1Z2QA 1MM3A 4N3WA 1JM7B 5FXXA 4AAPA 2EODA 5A7QA 5IVFA 5A1LA 2QICA 1G25A 3PDQA 5FZCA 4BBQA 5ISLA 3PHDA 5F3IA 2KWJA 1U6GB 2L75A 5FJHA 2E6RA 5G0FA 4ZUXU 2LV9A 3GL6A 3RTRB 3DQVR 4GB0A 3HTKC 1Z60A 5FZAA 3O33A 2L43A 3ZNIA 4V3LC 1X4IA 5LWBA 5AITA 5H1UA 4V3KC 2YT5A 5FP9A 4I7DA 4XDOA 1LDJB 2KIZA 4IC3A 4Y3OA 2AN6A 2PNXA 4QF3A 1WEWA 5FZOB 4Q6FA 2MT5A 5TBNA 5FPVA 4TKPB 3HCTA 2VJFB 1T1HA 4XI1A 3RPGB 3U5MA 3PUQA 4AI9A 5B78A 4B86C 4BISA 5A7OA 5TABA 2LQ6A 4I7CA 5FWJA 3OPTA 5FZGA 5FXVA 2XUEA 3FL2A 3MHSA 5FYUA 2VPBA 2LGGA 5K4LA 5IW0A 4FIPA 3U5PA 3LQJA 3AL6A 5IVYA 3MHHA 3ZPVE 1IYMA 2OXQC 5H1TA 5FUPA 3KV4A 5IVEA 2KREA 3M62A 2F6JA 4CSWA 2F42A 3M63A 4YBMA 5DINA 3U78A 3KQIA 2L5UA 2KU3A 4QWNA 2OX0A 2VJFA 3KV5A 1WGMA 2YU4A 5A3TA 3VK6A 2CSZA 2VPDA 1WESA 1WFKA 2PUYA 2OT7A
chains in the Genus database with same CATH superfamily
4KNCA 5SVYA 2GNDA 1QJY1 5J37A 4OGCA 4S3OB 4YSZA 3H1MA 1QQP3 3H9AA 4MGZE 4XPVA 3VBUC 1HB3A 2K3WA 3E97A 4YW4A 1RINA 3I9YA 2RS52 2Q30A 5G04B 3WP3A 5L73A 5HXMA 4LK7A 4PBOA 4XJ9A 3UYJA 3DPRC 4OHXA 4JC1A 1G9BA 3B57A 3C98B 3ETUA 3P3PA 3VHPA 2GMMA 2D8SA 2LRLA 3AE7A 3FBZA 2ZKLA 4GYRA 4AEMA 4UXNB 1FMVA 5D8AB 1W6QB 3UU3A 4MX3A 4X64T 4YLHA 2YYRA 2E9XA 4GYSA 4XAAA 2AH2A 5CU1A 1BVVA 4Y5SA 4ZI2C 2RI7A 5DZFA 3I49A 2ZEYA 3ZYQA 3AX4A 1EY2A 3EI0A 1RUD3 1CZSA 1JS9A 2VZRA 4Q1RA 4ZPIA 1H8TA 2WMNA 4YVSC 4QQOA 4JLEA 2R062 1GYKA 1NA1C 4FP2A 4AEJA 2M13A 1VP6A 1MPXA 2VPEA 4ZDTA 5K0UA 4IV1A 4Q4V1 2YDEA 3ZC1A 3H3ZA 1HX8A 1KD7A 3DJBA 3DL3A 4LO7A 1U0AA 1DG6A 4AKRB 3B94A 3ZSLA 5LW9A 4CDWA 2QRXA 2PG8A 4XAEA 4A3XA 5IVCA 1K3IA 2VMIA 3V56A 1GKBA 1JZ2A 2DI4A 5FLIA 3ZYRA 3WG1A 5KR7A 4NVPA 4C1WA 4E7ZA 3VDAA 1I6ZA 1VJ2A 1O5LA 1WIMA 3N9MA 4NWWA 4KHZF 2OW4A 2LSKA 4H9QC 2QQKA 5FMCA 1WCDJ 1XSQA 5C4WB 2KMFA 2QZ2A 4WZ2A 3NJXA 3QACA 2X9HA 3OPCA 1HB4A 1PK6C 4YHHT 4U36A 4D6RA 1XOYA 3J9SA 2X9YA 3RH3A 2ES0A 3T2QA 1VE0A 2Q8OA 3KWVA 2YZ4A 3I0QA 1X36A 4FQZA 2M6IA 5LHHB 2WUHA 4P9WA 4V2VA 1US3A 2HKXA 2WZHA 5C4WA 2JMDA 5BR8T 5CBLA 2O8OA 3L1XA 4ASMB 4WM7C 3MK7C 3VDDA 4E2GA 3USUA 2E6SA 5AVPA 2CBJA 3VBUA 3KV9A 3HKEE 1W2TA 3CU7A 1AX0A 2HJIA 1VR3A 5JI9A 2FDFA 5SVIA 4Y5Z0 4P5YA 3OBZA 3MPBA 4A44A 3CX7B 2X0LB 2LGLA 3DTOA 3L3PA 2A71A 4P9JA 3S5QA 2W00A 2NQYA 3Q8BA 5H1VA 3HN3A 1LOFA 2X66A 1NAFA 5AQGB 3ZDSA 3UU4A 4E2QA 1TNFA 4ZXKA 3V0AB 4Q27A 2CBIA 4ASKA 2IC1A 5FY4A 3ACFA 3HL6A 2ZBJA 2DVFA 2RR13 2NAAA 3JQWA 1MNEA 3PE0A 4WVVA 2CWOA 4TLGA 4HN9A 5FYSA 1PX3A 2DVAA 3PL0A 3U4SA 4DEQA 2VR4A 2VQTA 1O6UA 2EVXA 2W67A 3ES1A 3AK0A 2WN3A 4JDNA 1E5SA 4AHWA 1GUIA 1AR92 5JXGA 4BXFA 5T50A 1PGSA 2HWF3 4LA2A 2YW8A 2ZM2A 2DCJA 1J1JA 1UMHA 4CI3B 3ZMTB 1XE8A 3VV1A 3K4ZA 4U31A 1DGWA 3WDYA 5KC6A 4JHTA 4IEPA 3H42B 4P9IA 3WNOA 4NAOA 5CGMA 2E6RA 1PM7A 2RJ2A 1D4M2 3N5LA 2B42B 3DQVR 3MI8A 1TMF1 5FZAA 5BY5A 3L2HA 2VTXA 5EIYB 4NPMA 1Q8QA 1WEWA 1BMV1 2MT5A 1Q8PA 3RC8A 3SFDA 4PIZA 5C2TA 4AI9A 2D3PA 5SVXA 5FWJA 3AE1A 4S2DA 2ZEXA 3WLUA 4HKLA 5AQFB 3GBGA 2VPBA 2J1VA 3FFQA 2BG9E 5IVYA 4YVWC 3BIEA 3THPA 5EYXA 1S2EA 5H1TA 2WBLA 4XCAA 4EN8B 1V9U1 4AQ6A 5LEKA 5HI0A 4DRVA 3JC6C 1RUE3 2CRBA 1C8M3 2DFCA 2PLV1 4CXXA 3SOLA 1XRUA 3FZ3A 1LR5A 4DXTA 1ASJ2 3ITQA 1WCQA 2E61A 4GXLA 1AX1A 4GH4A 1SPPB 4OUMA 2LAUA 2A3XA 2XLFA 2NN8A 2W5FA 3TKLB 1WMXA 4LBQB 4QDQA 4ILBA 4LBOA 4DUVA 4N7IA 4CEYC 5J36A 1YFYA 1GANA 2B8MA 5ACA1 2PFVA 2P3YA 4BWOA 3ZYIB 3LVRE 4A7KA 3VKNA 5F3GA 1CAXA 1T2XA 2C1FA 4AOCA 3SS1A 2ZZJA 5E88A 4UFLA 4OI2A 2W1QA 4DVDA 2WQ8A 2Y34A 1BVP1 1ND3B 3I3BA 4L99A 4KGQA 2XQ7A 4A41A 4V2WA 4J1XA 1LKNA 3OJAA 2RJLA 3A7MA 1XNBA 1X4UA 3GJBA 2HWC3 4XUTA 4I09A 3WX5A 3C4XA 3HT1A 2HWF2 5LASA 2XMLA 1LHVA 4OYUA 4W6XA 1WEVA 3WF1A 1XQNA 2DUQA 2EGPA 3C6WA 1U5YA 5FCCA 3HBZA 1FV2A 1XSRA 4Q0VA 4CCOA 4FPLA 2VECA 4K7JA 4BYYA 2Z6EA 4H9DA 4TWDA 5HCBA 4YTPA 4FJCA 2XAFB 1RUG1 4FOYA 4LUKA 3A0KA 3VBHB 4FTSA 4YHJA 1PMIA 3I54A 2LKHA 2RS12 2GNBA 1FMD2 2PMWB 5FZLA 4DV4T 4GMP1 4MH0E 3WF2A 2VULA 5CFDA 5CJ5A 1AYM2 3ZYPA 1JYXA 4MHRA 4AI6A 2R071 4XFCA 5A7WB 4Q4Y3 5D1KB 1DYKA 2W91A 2WM9A 2WZ8A 5FLJA 1EUUA 4N90A 3FEHA 3LSEA 5JDGA 3DPRA 4RYDA 2UZGA 4QB2A 3U37A 2X9XA 4NIDA 5LXTE 4AF9A 2SPCA 1O3RA 3NMBA 3QH7A 1X50A 4GNDA 3U5OA 2WMOA 5LMNT 4CEWC 5JIAA 2PQSA 5A7SA 4YZ1A 3AE2A 2WQ4A 2MD7B 3WG2A 4NIQA 2UY9A 3CIHA 3GZUC 1VBD2 5I93A 1FBVA 2TUNA 5DPNA 3LRQA 2AEZA 4YNIA 3TN91 3GGLA 4PF1A 4A7YA 1DU3D 5CFDC 4DMVA 4DR4T 4Q0PA 2FJDA 2M6MA 5B2GB 2W08A 4CPBD 4XUNA 2KGGA 2JECA 1NWMX 4RS5B 5GZEA 5ABJB 5F5WA 1W90A 2DDUA 2VL8A 5JAXA 4ZZ8A 4DUZT 3AKTA 4LUMA 2D97A 2XQ6A 2WBKA 2A70A 3M3IA 2WWVA 4CEYA 3ZKRA 1ST8A 3VBFC 2XVKA 4LJHA 4DIDB 1BCXA 2DVBA 5F3EA 2WC2A 2PLV2 4HLTA 1W05A 4WA6A 3RHWA 3NO8A 