3KV5A

Structure of kiaa1718, human jumonji demethylase, in complex with n-oxalylglycine
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
447
structure length
447
Chain Sequence
b'PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 129
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv5A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv5A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv5A01
4YC9A 3KV6A 5FYBA 2IDAA 3LQJA 3O34A 2G6QA 3O36A 2VJEA 5A7QA 4CCJA 5G05B 5TRBA 5FZFA 5FXXA 2XXZA 3PURA 5FZ1A 5F5AA 5D1MB 2YUCA 1JOCA 5LKUA 2VPDA 2MD8C 2YQMA 5FXZA 4NN2A 5LCWB 5FBJA 4EZ4A 5C13A 5FZIA 3RVHA 2YHNA 2L0BA 1WFKA 5FZEA 2LXPC 4LIVA 4R7EA 3SOUA 2KGIA 4TN7A 1WEMA 4HOOA 4D6RA 3L11A 3K3NA 4B86C 2XEUA 3IHPA 5LKTA 2H0DA 3M63A 2ECWA 2XDVA 5A80A 5DKAA 3ZPVE 2YYRA 4CCGX 4YBMA 5FYVA 5FZ0A 2KFTA 4FK5A 2LRIC 5FEYA 5LW9A 5FPAA 3PUQA 5FY7A 2F6NA 5I3LA 4IC2A 2MA5A 3O33A 4UP0A 4R2YA 4FIPA 4BHWA 2LGGA 1Z60A 4L58A 3AVSA 4ZUXU 4QX8A 4V3KC 3T6RA 5J3XA 4BXFA 4X3GA 5JG6A 4IC3A 2NAAA 2VNFA 1E4UA 4V2VA 4GNFA 5A3TA 4Q6FA 5FZCA 2CKLB 2KWNA 2OQ6A 5FZ9A 2K1JA 5FY0A 2UZGA 4CCOA 5FYYA 2YURA 1N87A 4V3LC 1Z6UA 2QICA 3RTRB 4QWNA 5H1TA 2KU3A 2VJFB 5FZKA 2Q8DA 2LQ6A 1V87A 3MHHA 5A7WA 5FYUA 4BU2A 3N9MA 2GP5A 2MA6A 2M1RA 4Y4RA 2LGKA 3M62A 5FZBA 3O35A 1WEEA 1FP0A 5FP9A 4DIQA 4GJYA 3GL6A 5FJKA 4CUGA 2XUEA 2AN6A 4S3OB 2XMLA 3QZVA 4QXBA 3KVAA 4AVXA 2KR4A 3SOXA 2VP7A 4DO0A 4WZ3B 2C2LA 2OQ7A 5FZMA 5FZOA 2MIQA 4GNDA 3AVRA 5FYMA 3DXUA 5B8DA 4BISA 5F5IA 3RPGC 3SHBA 2PUYA 5F5CA 4CA1A 1X4UA 2KREA 5E6HA 3I2DA 4PTBA 5TBNA 2YBKA 1HYIA 3U78A 2P5BA 1WIMA 5H9MA 5KH7A 4WA6A 5B75A 3U5NA 4I7BA 1ZBDB 3NG2A 4N3WA 5TDWA 4CCMA 5ANQA 2WWUA 3DPLR 2JMIA 4IGPA 3M99A 2YW8A 3L1ZB 4GNEA 3U5MA 2MD7B 4BBQA 4AYCA 2QIZA 2HDPA 2E6SA 1WEVA 5A3PA 4P5OB 4LXLA 2LDRA 3U5OA 3ZPOA 2MNZA 3NJYA 1CHCA 1VRBA 4CCNA 3SOWA 2JMDA 3K3OA 4AP4A 5H1UA 3KNVA 2Q8EA 4UP5A 3PUSA 2W2IA 4MVTA 1WEPA 1JM7A 5IVVA 4XDOA 3ZVYA 2KWJA 3EB6A 2OT7A 5FUNA 4GJZA 5F3GA 5FYZA 3HTKC 5DINA 4LADB 5LKZA 2I50A 5G0FA 3AL5A 1MM3A 2K16A 3KV5A 1DVPA 5FZ3A 5A3WA 5FP8A 2VJEB 5FZLA 2GP3A 5CEHA 4WZ2A 4AI9A 2FUIA 2OX0A 5K4LA 3O70A 4LLBA 5EYAF 5TDRA 4UF0A 2PXJA 5FY8A 4FJCA 3U5PA 4IGOA 3ZNIA 4CCLA 5IVYA 2YREA 5FY1A 2YBPA 5KR7A 2ECNA 2EODA 3U4SA 2ECGA 2F42A 4EZHA 5KH9A 2M3HA 2KIZA 2LGVA 3ZLIA 5FYTA 3ZTGA 2MUMA 4PPEA 4E4HA 2ECVA 5FY9A 5FPLA 2ZETC 4TKPB 2H0DB 3OPTA 5A7OA 4A4BA 5A1FA 5FPVA 5IVEA 2FUUA 5FWEA 5G04B 3ZPV1 1VYXA 3UYJA 4YBSA 4A4CA 1VFYA 1LDKC 4QX7A 5FXVA 1K2FA 2LN0A 2Y43A 2JRJA 3T7LA 4I7CA 5FUPA 2L43A 1WEOA 4YBTA 1XWHA 5H1VA 5IVBA 5FB0A 5A1LA 4ZDTA 4QF2A 5FYCA 5FPBA 1X4JA 3HCUA 5D1KB 4A49A 5F39A 1Z2QA 1T1HA 2M6MA 4O64A 2KWOA 3RPGB 1WEQA 3V43A 2ECIA 2KWKA 4LKAA 3LQHA 3GV4A 5AIUA 5LY2A 4NUBA 4R8PK 4YABA 1LDJB 5TABA 4CCKA 5F2SA 3EB5A 2MNYA 5FYIA 2VPGA 4MSXA 2DX8A 5A7WB 5B79A 1IYMA 2LXHC 5FB1A 2CSYA 5B76A 2YU4A 4YATA 3LRQA 1MM2A 4YAXA 4Y33A 3L1XA 1WE9A 2HYED 5F37A 5A7NA 4ASKA 3LD8A 2YU1A 2YQLA 2L75A 2OS2A 5A7PA 4YADA 5FZ8A 4V2WA 4LIUA 2ECJA 3ZYQA 5FZDA 1WILA 4L7XA 4B7YC 2EA6A 5FZ7A 4CSWA 5FZOB 2ECTA 4GAZA 2KYUA 2WWJA 5FZ6A 4A0CD 5F32A 2CSZA 5FYSA 5FYHA 2YBSA 4WZ0A 4F52B 2LV9A 3C5KA 3DXTA 4GNGA 5IWFA 5FWJA 4AAPA 1RMDA 2OXQC 2RI7A 4LK9A 5F2WA 1HYJA 2CT2A 5D1LB 3PDQA 2EGPA 2PNXA 4QF3A 1BORA 2QJ0A 3VK6A 2YSMA 1U6GB 2CKLA 1FBVA 3KV9A 5LY1A 4HONA 2YPDA 2VPEA 3PUAA 3PHDA 5FERA 3PTRB 3AL6A 5FP7A 4URAA 1F62A 2F6JA 2VJFA 3MHSA 5AITA 2K17A 3KV4A 4AYCB 4D6QA 2KGGA 5A3NA 2Y1NA 2G45A 2K4DA 1X4IA 4EYUA 5FZHA 2M85A 4GB0A 1WGMA 4I7DA 3KVBA 5ISLA 2LGLA 1JM7B 4XI1A 3ZVZB 2YU2A 5FY5A 5LWBA 5B77A 5FP3A 4UI9B 2Q8CA 3N9QA 5A7SA 2RSDA 2KE1A 2YHOA 3N9OA 3HCSA 1WENA 5F3CA 5F3IA 5C11A 2D8SA 2XB1A 4Y3OA 1WEUA 4QU1A 3O37A 4UF0B 4LJNA 3C6WA 3N9LA 3N9PA 4C8DA 5FZ4A 5FZGA 5FPUA 3O7AA 5FJHA 2E6RA 4GD4A 3LQIA 2YSJA 1G25A 2VD7A 4IGQA 2BAYA 5LKXA 4AUQB 5IVCA 2G43A 3KQIA 3ASLA 5IVJA 3PU8A 1WEWA 4XDPA 5FP4A 5B78A 5FXWA 4LITA 5FY4A 3N9NA 2MT5A 5FZAA 3K2OA 4FO9A 3HCTA 1VD4A 4S3OC 4N4FA 2FSAA 2C2VS 2Y1MA 3PU3A 5IVFA 2JMJA 2L80A 3LDBA 3DQVR 4QXCA 4C9ZA 4D6SA 4W4UA 3OPWA 4ZQLA 3FL2A 5FV3A 5IW0A 2VPBA 4QXHA 2L5UA 5F3EA 2YT5A 1WESA 5KH3A
chains in the Genus database with same CATH superfamily