5JDFA 3ON7A 4HE8A 1GQEA 4QX7A 3IDAA 2CTVA 3HWJA 4YYOA 4NXMT 4IEOA 4WV8A 3MIBA 5JLVA 4DV5T 3ZSKA 1WMDA 1G73A 2RS53 2XQXA 5HCFA 3VRAA 3ZXLA 1X8EA 1R081 2YU2A 4Y5TA 2YBSA 5H9RA 3OEBA 4AFBA 4EXTA 3BUCA 1SUMB 2KWKA 5CG9A 4QGLA 2ZXQA 2JIJA 3LFMA 2RVAA 3ASIA 1VB4A 4A3ZA 4BHPA 5HEOA 1G9DA 2A6ZA 2XWBB 4UW5A 4MYEA 2BRTA 4GQ7A 3VHLA 4RN5A 2WDVA 5KHGA 3PVBB 2JXAA 4F52B 3M4FA 3TLTA 2XBO1 4QH4A 2Y6FA 4LO8A 5ABHA 5IATA 3QD6A 3LB9A 4FFGA 1D2QA 2I59A 2DUOA 5F5QA 5GM0A 5FO8B 4MO3M 2D0UA 4IL4A 2XG3A 2EXUA 4DS0A 2AXDS 4ILAA 2ZMNA 4JGZB 2Z69A 4LT5A 1QXJA 5A3NA 3SQOA 2BQPA 2BU9A 1CQ9A 3WSOA 5FXXA 4AAPA 4XFFA 3V5SA 1NCRC 2GDFA 2VNRA 2E53A 4Q0QA 2J47A 5C8CA 4YSYA 1DZQA 3PIJA 2Q1ZB 4CCEA 1SCSA 3CZUA 4OLLA 1SHZC 5HCJA 2WNVA 4DQAA 5ERLA 3N2KE 1NCQA 4C0HA 3O1MA 2BVLA 3R4SA 5AQUB 2W63A 3EHZA 1WBFA 4N53C 4TV8E 4QF3A 2DFBA 4YG6A 3BGAA 3VDDB 3T08A 1QJU2 3FLPA 2XUEA 3FL2A 1Z0PA 1QDCA 4HZFA 1RL3A 3SITA 3RC3A 1ZZ8A 3LQJA 1CZVA 3E22E 3ATGA 5ABJA 5AQNB 4RS5A 3BPSA 5TAOA 1MIVA 1YUDA 3WI3A 3U78A 3R4DB 5AQKB 5M4YA 5CFCA 3ZPYA 1ZZ9A 2WFF1 5FKBA 2AACA 4YARA 1WR6A 3AEFA 1IS4A 3D4KA 4FPEA 3E6CC 4JGYC 2VJEB 1ZBA2 3IPVB 3JQXA 1R1A2 5K3QA 2LTNA 1C5IA 3IHRA 3B13A 3TWIA 2VM9A 1PNGA 4ZU7A 4CN4A 2G19A 1H1AA 3M70A 1W2NA 3PJAA 3N9NA 3L8RA 1CESA 2VK9A 3EVYA 3OUJA 4B4PA 5LKZA 2OZ6A 5C33A 5F3CA 4RHV2 1HRV1 3ZXKA 1V6IA 3UUXB 1JYNA 2UWAA 1QH6A 1WENA 5JQGE 2VKJA 3PTRB 3PJAJ 3UESA 5ABFA 3O9XA 1K45A 1O4ZA 3IIAA 2GZWA 2M3HA 4YJ3E 1UZYA 4QPWA 4WBBA 1NCQC 1DFQA 1GZ9A 4NIAA 3U07A 2ZX3A 4NMIA 2PN5A 1JYIA 5A3LA 4NIIA 4LKEA 3ZO0B 3ZSEA 3CK6A 3AA7B 2BS3A 2J1UA 1W09A 5ANNA 3VD5A 3P3NA 3EB5A 2ADDA 5EZWA 5JZGB 3NQHA 1OEDE 1CHCA 2ARCA 2B45X 2FQPA 3MDBC 2D6OX 3WQ0A 2H0DB 1OLMA 1H30A 3RZKA 4O7XA 2KSRA 2YVRA 4Q0UA 4IEUA 2QQIA 4C91A 5EJZB 1OC1A 2WWJA 2ARBA 1Z0HA 2EXIA 1JYVA 3HEIA 2WDRA 5AQLB 1JODA 3LF7A 4FTBA 1PO21 1CAXB 1RITA 3R0RA 2HEWF 3VDDC 5IJRA 4F1PA 4BK4A 1XJAA 1HF8A 4ZS2A 1VYXA 5HYAA 1VBA3 4EYYR 3EB6A 1NX9A 4NO4A 2ETEA 4TYSA 2R1BA 3ACLA 1UL9A 4DXZA 2OXBA 3FB2A 4OI0A 3MFAA 3KMHA 4Q29A 5IHYA 2C24A 1H2NA 1N1VA 1S55A 4HK8A 2JD4A 4DR3T 2J1AA 3V43A 3MICA 1J1LA 2G43A 3ZTGA 1NENA 4O9GA 1M4WA 3WCRA 1W0OA 3POFA 1AR63 4IL9A 3GNEA 2W1UA 4I4TE 3LDBA 5GLUA 3M3ZB 4QXHA 3WDXA 1CAUA 2F4VT 2YREA 2X29A 4AI3A 4AEDC 4O61A 2AEYA 1YFWA 5JH7E 1LU1A 2IXJA 5FZMA 3VBRA 4AZZA 1RUG2 2P34A 2LALA 2E5LT 4QPGA 1STMA 2UWCA 3THTA 2QE3A 1KFUL 4R8PK 5FMDA 4DPNA 4LBKA 1SLAA 4ZU4A 2ECIA 4TWFA 2VNFA 2W39A 5LJMA 5FY9A 3VDCA 4NHKA 2WZR2 5A32B 1PZ9A 4LF7T 1OLQA 2LRPA 5FKCA 3ZMNA 3DUIA 1A34A 4UT5A 3PMSA 3CZJA 1QJFA 3L11A 3PHMA 1VRH3 3D0SA 3FMGA 4CDUB 3K1SA 1Y3TA 2GH8A 4G3YC 3OG2A 3RDIA 4EYUA 2BKPA 3CQXC 4WVMA 2XKPA 4Y1XA 2XQYA 1KF6A 2P2KA 2QGSA 5J2TE 3UT5E 5A3OA 4IV3C 4IXLA 2FZ1A 4HKWA 2ZMAA 2JM3A 5LBMA 2CM0A 2E7QA 3ZXJA 3WNNA 3IB3A 1MS8A 2PAKA 3LKJA 2JQKA 3ZMSB 4P08A 4A98A 3AECA 4DY5A 4ZXEA 1PMJX 2XLAA 3ALQA 3LEMA 5A7QA 2JMKA 4LQRA 2BBVA 1EAH3 2YDQA 4CUAA 2RP4A 2IXIA 4Y1UA 1RMU2 1DYPA 1U6GB 4EROA 3OGSA 2EICA 4GH4C 3UL2A 4XJUA 5JR9A 1QOOA 1C28A 1VBD3 2GSYA 2WS91 4AVTA 1L0VA 3ZNIA 1ZX5A 2O1QA 3R05A 5LWBA 3VR9A 1W8FA 3I97A 4KG0A 2W9XA 1BZWA 3JU9A 1LDJB 4FPCA 2XHEB 5KHKA 2BGOA 3RYPA 5DAVA 2BBAA 1FEWA 3PUQA 5J96B 2D40A 1JZ7A 2VQ0A 3EBRA 4JCKA 1RUG3 4X6QB 3JXSA 5FTTC 3VZNA 1WW5A 3N3HA 2W0GA 2CNAA 3M62A 4CDXC 2O8QA 3PUIA 2ZAHA 1ONAA 1HXS2 2YK0A 1PK6B 4RQPB 2YGMA 1HB2A 4QWNA 4LMKA 3AP6A 2YU4A 1RGSA 2A7AA 2HHHT 2JENA 3D5OA 4JYAT 3B5LB 2ZMLA 2V7MA 1E7PA 2Q9QA 1ENSA 2KE1A 1DYOA 1Z7S1 5ETWA 2Q9QB 4V1Av 5FOJB 5EYAF 1VMHA 4B29A 1R1A1 3IN9A 3O36A 3W20A 1F4AA 1CJDA 1PZ8A 4GJYA 4LFAT 4X1KE 3J7Yq 4AQ2A 1OQ1A 2V09A 4YM3A 2PELA 5HV4A 2L9LA 4QX8B 5DQ0A 4I7BA 3AEEA 4XTPA 2WAUA 5BNQA 4QHOA 5C3RA 1YIFA 4H9OC 3O1HA 3ZYFA 3WAJA 2W87A 1X4JA 3NZQA 2EXKA 2WO2A 1J1TA 3C4ZA 3K3QC 3TN93 4XJ8A 1QJX2 5IHRA 3AEGA 1PIV2 3N7JA 5EXOA 3RIFA 4Y33A 1QLBA 5FVKA 3AMQA 3VRBA 4OHFA 1C8M1 2OUHA 2K17A 2W2IA 4XTMA 3WF0A 3KT7A 2HEYF 3JD71 2FJAA 3WY6A 5CB4E 2Y6LA 3WW3A 3FM8C 1A8MA 3WNKA 5M0TA 1PVXA 3DECA 4P5HA 5FZBA 2TBVA 1QU0A 1V6OA 2VQFT 4QHBA 2D7FA 4R52A 4XZUG 1YLLA 5I0DA 1WW4A 3JUUA 4ZONA 4CDXB 4CCCA 3IMMA 3JAEA 5FNVE 4J25A 3QNUA 4FPKA 2VB6A 4HFCA 1RUH3 2HWC2 3D82A 1W0PA 4R9DA 5FMOS 2G6QA 3O7AA 3BOPA 1XE0A 2XQ8A 1LECA 2LRIC 3S7EA 5AQPB 2CE7A 1H4HA 3AP5A 5GZDA 3RX6A 2BJSA 4DO0A 4NXNT 2FMDA 4Q4V2 3VBUB 3AJYA 4ZZCA 2LT3A 1QMJA 5DUWA 1RUC3 5JVVA 5B79A 2XPKA 1B35C 1X9PA 3LJCA 4IV1C 2VW2A 1MZEA 4AGVA 4Z82A 4XE9A 4AP4A 5FB0A 1AR62 1SE7A 2VNOA 2RDRA 3NWKA 2PJQA 5KH3A 4FO9A 2CY6A 5EP9A 2KFTA 4YW2A 1VMJA 3OPWA 4BHWA 2V7JA 2XB6C 2UXBT 3POGA 1VAKA 1CONA 1VBB2 3PUHA 2ZM8A 4LF6T 1RTVA 2NTXA 1ZZ7A 2VOWA 3ZXGA 4Q4W2 4YBSA 4QGNA 4QPIC 2J7MA 2XXZA 3Q8FA 3ZYKA 4COZA 3UUNA 3I2IA 1ENRA 1ENXA 1VAVA 3D8CA 5KHJA 1W03A 3N9QA 4PAGA 4LNVA 5BNPB 3GHMA 1J58A 3NJYA 4IDPA 2R072 4MXVA 2D5HA 5FZDA 4BLJA 2UU9T 1FOD1 5IVBA 1HIXA 2TEPA 3T6RA 4MGYE 3ZN5A 4A2UA 5CEHA 1MZFA 1ULFA 3THCA 5FAXA 1RUE1 1ACCA 3SH4A 3ZOIA 1CN1A 2A73B 1HX1B 4HONA 2V6YA 5FP8A 3T4VA 4JUYA 4COWA 2VZTA 2VJEA 3ZN4A 1NYWA 4JI7T 1POQA 5FZ7A 3T2TA 4PQ9A 5B77A 2ZX0A 4LHLA 2XAGB 3GBWA 3TEWA 3WXPA 3M1HA 1Q8VA 3G7DA 3IZOA 4ZI3D 1BK0A 1G25A 4MG2A 4JI2T 3PDQA 2A3WA 3F2ZA 4JI5T 5G0FA 5BYNA 1GNHA 1QEXA 1QQP1 3MPPG 4TZ4C 2HWB2 4MOAA 1WLDA 3HTKC 1V9DA 1HJGA 2DBNA 5H1UA 2YT5A 3ORJA 2IVJA 3IDBB 4XI1A 2H7OA 1D2SA 2QVSB 5A7OA 2R042 1MQTA 4AQYT 2VMHA 2JUNA 3CIRA 3O1OA 2E31A 2WT2A 2Z4FA 2V72A 2E26A 5ADXL 2OX0A 3AYCA 2CWYA 5AQSB 1WESA 1JZ3A 2YFZA 3Q5EA 3ACHA 2RS31 1O5UA 3EXUA 2QDNA 1ZBE1 2R49A 4CPBA 3N9LA 3M7KA 2VOTA 1JNRA 4YGDA 3S4UA 2WZR3 4BQ2A 4XDQA 1X9BA 1PVC3 4OI1A 1W04A 3VBSA 4MGKE 3IDCB 3MIEA 2CGPA 1GNYA 4XMIA 4MALA 2EIBA 2N1GA 4L0RA 1DQ2A 5DUVA 2D93A 1RUH1 4N9IA 1V9U2 4LF8T 3Q5WA 3BYWA 2BGPA 3ASLA 1WEEA 3A0NA 1Y9MA 4XZPA 5JWPA 3SOXA 2CPTA 1CIYA 2CWMA 3HA4A 5F5IA 1RUI1 4X6RB 2QQOA 2W92A 4MUVA 1TQ5A 2H0DA 1WEPA 3LE0A 4IDZA 1UN1A 4JQRA 5FZIA 4LF9T 1LHUA 3O37A 1KITA 1CAWB 1OA2A 1ZBA3 3UKTA 3V0BA 2Q0AA 4AG4A 1GQHA 1ND2A 3ONLC 5DAWA 4PLOA 2IXHA 3DN7A 5DJQC 3NZPA 1ZVFA 5A3MA 2YSMA 3HN1A 2W0XA 3N36A 2W62A 3LK3B 1TZOA 3CJIB 4X20E 4K0UA 1UW8A 1V6NA 1ZZ6A 2WSSV 4L7XA 5L3EB 2K0GA 2MA5A 2LHRA 2R043 3M3QA 3RZJA 2OVUA 2Y6XA 4MGQA 4A6SA 2KM2A 4GMP0 1IS6A 1S0FA 1HB1A 2A3YA 3ZR5A 4UF0A 3C7HA 1BBT2 4XBQA 3MIHA 1F15A 3PMEA 1Z6UA 2V4AA 5B75A 5FZ3A 3SISA 2GC3A 4IUGA 4EZ4A 3NKGA 1GOHA 4K6BA 2ZM0A 3NL1A 4DXRA 4OYKA 1W6PA 4KWJA 3N9OA 1AR72 1TVGA 2XOMA 3V65A 2CL2A 3EDUA 2FBWA 1ENQA 2KA3A 4BE3A 1WYCA 5EJ1B 5JOZA 1S0DA 5FB1A 1PK6A 4QM9A 2K9ZA 4LIUA 4I0WB 1D1CA 5KXCA 2Z2SB 2VXJA 4E9KA 5L7OB 2NP9A 3I59A 1ULOA 2QZ3A 4AQTA 5I91A 1NT0A 5A32A 4Y4YA 2XQ5A 4JDMA 1OD5A 4CEYB 4P00B 3RJRA 4LMFA 2D2SA 3WAKA 5DABA 2BVMA 4XURA 2CKLA 3FXDB 1GU3A 2J1SA 5A6XA 5EPAA 2LSYA 3ZLIA 5EK2A 2QNKA 4D8MA 1UXZA 5K8SA 4LBMA 4NN0A 5IYZE 3VZOA 3SKVA 3TLSA 2WNVC 3UK9A 1YQ6A 1U12A 4XIOA 5FZEA 3HR9A 2VVFA 3K3OA 3FBYA 1X8MA 4YW7A 1KJLA 4U7IA 2OZJA 5L3DB 5HEUA 1R083 1ZRCA 1XYNA 1RXGA 5KXBA 5D21A 5JSOA 3APBA 1OUSA 1KEYA 2UYAA 2BTVC 1IKPA 3S57A 1DZTA 2XVGA 2ZTNA 1W6QA 1H9PA 4JX0A 2VY0A 4L92A 4KHPT 2V5DA 1VBB1 5BV6A 4DNDA 1WEQA 2GK9A 3FZFB 1VALA 2VCCA 4ZZ5A 5BMVE 3ECQA 2W1SA 5BNNB 5JDBA 2YC0A 3FZKB 4FFHA 4M3CF 2QIZA 3AEBA 2K5BB 5IVFA 4Q26A 4NWVA 4URTA 4UFIA 1NLQA 1PO23 5I0TA 4K3UA 4MZUA 3GALA 4FPJA 1LVFA 4QKFA 5JZGC 3PUVF 1NXMA 3U1XA 1Z60A 1D4M3 1HNXT 3V5UA 4P02B 2V6YB 4BQ5A 2RE9A 1W6NB 3VD4A 4A45A 1RC6A 4FFIA 2MAWA 5JIUA 2X51A 3AZXA 4QQPA 4LE3A 5E89A 3UNPA 3LBXB 2JE7A 1IBKT 1V6MA 5LHIB 2RDSA 3FZHB 3ZN6B 1RIRA 1EPWA 1PO13 2F6JA 2F6BA 3T4HB 2L5UA 3OBAA 1RUE2 2Y8KA 4DR2T 2X67A 4IREA 4UFMA 5JDMA 4YW1A 2WQZC 1WUVA 3RGBA 4CCMA 2DYCA 4TN7A 2YURA 3QOPA 2JB4A 4P5OB 1AF9A 5D1IA 2JIGA 2XHKA 4J2CA 4Q4X1 2YC2A 4IDOA 1OF3A 2Q9QD 4PPEA 3H1WA 2BWAA 1SFNA 3H8XA 5JMCA 4YW3A 2LSIA 1LKXA 3KSCA 2D0TA 1D1BA 3H8RA 2NP0A 4HKAA 1IQDC 2R073 4YVSA 3KNVA 1MS9A 4MSXA 4XJAA 1OXCA 3B93A 5LY2A 1YHFA 4QKNA 1F31A 1AHSA 2Y43A 1HRI2 4GALA 5C9AB 5LMUT 3IPVA 2LDRA 2JICA 3WNMA 5H9MA 3ZM8A 1T7SA 3IWZA 2WZPP 3LA3A 4CZSA 5F37A 2BG9A 3K46A 3ZFFB 2B39A 3T1LA 1JYWA 4MBQA 1MMDA 4N53B 4XF3A 4WM7A 2OA2A 2CHHA 5AC91 2JKXA 1EUTA 1S2KA 3GCWA 2BNMA 1NUKA 1GZTA 5AQVB 4JBWF 2XY8B 5JTGA 3QB5A 2W47A 2IXCA 4D7YA 4DNYA 1NE6A 3W58A 5FFOC 4F83A 5C5UA 5L3CB 3MIGA 2ECWA 4CXWA 2RHPA 5T54A 1S0CA 3OD4A 3RPQA 5GLVA 3WDTA 2RR12 3NAPC 5GONE 2BS2A 4Z8BA 1XNTA 2XVLA 2XGXA 1YFXA 1AZDA 3WHTA 1PO12 1PIV3 4TZDA 1ZM1A 3HD8B 4IEQA 4HETA 2GMEA 4GKXA 2RDQA 5C4WC 1MS4A 1LNSA 2VOVA 5E6HA 5DQWA 4CA1A 2J62A 1ZBDB 2HPLA 2KZ7B 1G9CA 3UETA 5L7OC 5I8SA 3ILRA 5DKAA 4HKOA 5HWYA 4FPFA 1V87A 4RFRB 4HTEA 3AYDA 1WCKA 2R7EB 2LUWA 3X1DA 1ZOYA 2DJAA 3ZPOA 4MLOA 4R8HA 4LIVA 4OCTA 3RWNA 4MXWA 2VG9A 3HJRA 1IKQA 2PHDA 5JR9C 1CAVA 1DQ0A 3AMPA 3BTAA 1FT9A 3PLQA 1POV3 4GD4A 4KUMB 5J98B 2KD7A 3KCCA 1DQ6A 4FPHA 1ALYA 2KGIA 4FPOB 4LOTA 2M67A 1OPMA 1NZIA 3SHBA 3SMHA 4YJ2E 1XWHA 4GJZA 3MBWA 1KJRA 5FYCA 4AFCA 4X66T 4UI9L 4H3WA 2YQLA 2ILMA 4ZS3A 2YBKA 2JRJA 3UU8A 3ANWB 1UKGA 3UGFA 5L19A 1H9WA 1BR4A 4YY3T 2XL7A 2YUEA 2Q8EA 2P37A 2V26A 2F4PA 1ZHCA 3E6BA 3VBFA 3SXWA 4U72A 4FI9A 5LATA 4JZRA 4JTNA 1RUNA 3LEGA 4HANA 1SDDB 2HBUA 4YZ3A 3ZMVB 3K4DA 2VKHA 1WCRA 1QJU1 1PZ7A 4O64A 1MS0A 4WM8B 3AE4A 4ARXA 4OQ8A 2ZCWA 3P4WA 1VB2A 