4XFCA 3LQJA 4DV0T 2EIGA 5A7QA 2ACXA 4D94A 2Y8DA 3KQ4B 1BCXA 1ZBA3 3SS1A 2V5DA 2XR4A 4ITCA 3AA1B 2V72A 2VPDA 4FFHA 3CMGA 2YQMA 1S0FA 2CRWA 4BQ2A 3RH3A 4O2AE 2YDEA 5C13A 4AVBA 3L3PA 3AAAB 2L0BA 5C8WA 1QJX2 2KGIA 4MALA 3B02A 3LAGA 5ABFA 4H7MA 2WZPP 2YC4A 2DL1A 5EJ3A 3RC3A 4O4LE 2LRIC 3K4ZA 1YUDA 3SCHA 3RZKA 4PAGA 5HEOA 3K46A 1RUI3 2VMEA 2QJVA 4LO8A 2JXAA 3ZMNA 3PMSA 1WW7A 2VW1A 2CXLA 4FSJA 3PIJA 3PLQA 1G7YA 4H9OC 4PK4A 1DHKB 4GNFA 4L99A 4YRDA 5LJMA 1R1A3 1S0GA 4BMBA 4JI7T 1WMXA 3H3ZA 4R9DA 2YURA 4TLGA 4S2FA 5FZKA 3HKBE 1UK5A 2V5YA 5FYUA 4FOYA 2Q9QD 3PVBB 3UU6A 3QB5A 4PJYA 3K77A 5FJKA 3F31A 1D1BA 2X9WA 5AQRB 2CHOA 4YM0A 1TNFA 4ZXEA 1ZBE3 3LK42 3EAMA 1MMDA 1HRI2 2IAKA 3I2HA 1AR62 5B8DA 3VBSC 5SVIB 4ZU5A 2K9AA 3ILFA 1QJX1 2QGSA 3M4FA 4N78D 1OF4A 2ZAHA 5FPXA 1WIMA 3NNFA 1W8TA 5T5PA 4K9SA 1WCDJ 2X10A 1O5UA 1IJ6A 3OUIA 2QDRA 2ZZQA 3P3NA 1Y7BA 4LF6T 1C1FA 2P6HA 5F5WA 4AW7A 3ZDSA 2WMNA 1NCQC 4DV2T 4QPWA 5C8CC 1GWLA 1C57A 4B6XA 1AYN2 5AQQB 2D8UA 3PUSA 1LB2A 1ZRIA 2CHNA 2J1SA 2WA3A 4PQ9A 3K1SA 2XONA 1I94T 1GNZA 4JYAT 2VZRA 1WUVA 4RL7A 2IDOB 4ILCA 2MPFA 4YSFA 2VURA 3JADA 2GP3A 5CFCC 3BCWA 2OX0A 4MLKA 2PXJA 2R072 4QGMA 3BKZA 4Y22A 2MPKA 1NLQA 4NRPA 3EYPA 3NVOA 4MOAA 5JSOA 2BTVC 4FTEA 4Q4V3 1HRI1 2FBWA 3GCWA 1AR61 4BB3A 2HWE2 5A7OA 3M3QA 4AQFA 4LBQA 4FCAA 4RQPC 1FMVA 4YBSA 4H9PC 2DFBA 1Z0PA 1VFYA 5FXVA 1QJY2 5GKAC 5J3UA 3UT5E 1LOCA 2XQ8A 2NM1A 2OLTA 1MS4A 4RS5B 4ZXKA 4CQIA 5IVBA 1PGW2 5FB0A 1U0AA 4K0UA 2XM2A 2QCSB 5C70A 5EPAA 1VAVA 1NA1B 1LHOA 5F39A 2EIEA 1W9RA 2J47A 2AH2A 2HEVF 4BDVB 2KWOA 5EZYE 2ARCA 2VM9A 1T6BX 4LKAA 1AYN1 4CCKA 1MS1A 5FYIA 5B79A 5SVXA 2E51A 3T1MA 1KF6A 2Y48B 3L1XA 2DWRA 4CPBD 4N7IA 2CWOA 3NAPC 2BS3A 3UU3A 2R071 2XJTA 4BCUA 4L7XA 1PMHX 4PNIA 4I01A 4PBOA 1WBFA 4CEWC 2BZDA 2WO1A 5F2WA 4ISTA 3AK0A 3HNBM 3KCCA 3BTXA 1JS9A 4JUYA 2HWE1 4YZ2A 5EK2A 4L8QA 5KBFA 3AE1A 3ZXAC 3WQBA 5B4NA 3I2GA 5GZGA 2WSUA 1QJY1 5FIXA 3B94A 2WBLA 5HXMA 3BK9A 5TAOA 1PGW1 4YZ5A 2XQ6A 4TUYE 1DGWX 2YU2A 4QDSA 4CDQC 1X82A 2KWHA 5LRSA 4UI9B 4YG6A 1DGWA 2DI4A 1W2AX 5FQ0B 2VO5A 2EXUA 3RGLA 1SHZC 4EQVA 3Q2MA 3HQXA 4XJZA 2FCVA 4TV8E 4MH0E 3O37A 3E6BA 3QK6A 1CONA 2WBKA 2WM9A 4GD4A 1ZRDA 5EYXA 2VD7A 3U10A 3M70A 1SBDA 1RMU3 5D8AB 3PU8A 4TNWA 4I3PA 1WCKA 1HX8A 1Y01A 1KGYA 1PO22 3MLKA 1VD4A 4YSYA 3RIFA 1TMF3 4AE2A 3IM0A 4AZZA 5JDMA 4D6SA 2P3KA 3PUZF 5DAWA 3DJBA 2PAMA 4I0BA 2XLGA 4CEYB 1ZP0A 4R8HA 2WAUA 4LOSA 1GU3A 4QB2A 4F1PA 1H30A 5APAA 3QBQA 2F4VT 3QD6A 1LR5A 2RR11 4EWDA 1RUJ2 4EZ4A 2DTWA 3ACHA 4R7EA 1MZFA 3HMYA 1IGOA 4IT4A 1OWAA 2UU8A 2HWD2 4FPYA 2H0DA 2YKSA 4DMIA 1GWMA 3CX8B 5DKAA 2PHDA 4DR3T 4RQPA 2QQOA 2V6YB 3WDYA 4I55E 1NUKA 1UUSA 3BYWA 5LMUT 2XWJB 1ZV4X 3VKGA 1KS5A 2BUKA 2NAAA 4JI0T 1PO21 1ZA7A 2WO2A 3TEYA 2WZHA 3RWKX 3Q8FA 2QICA 2Y6HA 2GNMA 2Y38A 1ULEA 2DCYA 1WW6A 5IUQA 4JEHB 5J37A 4PBPA 4BHPA 1WEEA 5JZGB 2Y34A 3GL6A 1QHDA 4XXPA 1ONAA 4AQ6A 2KLQA 1IKPA 3KVAA 3NAPA 2ZGSA 3I49A 1YFXA 1POQA 1NA1C 4Q0QA 3JB8A 2WNVC 4TWDA 2VU9A 4HSLA 2MIQA 4CA9A 3MF9A 3WNXA 3I2DA 3NV3A 1YFWA 3C7GA 1GANA 4CEWA 3ZT5A 1CWPA 2HWD1 2KA3A 1RVF3 2UURA 5E88A 1XYOA 3JC6C 4Q5OA 5LA2A 2WMOA 1W6OA 4LO7A 5JMCA 3FLTA 3MW3A 1URXA 3D5OA 3T2TA 4NVPA 1WWYA 1C8M2 2JRKA 1UX6A 2DBNA 4LXLA 4GZ9A 1MS9A 2DJAA 3ZPOA 3C7HA 3WG1A 2JMDA 4C1XA 2EHOA 3CO2A 4A5XA 1KDMA 2XJQA 2VL8A 1S1AA 4CDQA 5F5QA 4HFDA 3T1HT 2AR6A 1VRH3 1DVPA 4BWOA 1Z0HA 1VR3A 2IWGB 2W46A 1ULPA 4AI8A 3C8XA 1JYNA 2P9BA 1IPKA 2XOZA 2ZOEB 3H3AA 2GU9A 2NOXA 2QNKA 2ZA9A 2L3LA 5LASA 4MGSA 4O4HE 2VOXA 3A5XA 2MEV3 3DYOA 2XUMA 4LHNA 2XLFA 5A1AA 4IEXA 4X64T 2D0UA 1LOGA 1BK1A 3D8CA 2DDUA 3AE2A 4S2GA 4A4BA 5I8YA 1MS0A 4XUNA 5AQPB 3AE8A 1W9WA 3ZKYA 2BERA 5SVIA 1J58A 4RR3B 4HE8A 2HEYF 5J48A 2CDOA 1REDA 4LF7T 4FPFA 3K8PC 4WM7B 3CPZA 4QF2A 3AKRA 2Q1MA 5FPBA 4UW3A 5DQVA 3UKVA 1C8M1 3MV11 5D8AC 1MZ6A 3I2OA 1WEQA 2ECIA 3M3IA 2YDSA 3K4AA 5LA6E 2GC0A 2YHJA 4PLNA 2YGMA 3ABVA 3T8OA 3FL7A 3RIUA 1PHMA 4Y1UA 2Q5TA 2CLYC 1NZCA 4CEYC 1UU5A 2HYED 2FDHA 1NZIA 4LQRA 2L75A 2YGLA 2BPA2 1XJAA 4PJMA 2OUHA 2WNOA 2KINB 5AQGB 2HWC3 4DRRA 2TBVA 5FYSA 4F52B 2L9QA 2VAUA 4GNGA 3M8LA 2DF7A 1RUG3 4E9KA 4H9QC 3USUB 1OHFA 4YZ4A 3I2KA 5HEUA 5F6LB 1RUNA 3JXSA 1HXS3 5LGUB 3T4HB 1F5JA 1JM7B 3WF4A 5DUXA 4DEVA 3VKHA 2I74A 2WU2A 2QZ3A 3P4WA 1GSLA 2LUWA 2WNVA 2KE1A 2E63A 3ZSSA 4F8AA 5C6CA 1BLZA 3CZJA 3CU7A 1SLLA 2MYSA 2WNUB 1FI2A 4WZCA 2B42B 5D1IA 4HFHA 3UNPA 1P8JA 4WVZA 4LBQD 3AP7A 2VOKA 2DWGA 1VBC2 5FAXA 3KS7A 2X8KA 5DDJ2 1H0BA 3OG2A 3O1JA 3EQEA 3LSVA 2ZACA 4QAWA 3LSDA 3DPRB 3SXWA 5FRAA 2YV8A 5FLHA 4KQ7A 2VPBA 1QEXA 1RXGA 3FFZA 3ELNA 4CU6A 5KH3A 1MS5A 3KQRA 1RGSA 3O34A 4Y5SA 2EAKA 4KG0A 1UMHA 3PJYA 1LESA 1IPSA 3R84B 5DAQA 2XXZA 2VQTA 5JH7E 3OYWB 2XHEB 3UJOA 1BR0A 3ES1A 3HVDA 4YG0A 5KWRA 3IB3A 4B3RT 4YNIA 2VQAA 2FCTA 1H2MA 