4AYCA 3PV0F 1DVPA 2ZJCA 5JMOA 2VAUA 2Y60A 5C7GA 2LW8A 2JDAA 4U2AA 3NG2A 2X8KA 2A2FX 1XNCA 1NLRA 4A4BA 4G4FA 1YKHB 2ZGKA 2I0MA 1Z2QA 3SEEA 1YQ2A 1UF2C 1MMNA 1FNYA 5IWAT 1XYOA 4CN1A 4JGZC 2XQAA 3B69A 3HPNA 2RM22 1WLTA 3RWKX 4PW8A 3ZC0A 4Q25A 4U7YA 2V73A 4ZXLA 3RQWA 5FP9A 5A3UA 2P3KA 2KIZA 4HSJA 4DRRA 2X05A 1H2KA 1SQ4A 1HV1A 4L0PA 1DGLA 3BVCA 2DWGA 1BBT3 1G7YA 2KKYA 2XBO2 1XNAA 3MW3A 4NR1A 4YFSA 3MHSA 4KWLA 5AQRB 2BDEA 2YKSA 1GZCA 4CUBA 4N78D 5HEHA 1VBE3 3QC9A 2CDPA 3POYA 4O4JE 3KHBA 1W8NA 4XABA 4JEHB 5I0RA 2N7GA 2QQUA 5LK7B 3UJQA 3DKWA 4OHWA 1UKRA 5IFTA 5AFBA 4W6WA 2QQJA 2AE9A 2PUYA 5J7MA 5T5JA 3P4PA 2VMDA 1QNYA 5G04L 3AE5A 5CKQA 2FHRA 1GQGA 5FV3A 3DXTA 4HG6B 5SV5A 3RG0A 1J83A 3EAMA 4HWIB 3WQ7A 1K5MA 4BAYB 4GK5E 3O1JA 4IE0A 4I43B 4P9XA 1DQ5A 2E9XD 1TMF3 4MV2A 4QXKA 4QPGC 4UFHA 3E08A 4AYCB 3GZEA 3T7LA 2LEHA 5JDLA 3MUY1 5GLZA 3M65A 1IBMT 4EWDA 1T72A 2VZOA 2H0VA 5A7PA 4AK3A 5LA6E 1N3OA 4KU8A 3O0XA 4B7KA 4IE4A 3ZR6A 5T5PA 3ZVZB 2VZQA 3W21A 2XH6A 1JU4A 1YFUA 2OWAA 4UYBA 2Z79A 3JB4C 4XIKA 2V7IA 2XQ3A 1YQCA 3J9X1 4XCBA 4CDXA 4PT6A 2K1JA 3GF6A 4D94A 4FOQA 1DZRA 4CI1B 3VBHA 2A6VA 2P3JA 4ZI7E 5GJ6A 5HBAA 5AFUL 1HCIA 3SC7X 4CU9A 4JI4T 2I6HA 3VL8A 4XACA 4HXCA 3Q8EA 2WJSA 3AP7A 4M3CB 5KMGP 4FXKB 2AR6A 4TNVA 1UU4A 4L11A 1SFPA 4BU2A 1HRV2 3LOBA 1JHJA 4LKAA 1W0NA 3KS7A 4D7SA 1XU1A 3VU7H 5I8YA 4ZI3C 1KK7A 1RJ8A 4BK5A 2C5DA 2JQHA 4CU7A 5JREA 3WQBA 1CUNA 4HVRA 5FL0A 2HH9A 3NVCA 2GNMA 2VL4A 1Q5OA 4EN7B 4HFEA 4AR2A 2MKEA 1FMD1 3MZKB 4Q4Y2 2RMU3 4FBFA 3POIA 1UYPA 1QY4A 4N7UA 4DV2T 1SBEA 5IVJA 2V7LA 1REDA 3E6DA 2OPWA 2CSGA 5L3BB 4RGKA 3VL9A 5T5LA 4ZHQE 4LADB 2HDPA 2RS13 3Q8AA 4AGGA 2ZABA 4DR6T 1VBE1 2CXFA 1G8XA 3R6NA 2MPKA 1MS5A 2BGCA 4AKHA 4COVA 4A97A 1IG0A 4CA9A 2VPGA 1TMF2 4N43B 1UMZA 1QIQA 3ZYGA 5FP3A 5L4HA 3F2EA 2R1DA 3WT3A 2GP3A 1UD1A 1XB9A 2Q8CA 5FZFA 5A1FA 3H7JA 3AMMA 1VFYA 1O3SA 3O1RA 2JG9A 4IETA 3L09A 2EHOA 3I3DA 4FAGA 4B3NA 3OEAA 5I0SA 2K2SA 3LPFA 3J8F1 1AL23 2LROA 4YBTA 4A4AA 2WS93 4B3ST 2CHNA 3OGVA 2BS4A 5LKTA 2J1TA 3KVAA 2BPA2 5FPZA 2B76A 4PF5A 2D5UA 1WA6X 4CTEA 1W0BA 2DV9A 2X0YA 3T3YA 2RS32 4XETA 4CZZB 3K2OA 2LN0A 2OLTA 5FP7A 4ATFA 2BZDA 1ND3C 3HCUA 2C9KA 2UXCT 5F2WA 3OTFA 4E7SA 2P5BA 1XYPA 4Y20B 5C13A 3LZZA 5FZ9A 2W68A 3IAPA 5FKYA 4IEZA 3RI8A 1FJGT 3UJOA 5FL1A 2PLV3 1UO9A 5IAXA 3WD5A 4B7YC 1CAVB 4AW7A 3LDYA 3DEMA 1Q3EA 3VBOA 1C57A 2B5HA 4DIQA 4XFHA 3NW4A 3MV01 1XWMA 2WNVB 5FZ0A 4UXAA 3IKWA 3S30A 3VBOB 3H3UA 4MGSA 1DDLA 4XUQA 4KL1A 4UOJA 1C8M2 2EF6A 2VZSA 3T09A 4ZHNA 5FK7A 4DUYT 4N3WA 2IZWA 3RRWA 2E8IA 4LF5T 1ZZCA 3J7LA 1WBLA 2CXLA 4ILUA 4IDNA 4PK5A 5FJHA 3E5UA 3UFEA 4IEWA 3UV9A 1LGCA 3UQ7A 4JI3T 3HKBE 3WG4A 1OQDA 4UAPA 4XJZA 2YPJA 5GLWA 4DR7T 4IC3A 5A6ZA 4UBHA 3K51A 2JG9B 2FZ2A 3OGJA 1T98A 2W66A 5LJNA 3HCTA 2VJFB 2ZGOA 3WDUA 3WNPA 4Q1PA 1BR2A 2PHTA 2BG9C 3FZMB 1W0AA 3ZJ2A 5K4LA 4QDSA 3NV3A 3B5MA 2VASA 3VD9A 3WDWA 1KXGA 5C8WA 4ZOLE 4CSWA 3ABVA 2F42A 3SWHA 1ZEEA 2WZR1 2L9QA 4AQGA 1OD3A 5HV0A 5LK5A 5F32A 4LFCT 1LHNA 4NRPA 1D0HA 4AVSA 2YN6A 2P4EA 1VBD1 5J3XA 4TUYE 5ABEA 3ZDVA 5LGTB 1X7NA 3EYPA 1EPZA 1KQRA 2G45A 2YU1A 4Y1YA 1NY72 2CT2A 2VMFA 1RUF2 1GP4A 1GV9A 3ZFFC 3NKZA 3BN6A 1O4YA 2CLYB 1H6YA 1COV3 4EAHA 2M6BA 1OMIA 1AR81 2P9BA 4ILCA 1FATA 3L2YA 4YZ5A 1WEUA 5DG2A 3AKSA 4P14A 5CIRA 3JBG3 1RVF2 4QXHB 1DLLA 4XXAA 4QQHA 3JCFA 2XASB 2NM1A 2WAOA 1DCQA 1XMOT 2E7TA 2P6HA 4QQ2A 3CLPA 1UX4A 4X1IE 1V6JA 4NOTA 2PAEA 3BTYA 1AXYA 4CQIA 3ZFGA 4PJNA 5J1XA 4KMCA 4K20A 1PHMA 4M3CE 4LTAA 2WKKA 4QF2A 4WNKA 3TYJA 4EN6B 1UZZA 4Q8KA 2NTYA 4CVUA 2ACXA 2ZZQA 4P9YA 2OPKA 1VRH2 3ZYJB 4O4LE 1ZREA 1LVKA 3TEYA 4TV9E 3GM8A 1O7FA 1VLNA 4XOGA 2XJ7A 1MVEA 4O4HE 4QXCA 4PBPA 4AFAA 1OEDC 3SNMA 5C11A 1JOCA 4YVSB 3OYXA 4AL9A 1S1AA 3AM2A 2OS2A 4C90A 1MS1A 5KXEA 2JJ6A 1W6MA 4K21A 1PGW1 5LP6E 3HVDA 2DTWA 2WZEA 2UXDT 1UQXA 3ZIXA 1H8TC 4KG8A 2VNVA 1ZRFA 4NHLA 4LLFA 3NRYA 2NW7A 3MEPA 4XAXB 1PO22 1OT5A 3C50A 5LRRA 5HXHA 4GNGA 1N3PA 1LOCA 2XWJB 4CDQB 3ZYBA 3L1ZB 5JDHA 3QK6A 1Q8SA 3TLUA 4JVAA 2MBGA 3IMNA 4GKYA 1N1YA 3VBOC 5DXDA 4NHXA 4MLKA 2DHRA 4DV0T 1CJPA 3OYWA 3ZXFA 3ANWA 2MEV1 5B4NA 1YQ3A 2VVDA 1XZYA 5KH9A 2CKLB 2HWF1 2VUAA 3M2MA 3VDBA 4WZ3B 5HXRA 1YQ4A 1I5ZA 1CWPA 5DQVA 3ETPA 4OFZA 2LOSA 2IC9A 5IK7A 3I59B 1FPN2 3VBSC 1GWLA 2YG0A 1ND3A 3IDEA 2KKXA 1NZCA 5EWSA 5FYYA 3JD72 3PUWF 1BKZA 2VUJA 4K8FA 4I0BA 3DYOA 1SEFA 1LHOA 1TNRA 1SFYA 2ZA9A 3RIUA 2CSVA 1U5XA 4NN2A 4XXPA 3RI9A 1K2FA 3AVSA 3PLWA 1JW6A 3L39A 1WE9A 3S5AA 2QTWB 3PIGA 1V00A 5LKUA 3JAFA 1OURA 1RHI2 3T1HT 5CISA 1YC61 2XJPA 2XOZA 1EV13 1QJU3 2Y1MA 3EO6A 1BORA 2FCTA 3BQIA 2AGSA 2J1RA 1WRDA 5TDWA 1BHGA 4BLIA 4I55E 4NUUA 2KWNA 5C3JA 1IG3A 1XNDA 3ETVA 4CCKA 5T3NA 2VCAA 4C0BA 5AQOB 5BUVA 2ACZA 3NAPA 4H9RC 1QOSA 1JUHA 4OYJA 4BOWA 1LOEA 4KI5M 1MIWA 5BNPC 3USSA 2A6XA 4B3RT 3PHDA 4EEBA 3J7NA 3WEZA 1HNWT 4RL7A 1AVBA 1W28A 4XBFB 5L7OA 5CNAA 2XLGA 4IL7A 1XC6A 1LCLA 3PUZF 4HT1T 4L9BA 1L3JA 4RA0A 2YXSA 4E27A 2A6YA 3U5MA 1ND2C 2Q4SA 4B86C 2HLEA 2JQ9A 5JI7A 2LQ6A 1RYYA 5FZGA 5J2UE 2ZS6B 1W6OA 4QX7B 3I2HA 5C70A 1JOJA 3ZPVE 4YM1A 3AKRA 5IVEA 4RQPA 3CMGA 3BQKA 1AR93 2RA1A 4HWDA 4DINB 1GNZA 2O14A 5LBCA 4UW3A 4AI2A 3VK6A 5H9QA 2CSZA 2XJSA 2IUWA 2VCBA 3CJIC 2OT7A 2P17A 4KGGA 3C8XA 4CEWB 4LA3A 4WBOA 3UU6A 1O59A 1LENA 5FZ8A 2ES3A 2XOYA 2G9FA 3T8OA 4QPIA 2EIDA 3A4UA 3ST7A 5KWRA 1C8NA 2NMOA 4IEVA 2V6XA 4H9SE 1MS3A 5LCWL 5FYBA 2IFRA 3GJAA 1HV0A 2XAHB 3AZYA 5JR9B 1LDKC 1W8UA 4OGEA 1JH5A 3VZJA 2YQMA 4ARYA 1AR71 3FUOA 1OSGA 5C71A 3AA1B 1S0GA 3RGLA 1VBE2 4IERA 3KZ4C 2ORZA 2VTFA 4Z1VA 1HXS3 3K4AA 3UFGA 3O5SA 1F4HA 1VBB3 2W1WA 1OHFA 2DVDA 2KNDA 2RS33 4BJNA 1JMUB 5I0UA 3RSJA 1LU2A 5LBFA 3AE8A 5CA1E 1N34T 1X79A 4JI8T 4LITA 1RMU1 4HPKA 3KDEC 5JSRA 1YRZA 3MF6A 5C9AA 5LBEA 4AHZA 2WSVA 1VAMA 3ME2A 1SACA 3RYRA 4PLNA 1ZNPA 4XQ4A 4LLBA 2MNZA 1KFYA 4UP5A 1WILA 1O3TA 4HN1A 5HWXA 2B7YA 5FXWA 1UOGA 3ZFFA 1UZVA 4I01A 4XFBA 1VBC1 5F5AA 3IHPA 4UBGA 2R32A 4BDVB 3OSDA 2DX8A 2RSDA 4E4DX 4PI0A 2KYUA 4WYVA 4JI1T 5C3QA 2CA5A 3T30A 2IUBA 2C26A 2H7VC 1OA3A 3IIIA 2VQET 1BYHA 3GN5A 4PK4A 3E5XA 2HWE2 4LHNA 3PVOA 3ZYMA 4ZKTB 2PQQA 4CU8A 2DF7A 1VRH1 3K8PC 4R4ZA 2RDNA 1T6BX 4BH9A 3DPLR 2IC6A 2P6CA 1SLLA 2ODUA 3FL7A 1ULDA 5AQQB 3AMNA 3M3OA 1BQPA 4UI9B 4W4UA 3POEA 2YHNA 1RXFA 2IQJA 4X65T 2YROA 3ZYHA 4A49A 4E4HA 4KQ7A 1DQ1A 2BFUL 3FZLB 1JOPA 4GZ9A 2JDNA 5LY1A 4DR5T 3ZXDA 4X1YE 5LZ6A 2Y1NA 3TB0A 2UUCT 1NXD1 3A21A 3AYEA 3GBFA 1NKGA 5EV7A 2DVGA 4QXCB 3D0JA 2WABA 3O70A 4GH4B 4DMIA 4Q4W3 4HPKB 4PIYA 1MEC2 3SH5A 4WZFA 1WW6A 1BXHA 3K77A 3JBG1 3I2JA 3FBMA 1JN2P 1J3RA 4IIJE 4KP3C 3LPGA 2JG8C 1GFF2 1W99A 4AVXA 3C7EA 2PHWA 5FYMA 1FX5A 4OQ9A 2CSYA 3VBHC 5FPUA 4LKSA 2JG8A 3KV6A 5APAA 4XQDA 1VIWB 1OH4A 1ODNA 3RRDA 3P6BA 3RKGA 2FD4A 2ECNA 1ASJ3 3HKDE 2R0HA 4AHYA 2YPDA 4GIWA 4LR4A 3JCIA 3I3MA 2IDAA 1N87A 5JDQA 2CONA 4NPLA 4XYXA 1K42A 3WP6A 3CWZB 1CHUA 2Y48B 3PUSA 1YJLA 3M99A 5JOWA 2GN3A 2UU8A 2LE8A 3WR0A 4AFMA 4MHUA 4BQ1A 2OA5A 4K1ZA 1XNRT 3AZZA 3F95A 2D6PA 3INAA 1DGWX 2ET1A 3T0DA 3GHNA 3RTRB 1HN0A 3WF3A 3GDBA 2VXRA 3L9JT 2JPFA 4Z2AA 5J0ZA 5T52A 2VQUA 3CQOA 1LODA 1HNZT 5GALA 5HXSA 3R4UA 3RPGB 1AR91 2LS6A 3VHNA 4XW3A 3JUEA 2D44A 4KI0F 5TABA 1AYM3 4OUEA 4GK0E 1W3VA 3AE3A 3NNMA 3I2KA 3AL6A 1UK5A 2RM21 2ZPXA 4NUVA 1BEV1 2KREA 2XQRA 3T1YT 5I8TA 3FWEA 1JZ4A 4MGTA 1UWWA 2ZEWA 3VHOA 2B0OE 1CZTA 4Y22A 2XHNA 4QX2A 3DGTA 2FUPA 1QXPA 2CU5A 3MW2A 1QJZA 1SDWA 2IMLA 3KBTA 1JOBA 1UOFA 5FVLA 4N8MA 1E5IA 4AQFA 2DTYA 1DLCA 1AR73 4FPYA 4EIWA 4GKKT 2C9AA 2WFF3 3N2GE 1N33T 5HCMA 1OVPA 1IPJA 4GAZA 2DCYA 4HVOA 1D0ZA 1T8BA 2JMIA 4N4FA 2JIWA 5G05B 4X3GA 1XNKA 5CKNA 4N43A 3H3LA 3RMYA 2YV8A 4QX8A 2ADEA 5LA2A 2VVEA 4R2YA 1PO11 4EZHA 2C0ZA 2FCUA 2YMZA 5EJ3A 1Y01A 2D3SA 1MQTC 1HQLA 5JOYA 4XBLA 5DDJ3 1ND2B 3WF4A 2MNYA 2BZBA 2L0BA 5DN2A 2W46A 2IDOB 2P3IA 2WAAA 4YTMA 1CAWA 2BFUS 2RR4A 2KR2A 2A75A 3NV1A 3H8OA 3T0BA 3PVNA 2QJVA 1QSDA 4LFBT 4UWDA 3WNXA 3CJIA 3FHAA 1GWKA 5FYTA 1J5WA 1E2AA 1EZ3A 2ODVA 3O0VA 1J3PA 1GBGA 2HYED 2SBAA 5F5CA 1O3XA 2EALA 3Q8CA 3RIAA 1MACA 3FHQA 4K1YA 4GIQA 5JR2A 3ONJA 1DCSA 4YATA 2Y6KA 4N9HA 4WZCA 3O1UA 3ZMOA 3AXEA 3MF9A 5FOBB 2K16A 4QMAA 2H3RA 3AXDA 4Z2WA 4Q2FA 4TWHA 3EHKA 4COUA 2MUMA 4YZ4A 4HK9A 3LIGA 2VPVA 3I9WA 1TG7A 2VKOA 3WV6A 1VCSA 3OD0A 4LMJA 3RPUA 5A7WA 4FQ4A 2BNOA 4H9NC 3LDQB 2VBBA 3EB7A 2WA4A 3U14A 2NMNA 4QM8A 4OUSA 4PJJA 4QX0A 2RS51 5FZ1A 4H2AA 4ZEYA 4PTBA 5FZHA 4LOSA 2VP7A 4WM7B 3A22A 1CPMA 3RS6A 1XMQT 2MTQA 3CVRA 4JTOA 2JDUA 3J8F2 3K3NA 1C4RA 5GZCA 2WN2A 3ZVXA 1QXRA 2D6LX 5ANQA 4NIHA 5E8AA 2MEV3 4P0AA 1YCIA 2EHOB 4CI2B 3X29B 2NYYA 2DWRA 2RPAA 5DDJ2 3V0BB 1MIYA 5FERA 4YTNA 4O8SA 4AEDA 4R7EA 3LSVA 4B7EA 4JEUB 1YIPA 1BK1A 3WZ1A 4AI1A 4NUBA 1UUSA 4OK0A 4XDPA 2VOXA 3CMLA 2MYSA 4C8DA 3AE6A 2DCTA 1U5PA 1OWAA 4FJOA 2C2LA 4W8JA 4Y1VA 2JDZA 3TEXA 2W94A 2XPJA 1FOD2 4WBNE 1RUJ2 4A42A 4PIXA 1LESA 1VD4A 1O91A 3AAIA 4HMZA 3OY8B 3ZIWA 3SOWA 1DP0A 2CMRA 1ZRIA 2Y6HA 3SCHA 1JTZX 3RYIE 3JB8A 1CX1A 4L5GA 1A78A 1COV2 2VQAA 1PVC1 1X33A 1JZ8A 1WEMA 1YW0A 4CP2A 3Q9DA 2LXHC 3RI5A 2WIIB 1QJY2 3C64A 4AE2A 3C7OA 2WRAA 1AL0G 2AZ5A 4D0QA 1Z7S3 4LF4T 3KGZA 4H55A 4QPGB 1DF0A 5AVAA 3LK42 1JM7B 2EGMA 3UTKA 2NR4A 2GC2A 1ODMA 2ZEZA 3IEEA 3V64A 1OFNA 3C51A 2V1DB 1IJ6A 2LM2A 4KWUA 1AXKA 2G9ZA 3GL6A 2DCZA 3IT8A 3KCXA 4ISQA 1REEA 2BEOA 