4F7ZA 2EXKA 1TME2 3E1F1 1ZEEA 5AQVB 4D6RA 3ILNA 5BUVA 4B86C 4GWIA 4DBQA 4D7YA 5A80A 4YBMA 1M4WA 3AP6A 1XYPA 4BK4A 3ETPA 3L9JT 3AYDA 4GQ7A 4QPIA 1YW0A 1VBC1 3AVSA 3ITQA 4XFFA 4QX8A 5LBFA 5DDJ1 4HSJA 1E5IA 2C6SA 4PDWA 4LR4A 5CNAA 2MOZA 1H8TC 5D8AA 3MW2A 5IHRA 3EDVA 2OQ6A 3EXUA 4ATFA 2UZGA 3B69A 3LQCA 2DCJA 4YSXA 2LQ6A 3E08A 3HIFA 3LIGA 2K46A 4BU2A 2M1RA 1BJQA 1YRZA 3MIBA 2RS33 3RZGA 5A3UA 3FX3A 3FN9A 3AE9A 3H37A 3QZVA 4WM7C 3UTKA 4OHWA 2ZHNA 3VR8A 3JQWA 2C2LA 3OUHA 4GNDA 3AVRA 3L39A 5FYMA 4BISA 1KNZA 2ZHMA 2H88A 2JE9A 5E8AA 3OTOT 2VG9A 5LP6E 2JIJA 2BZBA 1C8NA 1FATA 2ZS6B 1K5MA 1ENXA 4J1XA 2FJEA 1RUC2 2QIZA 4ZU7A 4GKYA 1CHCA 1U4QA 2VVDA 3CK6A 2DHRA 4GH4C 4HFIA 1JZ2A 3RZMA 2ZEXA 3HTKC 1TEIA 5JDGA 4ES9A 2LAUA 2W91A 4FBFA 1EPZA 2WWSA 3WHUA 1Z7S3 1NENA 2DNXA 3GJAA 4HFBA 1D2QA 2G4IA 4COFA 1GP6A 1QJU2 4UF0A 1PZ8A 4Q4Y2 4GIQA 4IGOA 2GDFA 2BWCA 3C4WA 1SEFA 2JPFA 1C5IA 4RGAA 4OI1A 3ZLIA 3ZTGA 4QKBA 1W8NA 2GMMA 5FPLA 1PVC3 1WCRA 4PCRA 2JD9A 1OURA 3D0TA 5AQHB 3AP4A 1VYXA 3WNOA 2HKXA 1W39A 2V7IA 4CUBA 1W0OA 3ZYGA 1EUUA 4URTA 3GWHA 4CXWA 1BBT3 1O3RA 4IEQA 4JTOA 3ACGA 4P9LA 4PJJA 2XKPA 1G9AA 3WNMA 4Z91A 2V26A 1WCQA 4TZ4C 3O0XA 3UJQA 3S7IA 2ADEA 3OBAA 2Q8OA 1WLXA 1STMA 1W99A 3DPRC 2P4EA 4GXLA 1ZA4A 4Y33A 2ZGPA 4FPCA 2UUAT 5HV4A 2YU1A 4AVTA 1QJU1 2GH8A 4Q4Y1 2YG0A 2E9XA 5FCCA 4GAZA 1OI6A 1VALA 2W47A 1J3RA 1K3IA 4E2QA 3DECA 4HMZA 3T2PA 3NO8A 1MIYA 3MACA 3BTZA 5L3BB 2EXHA 1H8TA 1JTZX 2QRXA 1U6GB 2EHOD 1W6MB 5LY1A 1QSDA 2YK0A 3M1HA 5FP7A 1W2OA 2VJFA 4AYCB 2XSAA 3SEEA 5A3NA 2G45A 3MUZ1 2F17A 3AECA 4O4IE 2LOPA 3F2ZA 3PUWF 4KL1A 4OCTA 1ZREA 2H0VA 4CVUA 5L9RA 4IDZA 4EE2A 4BMEA 4LFCT 3QLQA 1JYWA 4HKOA 3J7MA 4XETA 3NBXX 3BALA 2XJUA 3AXJB 4KNCA 3O7AA 1XNDA 1AX0A 3PVOA 3AB0A 4U2YA 2Z5WA 4CDUB 3KQIA 2QQMA 3ZPYA 1UY4A 1MZEA 4WZXA 5J96B 4QX5A 4YXDA 4XQ4A 1I9RA 1MR5A 3RI9A 3ALQA 2DUQA 4IDOA 4QXCA 4DRVA 3WF1A 4ZQLA 3LGRA 3FL2A 2LSYA 1BVP1 4JBWF 2EAAA 4GH4A 3TN93 1S0BA 2J1TA 4IE0A 4K7JA 2VZVA 5FO9B 3UFEA 5FYBA 4DS0A 3PE0A 3ACLA 3O36A 3APBA 5FMOL 3AKSA 2MBGA 3USUA 3IBMA 1QJX3 5GALA 5LHIB 5H9RA 3LOBA 2EXIA 3RPUA 1D4M1 4RFT0 4OLLA 4O9GA 4ILAA 1H9WA 4NAOA 2E5LT 2VZPA 5A33A 2LSJA 3PIGA 2EA7A 2V09A 4CCGX 5T3NA 3O1RA 1D2SA 4ZZ8A 3U1XA 2HN2A 4F3JA 1UOJA 4CUCA 2IC1A 3TNPB 2YFUA 4R9CA 1VCSA 1PO12 4LMKA 3DL3A 4XHXA 4AEDC 2VGDA 3RC8A 1DU3D 3UU8A 5J2TE 2K1JA 2J62A 3JBG2 3KGLA 3FB2A 4O62A 4ZI3D 2VZ3A 2YDQA 3P4SA 4GYRA 1UKGA 1W6QB 3O35A 4GJYA 2NQYA 1HRI3 2BGOA 2R49A 3SNMA 3FLRA 1DF0A 2KNDA 4WBOA 4XXAA 2XSBA 5FZOA 3QNUA 4P14A 1QLBA 3ACFA 3RGBA 5CKQA 1OEDB 5IHYA 3VUOA 1TNRA 3DGTA 5LHGB 2P5BA 3LEIA 5B75A 1X7NA 2RA1A 1W0PA 1YFYA 4N3WA 3I59A 1JYTA 1WMFA 3LPFA 1EV12 2RS51 1JODA 4PIYA 2ET7A 2W94A 2KKYA 2E6SA 1SG3A 1WGPA 3LG7A 5J09A 1VRBA 1PO11 2YXSA 2XQAA 1N1VA 1U5XA 1KXGA 4U7YA 2OT7A 5C3RA 2G9FA 1RHI2 2ZCWA 2W87A 4UOJA 5CA6A 1MM3A 4QKDA 3JBG1 4BJNA 3V64A 1Q8SA 4E7SA 2NW7A 3V0BA 1T7SA 3WQ0A 2ZX4A 5EYAF 5TDRA 2XL7A 2Y6KA 2PYTA 3U75A 3ZOIA 4QM9A 1WMEA 3KFWX 5FY1A 2YBPA 5KR7A 3U4SA 4EZHA 5FTTC 5KH9A 2X09A 2KIZA 3SMHA 1K45A 3WW4A 2WINB 2CWYA 5JR9A 4BIFA 4TKPB 1QJY3 2V73A 2L9LA 4KHPT 2D7FA 5FPVA 3FBMA 3N7JA 2A3WA 3VD7A 3MDPA 3ZXLA 3OYXA 2Y43A 2W52A 3N35A 3T7LA 4YBTA 2TUNA 2CHHA 5JWPA 1X4JA 1YXWA 4INDA 5BNPA 1IBKT 1V6IA 4FTBA 3V43A 4UXAA 2P17A 5HXCA 3P6BA 3GV4A 2ILMA 2A70A 1CGPA 4HWHA 2RMU2 4CDWB 1MVEA 1RHI1 3ZFGC 1QDCA 4Y1ZA 4YVWA 5LB7B 4FP3A 4XUQA 2Z2SB 5HCFA 4M3CB 2Y26A 3H1YA 2W61A 4JI5T 5A7NA 4DXRA 2WA4A 5A6XA 4V2WA 4HGAA 2EA6A 2JB8A 4I09A 5JMOA 4IV3B 3BVCA 4DXTA 5FYHA 2RM22 3UETA 4COUA 4EWAA 2WJSA 1K5JA 3C5KA 3FZLB 5FWJA 1J59A 2BBVA 4AEDA 4L9IA 3RFRA 3NL1A 3VK6A 1L7QA 1BR1A 2PELA 4A41A 2JDPA 2RR13 2WN2A 3PMEA 3KDEC 1MMNA 2QQJA 2FCUA 3R4SA 4TWTA 1RUE3 2M85A 1EZ3A 4I7DA 2WKKA 2ZHLA 4UW6A 4MXVA 3AP9A 4XBLA 1QDOA 5J98B 3ZN4A 5LK7B 2WL1A 3AMMA 4XIOA 4LO6B 1DFQA 1ZRCA 5A3LA 2RMU1 2DBIA 4XIKA 4LF8T 2XB1A 5T5OA 1AJOA 4HBNA 4HN1A 3POWA 3AYCA 2GNBA 3WQ1A 5FJHA 3P5BA 1PO23 2VKHA 2VUDA 5GLWA 4LBJA 1T72A 2RJ2A 1MEC2 4X6RB 1G9FA 2MT5A 2XM1A 2PBIA 3UKNA 5CKMA 4N4FA 2BRTA 4HWFA 1IQAA 5K0UA 1YQ2A 4WVWA 2RM21 3GMIA 3HNYM 2NP0A 2VZ1A 5AQIB 1CVNA 4LF4T 4HEAA 4YTNA 4MGTA 3TEZA 4GK5E 3M65A 5IW0A 4C0BA 2NMOA 2DVBA 3GZAA 1OEDC 3AE3A 5L3EB 4LTAA 3KV6A 1ZVFA 3I3DA 4XABA 5I0TA 1S35A 2QTWB 4L5GA 1ASJ3 4FXKB 3OPZA 4WVMA 1C28A 2YUCA 1T6GC 4ZI2C 2MD8C 4HWIB 5C4WB 5FXZA 3I54A 4XW3A 4AKRB 2WO7A 5LCWB 3H7YA 3D4KA 1QJEA 2HPLA 2E9XD 1ZRFA 1CAXA 3RHWA 1I6XA 1NCRB 3UGGA 5IYZE 3VD4A 2ECWA 3B5LB 3ZPVE 