1NE4A 2WNEA 3PUGA 4WVWA 1S35A 3BI3A 1J5ET 4AAXA 3DDTA 1JUIA 5FPVA 2CAUA 2JDKA 4BIOA 4CP0A 1VBC2 5B78A 2Y6JA 3MIDA 4I7CA 3FJSA 1AJ3A 5H9PA 1JU3A 1OBNA 4XC9A 3F57A 4FIPA 1BMV2 4ZI2D 4ZY9A 2I07B 3O1IA 1JZ5A 1YJKA 2FDJA 4UFKA 1Y7BA 4BB3A 1UX6A 3OOXA 2NW8A 2E33A 2YGLA 5L36A 1HQNA 2CLYC 4C1XA 5J1GA 4ORFA 1WFKA 4QPYA 1NEKA 3BTXA 5HPOA 4COYA 3RZGA 1LOFC 3HQUA 1RMU3 3RQUA 5CFDB 5A6YA 2Y8DA 3HKCE 2K24A 1SBDA 1AYN2 3MJXA 4PJMA 3QBQA 3BCWA 2Y38A 4ASLA 1FMD3 4M0NA 3HQXA 4CE8A 3GA8A 5A80A 3N2OA 1UZ0A 5DAPA 4M4RA 5FPBA 3ES4A 2BVBA 1D0YA 5A70A 1NCQB 1W8HA 2MA6A 3ACIA 4QD2A 5LG3A 5FZOA 4RR3B 5AQHB 5JG6A 4UEMA 4QGMA 1ZA7A 2J1EA 4BQWA 4IDQA 3KQ4B 1M62A 3AB3B 5DG1A 1SPPA 4WM8C 5AQJB 2V8SV 3SHRA 1BR1A 1Z78A 2QQVA 5ABGA 1URXA 5FZKA 3WP5A 4OHZA 4X5TA 2G4IA 3AVRA 4FOVA 1BLZA 2ZKNA 2HWD2 3PNAA 2WDBA 3LK2B 3TLVA 4AFDA 2EA6A 3SEPA 4H9PC 5FQ0A 4I2OA 1UIKA 1YI7A 1HRV3 1UPSA 5TDRA 2OKXA 2ZGPA 2LRKA 1YXWA 3AA0B 1AJOA 1Q43A 4YM2A 1EP0A 2WNUB 1H0BA 5T55A 3B9IA 4ISTA 3ZJ1A 4V1PA 2WT0A 5EZYE 3VN4A 5DZGA 3DF0A 1O4TA 5JSPA 4BQXA 4YW6A 2M1RA 1HXS1 2RR11 4QKBA 4JKKA 3MIFA 5DUUA 3I1AA 3G6JB 5G05L 4AKGA 2WS3A 1F9KA 1V70A 4CDUA 3UT0A 2BP6A 1UY1A 1RUI3 5FLHA 3AC0A 3CDZB 1V6KA 1H8TB 4RHV3 2LXPC 3WDVA 3ZSMA 5A7NA 4MVTA 3ZXAC 3SOUA 3IBPA 3GWHA 5A1AA 3C7GA 4QQ4A 2ZHMA 4GMP3 3P7IA 5GZFA 2R0FA 3PUXF 2K46A 3LGRA 2ZACA 3MLJA 3O0WA 2D5FA 2PXJA 4HWCA 4QU1A 3ZMUB 3DV8A 1PM4A 3EQEA 2AENA 4NRQA 4H7LA 2NZ9A 3TAYA 3VKGA 3UQ4A 2DSMA 3F31A 4NRMA 5FZ6A 4X8NA 4DMWA 2HYXA 4HOOA 2WR9A 4YABA 4DOUA 4BJMA 2VBDA 2BKNA 4B6XA 2YUCA 1UY4A 1I94T 3I2DA 2ARAA 4BMEA 4MSVA 3A5XA 2C6SA 2C0SA 3B01A 2E63A 3MKDA 2FBEA 3C3VA 4GB33 4I3GA 3PTYA 1IQAA 2JG8B 3H3MA 2BOJA 1MEC3 2EHOC 5J09A 1QH7A 2VW0A 5AQMB 1LEDA 2VTXJ 4X8PA 5GLTA 2MNGA 3U3IA 5CG8A 2VCMA 5FQ0B 1WEOA 5CKMA 2BNNA 1VBA2 5LCYA 5AQIB 1HYJA 2C5IT 4AWDA 1QJY3 4JV4A 3EJKA 3T1MA 4D6QA 1CPNA 2G0UA 4KBMB 4XBNA 2E9XB 1AUYA 5E0OA 4NHMA 5F9TA 2XONA 4S2GA 4DV6T 2E9XC 3LWCA 1W9RA 2EXJA 5IAVA 4BCUA 5JUVA 3J4UH 1W9SA 4LE4A 3OGGA 4M0HA 4YGEA 1JYCA 4Z07A 4YG3A 3J7MA 1RUI2 4IQPA 4F7ZA 4PJYA 2L7PA 3T2OA 1OQEA 3THDA 3BTZA 5FR3A 1UYYA 3BU7A 4I0AA 2WCAA 1JXNA 4GULA 2DNXA 2PNXA 4HSLA 4I02A 5FZOB 3NBXX 1D7PM 4FFFA 4WZXA 1WZXA 1UY2A 1QJX3 4Z91A 5BNPA 3H8UA 4IGUA 4E8DA 3RLFF 2VZPA 3HBKA 1COV1 4NIGA 1AR83 1DGRN 4FXGB 4EWEA 3FFZA 4QKDA 2MHFA 1OI6A 3HOBA 3Q9OA 4XF4A 4AGRA 1Q56A 3KV4A 3HT2A 1B35A 4EN9B 3BOWA 1GZWA 4BM8A 3M63A 1R091 5HEGA 5IK4A 1FAYA 3KCYA 3RZMA 2ZX4A 3FLTA 1LEMA 1IHMA 2XP0A 5IUQA 1LRHA 3VBRB 4IGPA 2HWE3 2H6BA 2QQPA 3DYPA 1UIJA 1C5HA 1KRIA 3ZN1B 1YD8G 3I3QA 3KVBA 1AJKA 5FY0A 1AXZA 5DAQA 2BW8A 2K9AA 2QJ0A 2QDRA 1SA0E 4O65A 2RG4A 3J26N 4AEDB 2X9WA 3Q5DA 4GB32 2B9UA 1EAH2 1OXZA 4A0CD 2QFEA 4UV9B 3MDPA 4ERRA 2WWSA 3LA7A 2LKGA 1REFA 1WR0A 2DWKA 1RMDA 2NWBA 3J7HA 2WYSA 2JB8A 2VOKA 4QB1A 1PGW2 1E4UA 4TSVA 2XSBA 2XR4A 5FYVA 3PU3A 1AX2A 2XJVA 3BK9A 2MIQA 1EV11 1F35A 1QGLA 2KWOA 3W9AA 1W6MB 4O62A 1MEC1 3VR8A 2FJBA 1WW7A 4Q5OA 2PAMA 1IOAA 5F2SA 4K9SA 3ZFGC 1E1HB 3RQ0A 4I50E 1WKYA 4G63A 1FV3A 3PDYA 1N1SA 4DBRA 3RJ2X 1RUJ3 2ECJA 1WWYA 4UVCB 3FJUB 5F6KA 3M3EA 4QHZA 3QB5K 3VZLA 4KMQA 3TNQA 2D43A 4M3CA 3ZSJA 2Z42A 3IBMA 3EDVA 5L3GB 5D8AC 4CRQA 1RUOA 1XXNA 4HWFA 5LG4A 2LGKA 3W59A 3O1PA 3RMXA 5JXIA 5FO7B 3KD4A 1QKQA 1HX6A 3P4SA 4M4PA 1WMFA 1AR82 1I9RA 4TLFA 3AZVA 1OOPA 5LBQB 2N9DA 4YVWB 1JM7A 1J3QA 1D0XA 2ZM6T 4QX3A 5ACA3 2CEAA 2BUKA 1E5RA 3RF1A 2TNFA 2X5IA 1BR0A 4MGIE 2C5KT 2Q5TA 1LGBA 1LAJA 3FC0A 1XNQT 3VKOA 4PDWC 4EE2A 4E8CA 2ZGLA 4META 4Q4W1 5JRCB 2XJTA 3CBNA 1LULA 4F3JA 1QJX1 4CEWA 4XMAA 4CP9B 2ECVA 1UPIA 2BV4A 5KHHA 2YDSA 2H89A 4AYUA 2QQWA 1GZWB 2CDOA 4LKDA 4EV0A 3UU5A 4NPRA 1RUF1 1N1TA 4PHZA 2HWE1 1Z8UA 5J3UA 1W06A 2X10A 1AL21 1DIWA 3NJVA 2EA7A 1FMWA 2WLPA 1AYN3 3FHIB 2HWD1 3P4RA 1KNZA 2GU9A 5JCTA 2PA7A 1KNRA 1UAIA 3UULA 3ZCIA 4TXWA 5FYIA 4QU2A 4AI0A 1XDPA 3O12A 3M3CA 4B1MA 2JDPA 3OUIA 2FDIA 3QLQA 5BNOC 3OUHA 2FUUA 4LULA 5L9BA 1PX4A 3CX6B 2EIEA 2ERFA 4TX5A 5LNKA 1LGNA 2ZHKA 4YADA 3Q1DA 1MMAA 1U5ZA 4A7ZA 3USUB 3DYMA 5FZ4A 1PIV1 2MD8C 5B4XA 2YC4A 3GZAA 5AFEA 4U74A 4H63H 4GKJT 3SCFA 1UXXX 3WNLA 1SHWB 2H6CA 4CDWC 4C9ZA 2XB1A 1JHNA 4IESA 5HXVA 1DQ4A 5IT6A 3ESLA 3GZTB 3W15B 1XBFA 5IWFA 5SVIB 2J1DG 4Q4V3 4O9EA 5F3JA 1N32T 4ES9A 1K5JA 1ULGA 1FOD3 5D1LB 4PDWB 2XEUA 3SFEA 2GN7A 2XBO3 3LD8A 3ENRA 3HMYA 5KX5E 5C3SA 3ABZA 2CCQA 5LB7B 3UKNA 1H2MA 4XFGA 5B76A 2UUBT 4XF0A 1UCXA 3WCSA 2WA3A 2WU5A 4BQ3A 3SCGA 3OPZA 2LGVA 1IAPA 2VURA 3UKVA 3VBSB 3KQRA 1S0EA 1P8JA 5A1LA 4DBQA 4W65A 3I4IA 5FZCA 4BBQA 3NVOA 2MOZA 2RJKA 2KWJA 1OKQA 1SLIA 4ADZA 1Z7S2 3MXZA 2YFUA 4U33A 2IVIB 4QH1A 1YQ5A 4NAMA 3LOIA 1VCTA 2LHNA 4RR3A 4JAAA 4CP9A 1V0AA 2KLQA 5E16A 3HIFA 2LGGA 1CR7A 5C9AC 1VOMA 4B3MT 1Q8OA 4EJRA 2HEVF 5KXJA 4TTGA 3JZVA 1UX7A 5DINA 4FSJA 3KDSE 4RFT0 3KQIA 4ONUA 4NROA 2KU3A 1V6LA 2W2UA 3UUMA 1WGMA 4CDQA 2IFWA 4JHZA 1KGYA 4QAWA 4I7DA 1FNZA 3E0ZA 4OZOA 3KLSA 1E57A 4BQ4A 1W9YA 4F8AA 1F8VA 3T9KA 1WLXA 4N53A 3AAAB 1YXRA 4AHXA 2VKDA 2VMGA 1IZ3A 3FUQA 3RYFE 2CYFA 4TNWA 2ZOEB 3E1F1 3MW4A 3HR0A 3MYXA 1O3QA 5H9SA 4Z92B 3VD3A 4IV1B 2WDQA 2FJEA 3O1TA 3LAGA 1GLHA 3ZN0B 1CIWA 5LYJE 1W8ZA 3HNBM 4IE6A 3O34A 3BODA 4Z8XA 4AVCA 4XILA 4BA6A 3O4XE 3CL1A 2QUOA 2I74A 4YWAA 5FXZA 3LBXA 1KDKA 1Y43B 4M01A 3H37A 4J6GA 4UP0A 2G9GA 3JBG2 3C7FA 4J1WA 4CCNA 1FXZA 3NV2A 2EAKA 4XFIA 2Y0OA 2R6GF 1H1IA 5IK8A 4CYDA 2FSAA 2ZGQA 5H6QB 1UY3A 3UGGA 2XDVA 3WUCA 4P1NA 5LKXA 3Q2MA 3KFWX 3MZHA 1IS3A 4OULA 1MQTB 2O0OA 1HG2A 2IWGB 2DL1A 3MGUA 4B8EA 2Q8DA 2X68A 4WM8A 5FMBA 1KS4A 3BALA 5FY1A 2E7AA 1K5MB 1QNWA 3E5QA 1F5FA 5GZGA 2WO1A 4FPGA 5DAXA 3SUBA 3P4QA 3PVEA 1HYIA 2XAQB 2VC9A 5CFBA 1MMGA 3CJXA 4CUGA 4PI2A 1UU5A 1VBA1 2QQMA 2JD9A 4R4XA 2HWC1 5J48A 2XKOA 4ET7A 5TRBA 4U2ZA 3FANA 4AISA 4EB6E 1QOTA 4HFSA 2RS11 3R6SA 4PK6A 1RHI3 2ZGRA 1LOBA 3GMIA 2N2NA 1SCRA 2VZ1A 1US7B 1V9U3 1OF4A 5I3LA 4LEJA 2E32A 3RYCE 5FIXA 2VVSA 4RHV1 3PJQA 4DV7T 4CDQC 2L8KA 3ZKUA 2OUJA 1WMEA 5FUNA 1QDOA 2JG9C 3NRXA 4LO4B 4R9AA 3RYHE 3LCPA 4QQLA 1HTJF 3PU8A 2FD8A 5C8YE 1GP5A 1GWMA 3QUJA 2L80A 2KT9A 4LJNA 4IW3A 1N47A 3ZN6A 3U10A 3ILFA 1KDMA 3ZT6A 3OF1A 3NRUA 3BB6A 2JKBA 2JJ9A 3A23A 1CVNA 3VBRC 2CHOA 5FPAA 3LQIA 1LOGA 5C6CA 3CO2A 1CGPA 4FT8A 3OY8A 4HWHA 3ZFGB 1S94A 2D3RA 1HDKA 2W61A 3I2GA 2ORXA 1NCRA 1OEDB 4FAHA 2R30A 2E2AA 4Y4RA 3GCXA 1WCUA 4ISRA 2CV6A 4FCAA 4L8QA 4HFHA 3MLLA 2V5CA 2HWB3 3TNPB 2HN1A 4B4RA 2YSJA 1WD4A 3ZT7A 3O7OA 1SZBA 2UXNB 1Y64B 2CAVA 5C3OA 4W6YA 2I2SA 3TEZA 2XM2A 3RYKA 2ZHNA 1TEIA 2K48A 4I0UA 2VVNA 4Z0OA 2PHUA 2E51A 3WOGA 1QUUA 3KHCA 1UOJA 3UGHA 3PURA 1O8SA 2ZGTA 2PTMA 4LPLA 5C8CB 4LBQD 1UOBA 3GV4A 2JE8A 1G86A 2NLRA 2D6MA 1HN1A 1ZBA1 2ZGMA 5FBJA 4G2AA 2LM9A 2PHXA 1OLRA 1PGL2 1YNAA 2VMCA 5EK3A 2FDKA 1IJ5A 2FCVA 2W3JA 3ROUA 2NPIA 4GWJA 1WD3A 5FREA 3KGLA 3OBTA 2A1XA 1NY71 2XOCA 4RSUA 4B4QA 3VKFC 1ZV4X 1R1A3 1K12A 4HGAA 2VWAA 2LV9A 5FDBA 5L4EA 4PFPA 4D69A 1MVQA 4BPZA 1X4IA 4WW0A 1D4VB 4H63V 2ARXA 2XL9A 1YWKA 4K0KT 5K0UB 3O1VA 1OLME 2WU2A 1T1HA 1TME2 1S0BA 4ITCA 3RFRA 3VKHA 4RQPC 4JV5T 3IF8B 4OHYA 4N43C 2J22A 1W8WA 2QYWA 5C5TA 5IW0A 5LEJA 2XQ9A 3H0OA 5FBZA 3RZHA 1CX4A 5EQUA 2JQQA 2OXQC 1R082 5BXXA 4ES8A 2GAUA 4QWNB 2A9UA 2LJLA 3OYZA 2XM1A 2QQNA 4JQTA 3FBLA 1FPN1 3KV5A 1PGL1 2KXPB 2JE9A 2AREA 3LG7A 4OMDA 5JOXA 2J42A 2DUPA 1G8WA 2VO5A 4UVAB 5K0UC 2GMPA 5FPLA 2BKOA 3I2OA 1GOGA 1U5IA 2ZX1A 2UY8A 3VZKA 1RJ7A 4YG0A 1W9FA 4PCRA 1ULEA 4OZXA 2LLYA 1DU2A 3CEWA 1WFDA 3M7AA 3N7LA 2YDRA 2GNTA 1HFAA 4F8HA 2YHJA 3QH6A 4F6RC 1JI6A 4AVBA 4JKLA 5FY8A 5BNOA 4TWTA 4AQSA 4Q4Y1 4URAA 4ISSA 1US2A 2WT1A 3TLWA 3ZKYA 3H3AA 4IGQA 1W6NA 4HVQA 1IS5A 2ECGA 3OCPA 4EWAA 3KINB 1PMHX 1L7RA 1ZRRA 4IV3B 2LSJA 1Y9QA 2XUMA 3WW4A 2ID4A 4IC2A 4YC9A 5KXDA 2A3DA 2OV9A 2V7KA 2ZGSA 2A72A 3WHUA 2VE1A 3AYAA 4CDUC 4INDA 4Y1ZA 4IE5A 3MHZA 4A5XA 3H50A 4CCLA 2OQ7A 2GC0A 3KB5A 4OMCA 5A3PA 1M06G 2X09A 1H8VA 4RGGA 5FO9B 2PTFA 2NW9A 1IBLT 2X5IB 2FFWA 4RGAA 2DU0A 3WVJA 4D7TA 2WYFA 1IPKA 1A3KA 2DU1A 4K8RB 3D0TA 5L2LA 4OX9T 4DY3A 4AVVA 3KBUA 3FE5A 1MR5A 1X82A 4AKLA 2Y6GA 2MPFA 5L9RA 5FY5A 1LOAA 2AYHA 3S0MA 2L3LA 4XQWA 4KBZA 4UW4A 3TN92 1OA4A 1C1LA 2V5YA 2QA7A 1NA1B 1RHI1 5L47A 1KEXA 2YY1A 3RPGC 1UY0A 3AAEB 2ZETC 4HEAA 2YBPA 4P9GA 3LJUX 5BPXA 4BJ0A 1W9TA 4DR1T 3OBRA 2IIUA 2PHLA 3NNGA 4AUQB 3B02A 4IE7A 2JEMA 3KF3A 5JXJA 4AI8A 1A8DA 1H6XA 4RR3C 5FMOL 5FP4A 1RB8G 4JI0T 3CHXA 2RM23 4AIUA 2PFWA 5H6RB 2ZHLA 3VD7A 4CXYA 2W4XA 1QF3A 4XUOA 3GN5B 1AYM1 4YXDA 3OB8A 3J8F3 3BIWE 4X62T 2D8UA 5EHDA 5ACA2 4A4CA 2AC1A 3AJZA 2HH7A 5EFUA 2IXLA 4IV3A 3P5BA 1W9WA 1D0GA 4L2NA 1NOVA 1J59A 1XDOA 2GP5A 2OYZA 5ABFB 4KBBA 5F6LB 4GNFA 3S7IA 2VZVA 4DUWA 1WLWA 2D6NA 4R9CA 3TRSB 2RMU2 3WW1A 2CGNA 4D3WA 1SG3A 2D6KA 1ZYBA 4E4ZA 3TBDA 4XEZA 1WCSA 5KC5A 1E5HA 2R063 4PNIA 1F62A 4COFA 1UYZA 1FP0A 3WQ1A 4WVZA 1S4CA 4H14A 2KINB 2VMEA 1A6CA 5CADA 3DCQA 4JI6T 4GB31 4EQVA 4DV3T 4Z0RA 3WINE 4CN6A 4I30A 4BMBA 3MV11 2KR4A 3H7YA 4QXBA 4H7MA 2WFF2 3AFKA 4YGBA 5FYHA 1ZBE3 2QQLA 1MZ6A 3C4WA 2AUYA 4NHYA 2LM3A 3LA2A 1N3QA 3HAGA 2JWPA 1NA1A 2W95A 4KWKA 1TME1 1EYBA 3O35A 1H2LA 4IHJE 5FK8A 2WP9A 4XHBA 2UYBA 2BWCA 1KS5A 1O8PA 4KU7A 3CKHA 2ZGUA 2W52A 3FAOA 2VD7A 5HEJA 3IAQA 2F6NA 3LIHA 2JRKA 2UURA 4ZU5A 1SLBA 5IVVA 1D1AA 2BYVE 1OKOA 1MM3A 2JDYA 3URFA 1OUXA 4QPIB 5A33A 