5FMDA 4TZDA 2IHR1 1SFYA 3AFGA 4LA3A 5LW9A 4NMIA 2UWBA 1W2NA 5KC5A 1IJ5A 3WP6A 1V6NA 4EN7B 4L58A 1MEC1 4QH4A 3MO4A 2BG9B 4NHKA 2Z42A 4UVCB 1IG3A 4XMIA 3AA6B 4IEUA 3UKTA 2LEHA 2VMIA 1F15A 1E5SA 4XTPA 1ZZ9A 3ZFGA 1AXKA 1LJ7A 1ENRA 5A7WA 3ZYRA 4HVQA 1R091 5C8YE 1IBMT 3U37A 2Q1FA 3ZYLA 4I02A 2JDHA 4IL7A 2KR4A 4TWHA 2V7JA 1NY71 2Q9QB 5D2AA 3C7OA 2PUYA 4FPKA 2E5VA 3BN6A 2VCMA 1ULOA 4JDOA 2AGSA 4CDWC 3CQCB 5AFBA 1C8M3 3MIDA 4JI8T 1A8DA 4RN5A 4ZS2A 1HN1A 2IXCA 1JYIA 2WWUA 4BLIA 3OGSA 5G04L 2MD7B 2WUHA 2WSSV 2RS12 2CSVA 2CNAA 5D21A 1DIWA 1UY2A 3T08A 3W21A 3NJYA 4ZZ5A 2E7AA 5DJQC 5LBBA 1BEV2 4IV3C 3I3MA 1VBE2 4EWEA 5IVVA 3EB6A 2VBPA 3MLJA 3VKMA 3WG2A 4NHYA 3VBRB 3KGZA 2D93A 2BVVA 4IEZA 5H6QB 4D69A 4I4TE 1FT9A 2YPJA 2V7MA 4XFIA 3HR9A 5BNQA 1QH6A 4MGIE 1OKQA 2ZM8A 3CQXC 4CCLA 2IZWA 3E0ZA 3G06A 3VKOA 3VKNA 3KLSA 2Y0IA 1DCSA 2A3XA 4HPKA 3RQUA 4P9YA 2ZX0A 4B3MT 2F6BA 2X05A 3VB9A 3PJQA 1VBB1 3MK7C 1XWHA 1Q8OA 4QD2A 2R6QA 3F95A 3ROUA 3OEAA 5D1KB 3VBOB 2RS11 4HKWA 2JKXA 1RITA 3WV6A 4E27A 5T5JA 4A45A 1UZZA 1BEV1 4YYOA 5L2LA 1NKGA 1VBE1 1GKBA 2MNYA 3DF0A 3H3LA 3N7LA 5JOYA 3UUNA 3NKTA 2CDPA 2W63A 4NIAA 1W09A 3MPBA 2JE8A 2ZEZA 4P0BA 5FL1A 2VVSA 5FZ7A 2WQ8A 3ZIXA 2KYUA 5FZ6A 5F32A 1OD3A 1RUD2 2YBSA 1LAJA 5C4WC 4HK9A 1W8OA 2CT2A 4BQ5A 4XILA 1MPXA 4JQRA 4SLIA 3FFQA 5I8SA 4LBMA 1NCRC 3VBUA 4OYKA 3PUAA 1B35B 3LPGA 3FHNA 2VMGA 2GC1A 1F62A 4YM2A 2K17A 5T50A 1F31A 3LKJA 1HR0T 2K0GA 3NJZA 2AEZA 2ID4A 3CHXA 1TG7A 2B8MA 2C0SA 4L97A 1HIXA 4GA9A 4JRAA 4W6WA 2KD7A 5L19A 2BG9C 2XBO2 3AKQA 3POSA 1YD8G 1JZ5A 5F7UA 4YLHA 4GKKT 1GZWA 3ILRA 4JGYB 2D8SA 1HJGA 1WEUA 1CAVA 4CDWA 3D3AA 3EMRA 3FBYA 3LA2A 5IFTA 4KWLA 3FUQA 4LFAT 1I1EA 2G43A 4RHV3 2W4XA 1WEWA 5FP4A 5FXWA 5K3QA 2E31A 4PLMA 3NSTA 3FJSA 3G6JB 2ZLYA 1RUD1 5C71A 1E57A 1BYHA 5LG4A 5CG9A 2Q9QC 4IV3A 2QYWA 4FFIA 4QX7B 4JHZA 1LGBA 2RHPA 3IPVB 5F3EA 2WZIA 1WESA 4OVEA 4AHZA 3T0DA 2FD4A 2X0YA 3OY8A 2PTFA 4D3WA 2ZGKA 4B4QA 2TEPA 2X51A 1W06A 4JC1A 2WDBA 5TRBA 1BK0A 3ZMUB 5FZ1A 1XNBA 4K0KT 3LBXA 1J83A 4ZXLA 4Q0PA 2N9DA 1ULCA 3IMMA 1UN1A 4XJWA 4XJUA 1W03A 4TN7A 3SITA 2VY0A 2XBO1 3H42B 3ASIA 1O3SA 3SCGA 3IHPA 4QX2A 1HW5A 3AJYA 3VBRC 2YYRA 3V5UA 2HWB2 4FK5A 2F4PA 4EYYR 3NNGA 4EEDA 3VD9A 3PUQA 4YVSB 1X9BA 1GZCA 1YKHB 5CGMA 4R2YA 4FIPA 1NOVA 3WY6A 3VZJA 1L0VA 4QKFA 3LF7A 4XMAA 1MQTB 2VZQA 4LJHA 5DMYA 2KWNA 4QQLA 2Y6LA 2A1XA 4XZCA 4NHXA 4MX3A 2P6CA 3M7AA 4U72A 2GP5A 3TBDA 3N5LA 4C90A 5EWSA 2VBDA 2VULA 5KHGA 1K12A 3FZMB 2J1DG 3VDDB 3VRBA 4QXBA 1W8UA 4COVA 5HBAA 2WQZC 4B8EA 3VBOC 5FZMA 4OK0A 5C3PA 4Z1VA 4O8SA 2M6IA 2VVFA 4CA1A 4YW1A 2JMKA 1QOTA 1FMWA 3RYCE 4JHTA 4NWWA 2LM9A 2CXDA 2M13A 1XE7A 5ABGA 1TE1B 5DXDA 1UMZA 3GHNA 5K9YA 5DZEA 1NCRA 2HWB1 4Z8XA 3GZUC 3L1ZB 3O1PA 4PW8A 5A32B 2HDPA 4JVAA 5A3PA 5FMBA 3LDKA 4JI4T 3MZKB 1B09A 1DP0A 2I45A 3BU7A 2BVMA 3WF3A 3RDIA 5FUNA 4GJZA 3QC9A 1FXZA 2BG9A 1QJU3 3RF1A 3FWEA 4RFRB 4AGVA 3ZFEB 5GZFA 4HG6B 3FBZA 3C64A 4AI6A 3CQOA 4NPPA 4ARXA 1VPHA 2B39A 1LOFC 2WIIB 3O70A 4LLBA 3AEBA 2RVAA 2VZUA 1B35C 3ZNIA 2OWAA 1MIVA 3RG0A 3IDAA 2YY1A 4ZOLE 4PT6A 1W6NA 5JPNB 1UNBA 4H7LA 1ZZ8A 4J6GA 4EN8B 4AG4A 4U7IA 2VE1A 1JU4A 2ZGQA 1R083 3I1AA 2WYSA 3OBRA 2OA2A 2QQUA 1AF9A 2CEAA 5FWEA 4PJNA 2VWAA 4KWKA 3KT4A 4JQTA 1MVQA 4JGYC 1AR92 5ADXL 2C5KT 5IK4A 3IF8B 3TLUA 4XJ9A 3GBGA 2VW0A 3F57A 5J1GA 3ZXKA 4UR9A 1G86A 3HCUA 1NG0A 2RJLA 1JNZA 4XFAA 5EP9A 3IDEA 3RPGB 3JCIA 2ERFA 3WHTA 1ZZ6A 2IXKA 4U2AA 3H9AA 2JQQA 2W92A 4NUBA 4AEJA 4UFJA 1OMIA 1H7CA 5TABA 3CJIC 3EB5A 4IEVA 4XQDA 3QB5K 2XHKA 1CN1A 4TWFA 4AXPA 3RLFF 4MV2A 3C50A 4JGZA 1AR73 3AYAA 3TOJA 3VBFA 5F3JA 4AI2A 4KUMB 1WE9A 4ZPIA 2ZZJA 2ZEWA 3J9X1 4YADA 4LIUA 2RDNA 3GHMA 2MNGA 1OVSA 2FMDA 1W8ZA 5EJZB 4QPYA 2R042 4AAPA 5C3OA 1NT0A 3FJUB 5DG1A 3PDQA 2X29A 2CKLA 1PVXA 3H8OA 1NQDA 1RUH3 1OEDE 2YPDA 1KEXA 3WI3A 3LE0A 1D4M3 1AR91 5C3JA 2A3DA 4YVSC 4EYUA 3ZT7A 1CX4A 1TVGA 1F35A 4NIIA 5EJ1B 4D0QA 5FP3A 1JHJA 1SCRA 2VUJA 5KXEA 4OZXA 1ND2A 4NRMA 4ADZA 1MQTC 3LEGA 2VTXA 1X50A 1T2XA 1D4VB 4QPGC 1NX9A 3ZYPA 2BKOA 3PUYF 2PN5A 3WP3A 5FPUA 2HH7A 4Y22B 4IGQA 1CUNA 3HI2A 1APNA 4DVDA 1TQ5A 4TLFA 4XOGA 2GMEA 4FO9A 4P00B 1US3A 4P5YA 1VBA3 2FSAA 4OHVA 3IDBB 2UUBT 3NNLA 2R041 2JWPA 4LBNA 4LBQB 4XBQA 4UI9L 3ZMVB 1XNQT 3MLLA 4CPBA 1OF3A 2K24A 4E4DX 4QHOA 1W3XA 2WC2A 5I0DA 1BVVA 2WT0A 5G05B 4OX9T 1JU3A 4TX5A 4Y1YA 2DU1A 5F5AA 3MKDA 2VMDA 4UFIA 5CFDA 2R32A 3HN3A 3N2GE 4YPJA 1SUMB 3FZFB 2YHNA 4DV3T 4R4ZA 3CJXA 2H6BA 2RS53 3L11A 1AR82 1CX1A 1O59A 2QQVA 2X67A 4DXZA 1W8HA 