4Q4X3 2VL0A 3LEIA 2XJUA 3Q5XA 4XF9A 4DXSA 4B3TT 5L9VA 4LO5B 5BNOB 2Y33A 4GB0A 2Q1MA 2FMYA 4FI5A 2B9VA 3KM5A 1I5PA 4V3KC 4M1PA 4YFWA 4GWNA 1IZNB 4Y3OA 4YSFA 2LSGA 2EAAA 4CP1A 5CZKA 4TKPB 3SH3A 4YFZA 4QH5A 2WNOA 5HXCA 4OI4A 1NAEA 1R1ZA 4XJWA 1TME3 3ACGA 1VPHA 1W8OA 2F17A 5FXVA 4UELA 5FYUA 2F4LA 3U5PA 4AXOA 2VGDA 3VZMA 3T0AA 1HRI3 2C5JA 4UW6A 2WLQA 4LBLA 2QCSB 3JC6D 4YBMA 3CQCB 1GICA 4G9SB 2RV9A 3LDRA 1ZZBA 4XUPA 3ZYLA 2VZ3A 2CGOA 3I2FA 1VRBA 5IUXA 2XTLA 2LOPA 3WG3A 3HQRA 3NSTA 2OQ6A 4KX6A 3N7KA 3ZPV1 4NJ4A 4IT4A 1LRZA 1WA4A 4A6OA 3GYDA 2PYTA 4CU6A 1XU2A 3I0OA 1NQJA 1ULPA 3B00A 1HS7A 3VBFB 4XVHA 5CAZA 1NCRB 2WO7A 5CB7A 3VUOA 5JXHA 1OH3A 2FUIA 5KDMC 3VB9A 5F39A 5DMYA 5LCWB 1I3HA 2VW1A 1HKDA 3AKPA 2X5IC 1HQWA 4AQFC 3AL5A 2FDGA 1C3HA 3NAPB 5K9YA 1RUH2 3ELNA 3JADA 1U4QA 4GNEA 1W6PB 3LQHA 1B09A 3ZX7A 4A56A 3OBVE 4AVAA 3OKQA 2QVAA 1MBMA 1GP6A 2CRWA 1OFSA 1DGRA 2PHRA 4PJLA 5EK4A 2WFPA 1G6NA 4Y20A 1L7LA 1LB2A 2I50A 4YSXA 4BA9A 1BEV3 4DFSA 2P57A 5TSWA 5JDNA 2ATFA 2Q1FA 3A8YC 2C4XA 1HRI1 3AP9A 2B46X 2HPJA 5FRAA 1W2UA 3LVQE 2ZMKA 1SLTA 3MA9A 2WS92 1OOPB 4CCJA 1G9FA 2VZUA 3U5NA 1NG0A 2ECTA 4UF0B 1LHWA 1QHDA 3POSA 3DKQA 4JDOA 3WUDA 5B8DA 4LXLA 3AKQA 5CA6A 5EYYA 2UXXB 5E1RA 3AEDA 4PQQA 5D2AA 1RUC2 3VLBB 4YT0A 4OHVA 5IYYA 4MHCA 1IGOA 2XJRA 2DLRA 3AB0A 3GXUA 3NNFA 2GALA 4OVEA 1XE7A 3BQLA 1W3XA 1F5JA 3KT4A 4Y26A 4LBJA 3U4XA 1AYN1 1B35B 2BAYA 1POV1 1ZP0A 4D6SA 2HWB1 1UYXA 1WLCA 4JRLA 4YVWA 3POBA 3ONXA 1GR3A 3RZZA 3PUAA 3KF5A 4O2BE 4GWMA 4UVBB 1FYUA 2C2VS 4GWIA 2KWIB 2DBIA 4HBNA 3NKTA 1SMVA 3AMHA 2E9QA 5CA0E 1FI2A 2KXLA 1KNPA 4GOUA 4Q0SA 1S0IA 4BQYA 1HLCA 5FEYA 1VBC3 2VBPA 4HN0A 5D8AA 5A3WA 3ZT5A 4CUCA 4O4IE 2XAJB 1DHKB 2YOEA 1S0JA 3LQCA 1VMFA 1R092 4WVMB 4HFBA 3VHRA 1RVF1 1UNBA 2YINA 2WQYA 5BNNC 4QX5A 1YYNA 3DP7A 4EGWA 2BVVA 4AXPA 5DZEA 5LHGB 3C2UA 4HL0A 3FLRA 1YKEB 3ZCJA 5JPMB 4YLZA 3VKLA 4E4SA 3OGRA 1RUD2 5BNNA 2R061 2Y64A 4IEYA 2BG9B 1HJFA 1HG5A 3O1SA 3BPZA 4YRDA 2RMU1 3VKMA 2DURA 4QDRA 1APNA 3ZVYA 3LFIA 2MEV2 3O14A 2M85A 1RUF3 3AA6B 2V4VA 1NLSA 5FJKA 3RNSA 3QZVA 3MFCA 2K4DA 5C8CC 5LRSA 3NWIA 2JMJA 5CYYA 5AC93 3HI2A 1FIOA 4Y24A 3U11A 1RUJ1 4YGCA 3K48A 4AEKA 1YQ8A 4UR9A 5FMNA 1CAUB 2DCKA 2EHOD 5KHIA 4LHSA 1CD3G 3W5NA 4W50A 1WYBA 1FPN3 5IFPA 4Q8LA 1MM2A 3DWDA 4E2SA 3I8TA 3AZWA 4LBQA 4U3CA 2EODA 4DV1T 4EOZB 3CKDA 2D98A 5ISLA 3AXJB 1LJ7A 1YEWA 4ZUXU 1ULCA 2ZAAA 3SRZA 1HR0T 1S2BA 3SLIA 3H7HA 1B7TA 3O33A 1PNFA 2HBTA 2L43A 5DDJ1 2Q9QC 2EIGA 2ZLYA 2H88A 1SLCA 3VGIA 4XDOA 3ZSTA 4AKIA 3WW2A 2HN2A 5JZGA 1GMMA 5TBNA 1RVF3 4P9LA 3U75A 1JNZA 2BBHA 3OPTA 2XZEA 2YB7A 1ZKEA 4TN7B 1AR61 4L97A 2Y26A 4S2HA 3MHHA 4BIFA 1IYMA 3ZMZB 1ASJ1 1F2NA 1R093 2ENRA 4FTEA 2XSAA 4NPPA 3B7MA 4LORA 1UX5A 4BZ4A 4SBVA 2R16A 3CQGB 4P0BA 2HWD3 1PVC2 3HNYM 3W5MA 4YPJA 2VJFA 2WL1A 2EXHA 4K40A 5DUXA 2VPDA 3IM0A 3HNMA 5CFCB 3UUBA 1POV0 1Y4WA 1T6GC 1H1MA 1YI9A 2WB5A 4ATEA 2HYKA 5AIUA 2KWHA 2XQ4A 3CX8B 1JYTA 1UU6A 3N4MA 2QKDA 3FX3A 4YM0A 2E5VA 5FWEA 1H7CA 2VNGA 3MACA 5KBFA 2JX9A 4ZZBA 1XPWA 3AEAA 3KT1A 2YEVC 3P1IA 2CRRA 4PDWA 4FK5A 3RKOA 5JVDE 3RZLA 5HXEA 3POWA 1WGPA 2UUAT 2GH2A 1BJQA 1YO8A 2YHOA 1L7QA 5GKAC 5HCAA 3AFGA 1JBCA 2Y0IA 3V0AA 4FVVA 4EEDA 4XZCA 4IEXA 2BOIA 3ZFEA 1HW5A 1D4M1 2CXDA 3NJZA 4DUXA 1KFXL 2E6VA 3ZXEA 3SKJE 2D9DA 1R64A 2B4KA 2QBXA 3OTOT 3BKZA 4NE9A 1J84A 4P09A 2B1EA 3PJYA 2X53S 3RIUC 3B3QE 4L58A 3CNAA 4YW5A 2WZIA 4MXWB 2PBIA 2I45A 3OVUA 3RVHA 4B1LA 3P8CD 2WWUA 5LA1A 4CCGX 5CFCC 4FOWA 4YAXA 2VUDA 4S2FA 4UV8B 5JPNB 1UMIA 2WNUA 1X9TA 3K75B 4O2AE 4QX1A 4LKFA 2IAKA 1AL22 1ZA4A 4W4ZA 4Y22B 2WSUA 3NV4A 4MFRA 2SLIA 2YYOA 3E2DA 1W39A 5AQTB 2JDMA 3R84B 4JGYB 3C5KA 1W2AX 4PLMA 5F1RA 3POJA 4LBNA 4JGYA 3ILNA 4QB6A 5C3PA 3NNLA 5LGUB 5T5OA 3TOJA 1BBT1 1RUC1 1MNDA 1H4GA 3MUZ1 1GQPA 2OIIA 4GA9A 4ANJA 1Y9GA 4ZQLA 2IXKA 1OVSA 3DXUA 4OFGA 5D1MB 1OOPC 5FY7A 2BDRA 5FUIA 1W2OA 3HCSA 4XF1A 1UGOA 2ET7A 4HFIA 3CF6E 4JKMA 1R8IA 5FYZA 1UZWA 3EMRA 1OEDA 3FHNA 1G9AA 4EV6A 4JGZA 5FPXA 1OPOA 1DBNA 4IGOA 3MO4A 4EN0A 3A7QA 4PFOA 2A6WA 1W6OB 1I1EA 2PHFA 3OYWB 1ZRDA 4U2YA 2IHR1 4RD7A 5LBBA 3T2PA 1GOFA 4JRAA 1MZ5A 3I7DA 4BXSV 5HAXA 4DB5A 2VJXA 5IK5A 2FDHA 1N36T 3QOFA 2WNUC 4HFDA 1GSLA 1K5MC 2VU9A 2P1BA 1QQP2 2ZX2A 2DCFA 3AE9A 3LEKA 3ZFEB 4UIGA 3EUHA 1TE1B 1UCUA 3FN9A 4LMLA 4WZ0A 1NQDA 1M7KA 3I3EA 3B9CA 5LOVE 4XHXA 1JZ6A 3D6EA 3ETQA 3PUYF 2J4GA 1C1FA 4LO6B 3ZEFB 3MLKA 2NOXA 5AC92 1UURA 4KH9A 3N35A 1RUD1 1EAH1 3N9PA 5F8PA 4S3OC 2WY2A 2XJQA 2GC1A 1BEV2 5CVRA 2X0HA 1ZBE2 2BBJA 4LHKA 1LTEA 3NNJA 5K7PA 5LB6A 3CPZA 4LK9A 1I6XA 4R9BA 5LGNB 5KH7A 3M8LA 3H1YA 5A33B 5LA9A 2ZGNA 3DPRB 4CCDA 4XFAA 1QWRA