2XY8B 1UF2C 3ZFEC 4M3CE 1ULFA 2CMRA 3H3MA 2ZGLA 2CBJA 3B9CA 5CA0E 5DUVA 1Y9MA 1OA4A 3HWJA 1L7LA 2D6MA 3JBG3 4AVCA 1CQ9A 3QH6A 3O14A 3TAYA 2KR2A 3HD8B 1DGRA 4WBNE 3VL9A 2OV9A 5HCJA 4KMCA 4KH9A 4FPJA 1DQ5A 3LIHA 5FYYA 4V3LC 2HWF1 3JU9A 3CJIA 3MIFA 3W5MA 3WG3A 4OFGA 1S94A 1REEA 1WLWA 1RIRA 3UGFA 2BS2A 3IZOA 1IHMA 5FZBA 4WW0A 5FP9A 4DIQA 3NV2A 1IS3A 2R062 1KFYA 1SLBA 2YB7A 3GN5A 4Y1XA 3NVCA 2DFCA 3ST7A 3DYPA 4CCEA 1MS8A 4Z2WA 3RPGC 2X0LB 3C7FA 1EAH2 2OW4A 4Q0UA 3LA3A 1ENSA 1AR81 2X66A 4Y5Z0 4LORA 1QQP2 3Q8BA 1HLCA 4AVAA 4YGCA 2V7LA 4Q0SA 2LSIA 1RHI3 4Z8BA 4E7ZA 5F1RA 3ZN1B 3UL2A 2MNZA 1E5HA 4YVSA 1PIV2 4AP4A 3CX6B 1COV3 2XASB 1JZ7A 5DQWA 3ZDVA 1F4HA 1H1IA 4BZ4A 2JIWA 4NHMA 5I8TA 3AKTA 1JYVA 1O3XA 1V0AA 1MQTA 4DZGA 5F8PA 2WZEA 2V6XA 4IHJE 4A7ZA 4P9GA 4EAHA 4QPGA 3NJXA 5LZ6A 2J7MA 3RRCA 4AKHA 2VOVA 4B3ST 4GKJT 2ARBA 3SKVA 4H63V 2R061 2XJVA 2UWAA 4XJ8A 4RA0A 3RZLA 2ECVA 3OTFA 2H0DB 3O4XE 1UYYA 3U07A 1JW6A 3DUIA 5ETWA 1R1A2 4Q4W3 4RQPB 3AMNA 4FJOA 1LEMA 4Y20A 1UW8A 3UYJA 3ZKUA 3C4XA 3ETVA 4QQPA 1LDKC 2LN0A 3HKCE 2AACA 2I6HA 3O0WA 4NPMA 2X9YA 1QQP1 3CBNA 3UUMA 1YJKA 4H63H 4K40A 2RMU3 2M6MA 3VHLA 5GLVA 2FDKA 3BTYA 5KXJA 1PIV1 3OGRA 4IEOA 1H1AA 1ZBE2 4I2OA 3K3QC 3QACA 3U0ZA 4AQFC 4LE4A 2BOJA 3AMHA 3H50A 4LKFA 3HAGA 5LEJA 2ADDA 5F37A 3PVEA 2RM23 1O7FA 4CP1A 3NAPB 3ZFEA 3OPCA 3ANWA 2YEVC 2W39A 2VNGA 5E0OA 3LSEA 4CSWA 3JD71 4N7UA 1E5RA 2XHNA 3AEAA 1VLNA 3HQUA 1YO8A 1HQLA 4CEWB 2NN8A 5JIAA 3N36A 1KEYA 5DUWA 3I97A 4JDMA 2YSMA 4LHKA 1YHFA 1W6OB 1JN2P 2FZ1A 1R1A1 4W8JA 4PFOA 4NR1A 2ORXA 5C5TA 3L2YA 3JCFA 2F6JA 3L8RA 1EUTA 3KV4A 2KGGA 2MAWA 5JVVA 4FP2A 1CZVA 3SISA 1O4YA 2EHOB 3KVBA 1UCUA 1Y9QA 4CDQB 5B77A 2NLRA 2GALA 3AP5A 3N9QA 5A7SA 2JDAA 1ZBE1 4Q4V2 1RUF2 4DB5A 3PJAA 3RZHA 2ORZA 4Y3OA 1HFAA 1JZ4A 1MEC3 5FZ4A 3O1UA 2ZGRA 1W9TA 1WKYA 3KB5A 3NWKA 3E5UA 4Z07A 3HOBA 4HWDA 5B78A 3ZYHA 1Q5OA 1V6MA 1JI6A 3HCTA 4Y26A 5IVFA 2A5ZA 3J8F3 2D6PA 1LNSA 1ND3A 2CY6A 3CKHA 1G73A 5FV3A 1YIFA 4NIGA 1R093 4LULA 4PLOA 4TNVA 4UVBB 3MEPA 4YZ1A 3FXEB 4UFHA 4QQOA 4A3ZA 3VR9A 2VJEA 4N43A 2WP9A 3CKDA 5AQKB 1W3VA 1W8WA 3PURA 3A7QA 4IV1A 1CPMA 4M3CF 3PJAJ 1LTEA 4NRQA 3FM8C 2BFUL 4LUKA 4AGRA 2LXPC 4LIVA 4EOZB 4CI1B 1XQNA 4UT5A 5JI9A 1O91A 1SDDB 2D6KA 2KM2A 3M63A 4Q4V1 1RUF1 3JZVA 4XACA 2VMFA 4HZFA 3NNJA 4A7YA 5GLTA 5FY7A 5IK7A 3L09A 1VE0A 1FX5A 3OCPA 1QGLA 4C1WA 2L7PA 4ZUXU 4U31A 4V3KC 3UESA 4PK5A 4AISA 5HXRA 4DMVA 1UY1A 5B4XA 4PFPA 2VNFA 5L3FB 1YIPA 3IWZA 3ZXDA 4A3XA 5A3TA 5FZ9A 2LRLA 1OXCA 1UL9A 3ONJA 1HV1A 4HN0A 5H1TA 3MA9A 4U2ZA 4KWUA 2WLPA 1UU4A 4MYEA 3JUUA 3SH5A 2MA6A 3KF3A 4ET7A 3M62A 2XPKA 3AXEA 1IZNB 5EFUA 1LHVA 1LHWA 1UX4A 4B4RA 3HL6A 1RMU2 2B46X 2C26A 5BPXA 2JJ6A 2WNVB 4QQ2A 2PLV2 1NYWA 2XKOA 4KI5M 5F5IA 1VBB3 2Y6JA 4Q27A 5JI7A 2KREA 3AFKA 5E6HA 2DURA 2YBKA 3MV01 1LKNA 3VLBB 1D1AA 2W0GA 3U5NA 4I7BA 1D0ZA 3DWDA 2L8KA 1V6KA 2RS13 2XQ3A 2VW2A 1EP0A 1S0JA 3KCYA 2N2NA 3DPLR 2JMIA 4XHBA 2J42A 2NMNA 4DY5A 4LBLA 1BR2A 1BEV3 1YXRA 3IIIA 1CJPA 5FK8A 4UFMA 2ZMAA 3WDWA 4B4PA 5JDLA 1F4AA 2W1WA 3I4IA 3RYHE 5FKBA 3RQWA 1SZBA 1WEPA 2XAQB 2M67A 4XDOA 5I91A 4L2NA 3LDYA 2D5UA 4S2DA 5AVPA 5FYZA 4CU7A 3U14A 5T54A 2QQWA 5A3WA 4DEQA 2VH9A 4A98A 4A56A 4YW4A 4HVOA 4Z2AA 2ETEA 3B3QE 3HA4A 2C1FA 5FY8A 3TEXA 1NAEA 3URFA 3E5QA 3LJCA 2YYOA 2ZMKA 1Q3EA 1WFDA 2UWCA 3T9KA 1YNAA 2EHOC 4JLEA 1RMU1 3FC0A 4D7TA 4GWJA 2PLV1 2FDGA 1J84A 2VR4A 1US2A 1RJ8A 2VUAA 4WBBA 5FK7A 3PTYA 3ZPV1 3S7EA 2BV4A 2YFZA 1ENQA 1QOOA 2LM3A 1QIQA 2JRJA 4GOUA 2L43A 3ZXGA 3H8UA 3MIEA 4MO3M 4QPIB 5H1VA 1AJKA 1ST8A 4QX8B 4QH5A 2CGOA 4PDWB 1T1HA 4BQ3A 2XQ7A 1XBFA 1GBGA 5H9SA 1J1LA 3NRXA 5GZDA 2D9DA 5F2SA 3IA3A 1GUIA 1M7KA 3WF2A 3ME2A 2VNOA 3BTAA 2CSYA 2CLYB 4YATA 1S2EA 2Y6XA 2VASA 3RYRA 3K51A 1UURA 5JPMB 4ASKA 1SACA 1MNDA 1DQ1A 3AC0A 1RUD3 2OS2A 3S5QA 4HLTA 4LHSA 2A3YA 5C7GA 2ECJA 3I9YA 1G8WA 4EN6B 4IDNA 2ECTA 2R1DA 3KT7A 5CYYA 2CSZA 4FPOB 5HCBA 3ZYBA 2OXQC 1OXZA 1QXRA 2JENA 2CRRA 3USSA 2XAGB 2LLYA 1Y9GA 1GZTA 5AFEA 4GWNA 1K5MB 2WDQA 3RIUC 4ISQA 2ODVA 3KV9A 3TWIA 2W2UA 3KDSE 3AZXA 2GSYA 5DPNA 1VRH2 1HCIA 1X8MA 3ZSLA 1FJGT 1XNKA 5CB4E 3TNQA 4B7EA 2WS3A 1UWWA 2K4DA 4YM1A 5FZHA 5FR3A 2D5FA 2LGLA 2GMPA 2XG3A 4FFGA 3MZHA 4FQZA 2VK9A 2BP6A 2GAUA 2JDYA 3MFCA 2O0OA 4AWDA 2YHOA 1ZZ7A 3BOPA 2KZ7B 4AI3A 4SBVA 4QU1A 3CVRA 4UF0B 1H1MA 5AQMB 4JTNA 3WG4A 4C8DA 3N9PA 1UOBA 3ZCIA 5L47A 1CIYA 1ZRRA 3OF1A 4IEYA 2WWVA 4LITA 3AB3B 4COZA 1L7RA 4WZFA 5CU1A 5JDHA 4K8RB 1PZ7A 4ZI3C 1OLME 1RUJ1 1HNZT 1WLDA 4YJ2E 4CTEA 4C91A 3A8YC 1REFA 4CN6A 2PHXA 3IMNA 3MXZA 2BGPA 1VRH1 2VPVA 2ZGOA 2R7EB 1PM7A 3RRDA 3BPZA 2Y8KA 4TXWA 2JDZA 4QQHA 5IYYA 3SKJE 4X1YE 2QQIA 2BDRA 4NAMA 2HWC2 2VOWA 4NUVA 2FD8A 1WEMA 2ZBJA 1UCXA 5FNVE 3IKWA 4HT1T 4Y4YA 5I0SA 3RMYA 4LEJA 1H2LA 3CQGB 1N1TA 1C1LA 2XDVA 2B0OE 3KT1A 1XMOT 5FYVA 3ZYKA 4LUMA 2A71A 5FEYA 3RMXA 2VB6A 1JNRA 2E9XB 2I2SA 4LBKA 1N3PA 4IC2A 2MA5A 4LE3A 4LHLA 1GNYA 3R0RA 2X5IA 3ZSKA 3ZEFB 4AKLA 1Y3TA 3VZLA 1H8TB 3IEEA 3C3VA 2WQ4A 4Q4X2 1N87A 3AKPA 4QWNA 2VJFB 1D0HA 5IJRA 1UYPA 5HCAA 3GDBA 2UXNB 2WSVA 2V4AA 4AFBA 4Y4RA 2EIBA 3AZYA 1G9CA 3WW3A 2FBEA 3J7HA 4NXNT 5A6YA 2XOCA 2BNOA 2NTXA 4UWDA 4BQWA 4QPIC 4IIJE 4N53A 1KRIA 1NE6A 2ZGMA 1OD5A 4PDWC 2CCQA 1X9TA 1KFUL 3CMLA 4XJAA 4W6XA 4JRLA 3EHKA 4IEWA 4WM8A 3DV8A 3HPNA 3H1MA 4CDXA 2FUPA 4TYSA 4N9HA 4AI1A 1CAUA 5KDMC 4GB32 3NG2A 4LF9T 1KQRA 2LRKA 4LO4B 4IGPA 4RGGA 3LOIA 4GNEA 1UYXA 2LRPA 1HX6A 3POYA 3B01A 3I3QA 2XPJA 4QXCB 4CCNA 4GH4B 1VBD2 2XJ7A 4YGEA 3ZVYA 1HQWA 2O8OA 5AC93 1XSQA 5DINA 1WLTA 2HYKA 4Q4X1 3O7OA 1US7B 1SLAA 5FZLA 1K5MC 5IATA 1CAWA 5K4LA 2ZGUA 3VKLA 2D6NA 4Z90A 2YREA 1GWKA 4LKDA 2K5BB 4IW3A 5ABJA 3FHQA 4OI4A 1O5LA 1S2KA 1QNWA 4FOWA 2OXBA 4YW2A 5A33B 4MUVA 3T1LA 4KG8A 2VJXA 3MIGA 3PUHA 4XAAA 5AQFB 3WF0A 5G04B 2NR4A 4LO5B 5H9QA 1IAPA 4HXCA 3ZMZB 2PQSA 1YI7A 4GB31 2GZWA 1LENA 1ALYA 2XLAA 2WAOA 2BU9A 1JOBA 3PL0A 4DFSA 2CONA 5JDBA 2W62A 3TLTA 5T55A 3MYXA 1VBD1 2QQLA 3SLIA 1N36T 3X29B 3FHAA 1GQPA 4MSXA 5C9AA 5ANNA 3W59A 5FB1A 1YEWA 2CGNA 5B76A 3W5NA 1SPPA 2WN3A 5DAVA 2FJAA 3A21A 1PK6A 1S2BA 3ABZA 2KWIB 2R043 1SQ4A 4MFRA 3H7JA 5FZOB 2P57A 4O2BE 4QXHB 5LOVE 3H3UA 4H14A 2P34A 2LW8A 1XE8A 2ENRA 4WVVA 2W08A 4LK9A 1RMDA 2RI7A 1Q8PA 1S0EA 5L73A 4AFDA 1LVFA 1QKQA 2LM2A 3I59B 4CYDA 3P4QA 3QH7A 2VPEA 1DG6A 2JG9A 4EEBA 4H3WA 1U5PA 3CLPA 5LYJE 1Z7S2 4C0HA 2WT1A 3SC7X 5L3CB 1HG2A 4CP0A 1HRV3 2E9XC 1WZXA 4EN0A 4P9WA 4GB0A 1XNTA 1AZDA 4P0AA 2OKXA 1SA0E 1YJLA 4PI0A 4H9RC 3VHRA 3INAA 3BODA 3H8RA 4XCBA 4N90A 3NZPA 3GJBA 3GM8A 4RSUA 2IMLA 3E6DA 3V0BB 1V6OA 4BYYA 2ARXA 5C11A 1HN0A 4L92A 2JQ9A 4MLOA 3PUXF 2QBXA 4XFBA 2I0MA 5AQTB 1FMD3 3C6WA 2EIDA 5FZGA 1XMQT 3W9AA 2BAYA 3VV1A 1N3OA 4IXLA 1KNPA 3N9NA 4GK0E 2HWF3 4Q29A 5JR9B 4QX0A 3MJXA 1C5HA 3UULA 1IG0A 1UKRA 1PZ9A 4B1MA 4XQWA 2EALA 5LA0A 2WAAA 2YT5A 2IXIA 5H9PA 1TME1 4XF4A 1RUOA 4AQTA 3I9WA 3O12A 5DG2A 1MS3A 3AMQA 1Z7S1 3T09A 3WR0A 5BNPB 1D1CA 4AF9A 4NIHA 1VCTA 3CX7B 1AL0G 2IXLA 5FBJA 3VZKA 3KZ4C 4S2HA 4LOTA 1ACCA 4YVWB 3JB4C 3K3NA 5FO7B 3ZO0B 2JD4A 3LK2B 3AE6A 2D2SA 4G9SB 3ONLC 2RDQA 4WNKA 3CEWA 4I30A 5L9VA 5I3LA 5L7OA 5FL0A 2AC1A 4IE7A 4MHCA 1JUHA 3FANA 2DCZA 2YVRA 5DZFA 4IC3A 4AEDB 4FXGB 3VD3A 2Q1ZB 1R8IA 4XF3A 1IS4A 1MNEA 2XVGA 4QGLA 2Q8DA 2DU0A 2R063 1E1HB 3N9MA 2NP9A 4E2GA 4DV6T 2WDRA 1NAFA 3UT0A 1UIKA 1JZ3A 3VKFC 4EXTA 4AVXA 1PX3A 3FBLA 1RUC1 3WZ1A 2ZKLA 3UQ4A 4CXXA 4OHXA 1MMAA 2XOMA 3SHBA 2D3PA 5F6KA 4L11A 5BNNA 1QQP3 2A2FX 3EB7A 1ODNA 3AMPA 1XOYA 3TN92 1YLLA 2J1EA 1UIJA 3ZJ1A 4BQ1A 5LGTB 1W28A 2J1VA 1PIV3 2WYFA 2LTNA 1FYUA 2G9GA 4BJ0A 3WQ7A 3THPA 1GP5A 1W6PA 4P5OB 2P1BA 5K0UB 4JKMA 1OLMA 1FNZA 4M0NA 3WP4A 5A6QA 4FQ4A 5EYYA 3AE4A 1VMHA 5ACA3 1FAYA 4LADB 5LKZA 3KV5A 2ARAA 5CADA 5JSRA 3JD73 2AE9A 3CL1A 2VQ0A 5CEHA 2YC0A 4WVMB 4QQ4A 2X0HA 3RWNA 3P4PA 4CP9A 4ATEA 4AEMA 1I6ZA 4ONUA 1H4GA 1I5ZA 5SVYA 2LGVA 4Q25A 2VC9A 3ENRA 4UW5A 1CAXB 4PPEA 4F6RC 5GZCA 4YJ3E 2LS6A 4PK6A 3UV9A 4META 3OPTA 4ZONA 4YSZA 2BVLA 2JG8A 3L2HA 2V1DB 1IS6A 4LPLA 4WYVA 1E7PA 3TN91 3OVUA 1JOPA 3EUHA 1QXPA 2E53A 5JRCA 4A49A 2O14A 2AENA 2LOSA 1AHSA 2H3RA 1XYNA 5AQUB 4R8PK 2WR9A 5KHJA 5JR9C 3CNAA 5GLZA 3ZFGB 3P1IA 4YHHT 5A7WB 2RDRA 2DCTA 3VBHA 4AL9A 2C0ZA 2O1QA 2X68A 2YQLA 5AQLB 4Y5TA 4EGWA 3GBWA 2UU9T 1UX7A 4ARYA 5BNPC 2HH9A 5H6RB 3H8XA 3H1WA 4CXYA 1UPIA 1OLQA 3W15B 2A6YA 5IAVA 4U74A 1HS7A 4YVWC 1WA6X 1PMIA 1QU0A 1FBVA 4BAYB 4HONA 4OI0A 4MG2A 5AITA 4U36A 2WQYA 2JDNA 2UYAA 2H89A 1RUF3 1UD1A 1Y43B 1N32T 4QMAA 2E8IA 3SH4A 2JJ9A 4IETA 2E9QA 3D82A 2JMHA 2ODUA 1WD4A 1WENA 1I5PA 5F3IA 1ZHCA 5IWAT 1HF8A 3J7NA 3W20A 2YMZA 2E61A 5FVLA 4Y24A 2E6RA 1G25A 2LHNA 4U3CA 3PLWA 1OOPC 2KMFA 5IVCA 2J4GA 4JEUB 5IVJA 3Q5EA 3RRWA 4MXWA 5LHHB 1H8VA 1RXFA 3SQOA 4ZU4A 5FZAA 2KT9A 4G3YC 3K2OA 1AR63 4HPKB 1Z8UA 2QKDA 1ZOYA 3B9IA 3O1TA 1LODA 4BPZA 1AXYA 1J3PA 1SDWA 1J5ET 3ZXFA 1YQ6A 4QXHA 4AQ2A 4L0PA 1BKZA 2JDUA 3OBVE 3DKQA 4Z92B 1AXZA 4HANA 1EYBA 1XU2A 4UVAB 1V70A 4DUWA 2CTVA 2IXHA 1JOCA 1AYN3 2WNEA 1ULDA 3WNPA 5KXBA 1KD7A 5FZIA 5K0UC 3HBZA 1H6YA 1AYM2 2XQRA 5FUIA 5C33A 2B5HA 3U11A 3KD4A 5JTGA 5LBCA 2IUWA 4BLJA 4YY3T 4EB6E 4Z82A 4CRQA 2R073 2RR12 1AL22 1X9PA 2VUCA 4YGDA 1W9YA 2AUYA 2OA5A 4BHWA 3A0KA 1Z60A 4JV4A 2D44A 5DAPA 3AXDA 3FXDB 1RUE2 2JDKA 2DYCA 3OJAA 2R1BA 3T3YA 4TTGA 2HWE3 1E4UA 4V2VA 4I0AA 4NIDA 3VBSA 5JDFA 3V56A 4AQGA 4UFKA 3VBUB 2PFVA 4J1WA 1R1ZA 2G0UA 1JUIA 5CAZA 3FHIB 5HYAA 4ZEYA 3SRZA 2LT3A 4QX1A 1MMGA 3LCPA 2UYBA 2PLV3 2W1QA 3Q8EA 2QQPA 1UAIA 1EV11 2AN6A 3QUJA 3PVNA 1NCQA 3SFDA 4QB6A 5C8CA 3NZQA 1PNGA 1GZWB 4W50A 1AYM1 2QVAA 4AHWA 2DUPA 4P9IA 1CAVB 3TLVA 5H9MA 2E26A 4IQPA 1H2KA 3KF5A 1ZBDB 2E6VA 4AR2A 1A34A 5CFCA 5JQGE 1UZWA 2YW8A 3I2FA 1AL21 1OQEA 3VZOA 3OYZA 3AEGA 5I0RA 1HX1B 1ASJ2 2FFWA 1WEVA 4AGGA 3RJ2X 3TEWA 5LK5A 3M3OA 3NQHA 2XAHB 3Q1DA 3SOWA 3WW2A 4AYUA 3ZT6A 4CZZB 1RUE1 1YQ3A 3M3ZB 3J7LA 3AM2A 3OY8B 1HQNA 5FP8A 3V0AA 2NZ9A 3KHCA 4FPHA 5GJ6A 2FUIA 3RNSA 1FV3A 4FPEA 3LBXB 2XL9A 3C7EA 2B76A 3FAOA 1OOPA 2EODA 4DR5T 2D3SA 1OFSA 5JDNA 3QOPA 4TN7B 2MUMA 4EN9B 3MDBC 2ZETC 2HYXA 2XVLA 3CF6E 4YG3A 4F83A 2G9ZA 3N2OA 1LVKA 2FUUA 5LA9A 4AXOA 4YTPA 4A4CA 5CA1E 3MIHA 4NWVA 1K2FA 2Y6GA 2VBBA 3KWVA 4XTMA 3C98B 3TLWA 4RS5C 4YTMA 4ZDTA 5L3DB 1DU2A 1ASJ1 4D8MA 1KITA 5JCTA 3JUEA 2JUNA 2KWKA 4XUPA 3LQHA 4QDQA 4R9AA 5AIUA 5JLVA 3T1YT 3VHNA 4O7XA 3AEFA 4OHYA 1PX4A 4N8MA 1U5ZA 5JIUA 4BE3A 3BU0A 4DV1T 2VNVA 3T0AA 1H4HA 2VMHA 1XB9A 5LXTE 1IS5A 1UY0A 2RR4A 4K20A 5LBQB 5LATA 3LD8A 4Q2FA 4QXBB 2Z4FA 1OLRA 2IW5B 2DCFA 3SUBA 3ZYQA 1RUJ3 1UGOA 4B7YC 5LA1A 1BMV2 2IVJA 4HL0A 3SEPA 2HWD3 3ZVXA 3ZSJA 2PTMA 3Q9OA 3O1VA 4R9BA 3R05A 3WD5A 5ERLA 4OMCA 4P9XA 3RS6A 3PHDA 2TNFA 4FOQA 4NOTA 3EABA 4I0UA 3MBWA 2XZEA 3DDTA 2D40A 1SFPA 3MUY1 1D0GA 3N3HA 1LOBA 3ZC1A 1WGMA 4XI1A 2CSGA 2EF6A 5CBLA 4W6YA 5FY5A 5IT6A 3FEHA 1NE4A 2WCAA 2RSDA 4KU8A 4AQYT 4UBHA 5LJNA 2VCBA 3ZKRA 5DAXA 4IL9A 4KHZF 3AX4A 3OGJA 4PI2A 4R4XA 3VBUC 4DNYA 1B7TA 1ZX5A 3BGAA 2CWMA 3BI3A 2V5CA 1OA3A 3B93A 1J5WA 1NLSA 3RI5A 5C3SA 3ASLA 1W6NB 3ON7A 4RYDA 2YUEA 3OOXA 3WX5A 1DCQA 2ES0A 4O65A 5DZGA 1Q56A 4PQQA 5J2UE 1BMV1 1WA4A 2Y1MA 2DV9A 4QDRA 5HXHA 3DQVR 1IPJA 3DYMA 1JH5A 4H55A 3T4VA 2EGMA 2ZKNA 1YKEB 1GOGA 3CIRA 2Y60A 2G6QA 2MHFA 5HI0A 1VB4A 4XEZA 1EY2A 2DVFA 4HK8A 4B3NA 4K3UA 3O1SA 1XRUA 1OUXA 4J2CA 2CBIA 1DGRN 5CISA 4TV9E 2WRAA 1GQHA 1G8XA 4HOOA 4JGZB 1BQPA 3VBFB 5LBEA 5BMVE 2XVKA 3N7MA 1O3QA 4BJMA 2HEWF 2PHFA 1SFNA 4XYXA 2F6NA 2R30A 4YGBA 4DV7T 4ZI7E 5G05L 2ZGTA 2MTQA 4GYSA 3IDCB 4RS5A 4BIOA 3CWZB 2GH2A 4Q4X3 3AAIA 1AVBA 3RJRA 5FFOC 5J3XA 4X3GA 1NA1A 1YQ4A 2OIIA 3THCA 2W00A 5JR7B 4KMQA 5CKNA 2BWAA 3RZZA 4Q6FA 2CKLB 4EV6A 2VKJA 2ZABA 4B1LA 4CCOA 4XZUG 1ZKEA 1Z6UA 3AA7B 1HV0A 2W3JA 3GCXA 1CPNA 4YWAA 1O4TA 4P9JA 3DCQA 4HETA 1JBCA 4IGUA 1FP0A 5JZGC 2R0FA 4CUGA 2XUEA 2YOEA 2ZHKA 1OH3A 5B2GB 3LEKA 3RYIE 3KBUA 1HKDA 2HLEA 4RHV2 2VP7A 1ND2B 4A4AA 1PNFA 2OQ7A 1LGNA 4XBFB 4AAXA 4M4PA 3DXUA 1JOJA 1D0XA 5HEGA 1Y4WA 5L4EA 2VNRA 2Z79A 4GB33 2R6GF 1OQDA 1X4UA 4PTBA 1YCIA 4EROA 2G1MA 4LK6A 1N1SA 4K6BA 3OD0A 4JI3T 2ZAAA 1FV2A 2JQHA 2CAUA 4NO4A 4L0RA 3OB8A 5HEJA 4CCMA 2IQJA 2MKEA 4ZZBA 1SHWB 2WZR2 4BBQA 4F8HA 1VBD3 1X33A 3PUVF 4KP3C 2GC3A 1T98A 2JB4A 1LRZA 3IBPA 1HB2A 4UP5A 5F3GA 3AL5A 5FQ0A 1PM4A 1GR3A 4JI1T 3AEEA 4P08A 3VZMA 5BV6A 2N7GA 3WOGA 4OZOA 5CFDB 4JI6T 1GOFA 4X1KE 4N9IA 2ECNA 2HN1A 2XQ9A 4LMJA 2F42A 4XF9A 2M3HA 5LEKA 4DUXA 1J1JA 4RHV1 4W4ZA 4ZZCA 5HWYA 2CM0A 1ZYBA 4KGGA 5A1FA 2BFUS 2LJLA 2Z69A 4ASMB 2PFWA 4QGNA 1YQ8A 1DQ6A 4RR3C 4CEYA 3O1IA 2LKHA 5SV5A 5FUPA 5KHHA 4I7CA 1NXD1 2EICA 1VBC3 2VCCA 1S55A 3ACIA 4KBMB 5A1LA 5DDJ3 2W95A 2P37A 2VZSA 2WZR1 4Q1PA 1YWKA 3HNMA 4DR7T 2QQKA 3HN1A 2UXBT 3I2IA 3ZR6A 4LMFA 3CJIB 3X1DA 4JAAA 2JICA 2EXJA 4ZS3A 4XCAA 5CFBA 3TYJA 2IXJA 5T5LA 3LRQA 5FOJB 1ODMA 3WNKA 2QUOA 3EHZA 3GN5B 4DQAA 2UXXB 4MBQA 1ZNPA 2V6YA 3U3IA 5A3MA 5FZDA 1DDLA 3AZVA 2AEYA 2WFF2 2ZM6T 5CVRA 1TME3 3RKOA 1SBEA 1F9KA 2D98A 1H6XA 4QF3A 3VGIA 3UU4A 2HPJA 4BQ4A 4W65A 2AXDS 4JGZC 1KFXL 3OBZA 5FERA 3VBFC 4URAA 1GLHA 4YW5A 4HFSA 1PGL2 2Y6FA 1X4IA 2PHRA 1YQCA 2CRBA 5JZGA 4A2UA 3T2OA 2DWKA 2Q8CA 3B7MA 1GICA 3N9OA 3I0QA 1R082 1XXNA 4QPGB 3ZYMA 2AREA 4O61A 4QHZA 1HDKA 3RIAA 1IBLT 4LJNA 2WNUC 5KC6A 1VJ2A 2DVAA 4YLZA 2B1EA 5JAXA 3LQIA 1QJZA 1VMJA 4KU7A 3B57A 5FREA 1A78A 2ZX3A 2JECA 4AKGA 1JYCA 3IHRA 1V9U2 3S5AA 4BA9A 2WFF1 4OGCA 2C2VS 4ZKTB 2JMJA 2YDRA 5LMNT 1ND2C 1CD3G 4Y20B 5AFUL 1ULGA 2RG4A 4LKSA 3EDUA 1WW4A 4A42A 1CESA 2A73B 3NRUA 4MADA 2VKOA 2IUBA 4AOCA 1RUC3 1AR72 5ABHA 3K4DA 5FXXA 4NE9A 2V7KA 1PGL1 2BBJA 1A6CA 1OFNA 1W2TA 3WW1A 3LDQB 2A6WA 2VQUA 3LK3B 4DPNA 2BVBA 4K21A 1MZ5A 3KSCA 4ASLA 5DABA 1UOGA 2H7VC 4P09A 1U5YA 5AQJB 1R081 4PHZA 3LFMA 4Q4Y3 3O1MA 1RUH2 4XE9A 3TLSA 3ANWB 3HJRA 1XDPA 3POIA 4A44A 4RR3A 3AA0B 3DP7A 3KINB 1WCSA 1UXXX 3FZHB 1D4M2 2LGGA 1X36A 4XC9A 4RGKA 1S4CA 5CFDC 4XF1A 4WM7A 1Y64B 1ZZBA 4BXFA 1FIOA 1V9U1 3ETQA 3WDTA 2WFPA 2VOTA 3VHOA 3P4RA 3PNAA 4QB1A 4BOWA 2VQET 4FPLA 4AHYA 3RYKA 3ZR5A 2ZM0A 1QJFA 2WB5A 4XAXB 2KU3A 4LT5A 1WYCA 3MHHA 2I59A 1CR7A 4DUZT 4KX6A 2OPWA 3LFIA 4JX0A 2CA5A 3I3BA 3EBRA 3GZTB 2EVXA 4MGQA 1F5FA 4NJ4A 1AR71 1J1TA 1V6LA 2OYZA 2H6CA 4YFZA 2WY2A 3Q5XA 4DV5T 3P7IA 4YFWA 4CE8A 1N47A 1VBA2 3B13A 1RTVA 1GFF2 5FO8B 3BQKA 5KH7A 1JZ6A 3VDAA 4XBNA 2LROA 3AJZA 5L9BA 4Q26A 5FKCA 1QOSA 2FJBA 1Q8QA 1RUH1 5FVKA 5F9TA 2WS92 2LDRA 4H9DA 3RSJA 3VDBA 3FMGA 1ND3B 4IESA 2Q8EA 2YINA 1UPSA 3S0MA 4B3TT 4MVTA 1M62A 1JM7A 3WCRA 1Z78A 4EV0A 1HG5A 3AAEB 2W1UA 2C24A 5M0TA 3LDRA 1SLTA 4E4SA 1HB3A 2K16A 2W67A 2RS52 1FOD2 2VJEB 4N43B 2ZX1A 4Q0VA 4OUSA 1UZYA 4AI9A 5JXGA 4IV1B 5JUVA 2HJIA 5JOXA 2FHRA 2WNUA 3VL8A 2JIGA 4YFSA 5IVYA 2DCKA 3KMHA 3HKEE 4QH1A 1S0CA 1LEDA 3O0VA 2Z6EA 3CDZB 4NHLA 3K48A 1XC6A 3M7KA 5JXJA 5JXHA 3AEDA 3WINE 3UGHA 3E5XA 1VBA1 4BK5A 1YI9A 4FT8A 3DPRA 4IERA 5HV0A 3WLUA 3SCFA 2QFEA 1U5IA 3ETUA 1UOFA 5C3QA 1IOAA 3JC6D 4OQ9A 2WS91 1Z2QA 1RINA 3OYWA 1POV1 5C2TA 1WLCA 4O9EA 5KXDA 4B29A 2C9KA 2Q4SA 4CZSA 2ZMNA 1HB1A 4AFMA 1OQ1A 2VPGA 4UW4A 4H9NC 5HEHA 1FOD1 3BQLA 1X8EA 1W2UA 3WDVA 3MPPG 1RYYA 4MGYE 4NROA 3ZJ2A 3A22A 4HN9A 4IEPA 5JXIA 3CIHA 4COYA 3FUOA 1L3JA 2IIUA 2GC2A 4A0CD 3VDCA 5J0ZA 4WZ0A 1SLCA 1UO9A 2WZ8A 3HBKA 1COV2 4XF0A 2NW8A 3H0OA 2PAKA 1OT5A 2BNNA 4UYBA 3PTRB 3WAKA 3AZZA 2K3WA 3MHSA 1VIWB 4EJRA 2XTLA 3NRYA 3AE5A 4CUAA 3DN7A 1PO13 2YC2A 5FDBA 3M3EA 1KS4A 4GIWA 4ZY9A 3UUXB 1FEWA 3Q8CA 1W05A 4BM8A 3PUIA 1BHGA 1GV9A 2IC9A 4UAPA 2BBHA 5EV7A 4CCCA 2CPTA 2Y33A 4XFHA 2W1SA 4LLOA 3MFAA 2DVGA 4BQXA 4YT0A 1XWMA 1NWMX 3HEIA 3SH3A 5EK3A 1G6NA 4U33A 2Q30A 3N4MA 2LKGA 4Q4W2 2GNDA 5A6ZA 1C4RA 2FJDA 3F2EA 1FPN2 2DLRA 4UBGA 4CDUC 5FY4A 1D7PM 4X62T 3HKDE 5SV8A 1TZOA 4K1YA 4UXNB 3OGGA 3LDBA 2PHLA 3OPWA 2VMCA 4I3GA 4AFAA 2FDIA 1COV1 2J1UA 4CN4A 1EV13 4PIXA 4QT6A 1N33T 2IDAA 4XUTA 2QDNA 4FFFA 3E22E 2BQPA 5EHDA 1GOHA 4UELA 1FNYA 4CCJA 2B9VA 4LKEA 2V4VA 2C9AA 2YN6A 2NTYA 4CU8A 1AYM3 2WU5A 5GLUA 2A6XA 3D0SA 5KXCA 5J36A 3Q5DA 4NPLA 4RD7A 1DYKA 1ZBA2 2BKPA 4HFCA 1WFKA 2SBAA 2VVNA 1IZ3A 1ND3C 5FPZA 1AL23 2XEUA 5LKTA 5A3OA 1DLCA 2H0BA 5FZ0A 2KFTA 5LG3A 4YW3A 4MGZE 2JKBA 4N43C 4Q4W1 2P3YA 1VOMA 1U12A 1K42A 4GMP1 1FPN1 2XOYA 4IV1C 2CE7A 4LFBT 3A7MA 1WBLA 2ZEYA 2VL0A 1O8SA 1NXMA 1RUI2 3HQRA 2NW9A 4M1PA 3T30A 4OYJA 1LGCA 3WUDA 2KKXA 4P5HA 3J4UH 5FY0A 1F2NA 4E8DA 5BR8T 3BIWE 3ZYJB 1WRDA 2JDMA 1EAH1 1WR0A 1AJ3A 4UFLA 5I93A 2RV9A 3JAEA 4NIQA 3ZN0B 4G4FA 1XNCA 3I3EA 3M2MA 2RDSA 5FLJA 1DZRA 4OHZA 2XQ4A 3GBFA 1A3KA 1QUUA 1G9BA 5FLIA 3ONXA 3SOXA 3GALA 4X65T 1YFUA 2XJSA 2UXDT 1SCSA 2PAEA 2C5JA 3D6EA 2K48A 1ZBA1 1W0BA 1GNHA 1W0NA 2RP4A 2IFRA 4GULA 2OUJA 2W5FA 2BG9E 3J8F2 3ZYFA 1GYKA 1JZ8A 5LGNB 2CU5A 5TSWA 4WA6A 4MZUA 3RYFE 3JAFA 3MF6A 1R092 3R6SA 4PJLA 1W6MA 3PDYA 2WABA 3RZJA 1LHUA 1LOEA 3KHBA 3ORJA 1NY72 2P3JA 2UXCT 4AYCA 4DR4T 5K7PA 2B4KA 3U5OA 2K2SA 1RUI1 5GM0A 4KGQA 5DN2A 2KWJA 2AYHA 2OPKA 2XGXA 5IUXA 2ZPXA 1AX1A 3I8TA 4ILUA 5FZ3A 5JSPA 3UFGA 3MI8A 4X8NA 3ZN5A 3R6NA 1UY3A 3ZSEA 3B00A 4V1PA 3AXJA 3U5PA 4HKAA 5M4YA 5BNOB 3POEA 2R0HA 4CDUA 2FQPA 5FMCA 2LALA 1OBNA 5FYTA 4DIDB 3LEMA 3PHMA 1VAKA 2ZMLA 4CP2A 5LB6A 2XJRA 4ZHNA 1C3HA 5LNKA 4OMDA 3A0NA 3J8F1 5E1RA 2A6ZA 5A70A 3ZCJA 4QM8A 4JZRA 1LHNA 1SLIA 1NLRA 4OI2A 1JYXA 1JXNA 2X5IB 5EK4A 3QCWA 3GA8A 4OFZA 5EXOA 3ZMOA 1QWRA 2UY9A 1LDJB 2BS4A 4KI0F 2D43A 4QWNB 2X9XA 3RX6A 3LA7A 1VBB2 1CZSA 3SOLA 1HNWT 4M01A 3EO6A 1QF3A 2PG8A 2D97A 3T2QA 1G9DA 3POGA 3LJUX 4Z0RA 4IE5A 4ORFA 5A7PA 4AEKA 5FZ8A 4I43B 4N53B 3NV1A 5CZKA 3AYEA 4OQ8A 4IL4A 3OBTA 4OUEA 2WWJA 4NPRA 4WM8B 2XAFB 2D3RA 4CDXB 5IWFA 3S6PA 1HYJA 5D1LB 4X6QB 2BJSA 1DZTA 1Q43A 1BORA 3OSDA 1CAUB 2BOIA 2B45X 2XJPA 3ZIWA 4HFVA 5FKYA 4X8PA 4XURA 3E2DA 4M0HA 4ISSA 1X79A 3NW4A 1KDKA 5DQ0A 3GF6A 4JKLA 1W6QA 4B7KA 2BNMA 3OJBA 5ISLA 3UQ7A 1ZZCA 4LBOA 1XNAA 3NJVA 3DEMA 2D0TA 3HT2A 2GN3A 2KXLA 4GALA 2C4XA 5F3CA 1RC6A 1OEDA 4IE6A 1CAWB 4XVHA 1XNRT 1KJRA 4DOUA 4CCDA 1UQXA 3TB0A 4H2AA 2GN7A 4L9BA 3SHRA 5LKXA 3RQ0A 2DVDA 4P02B 5ABJB 4XDPA 1EPWA 4UEMA 3LB9A 4O4JE 2IFWA 1LECA 5K8SA 2QA7A 5CIRA 4C9ZA 4W4UA 2GNTA 2HBTA 2WT2A 1RJ7A 2HBUA 1OUSA 5L36A 2CGPA 2SLIA 3WXPA 1TMF2 4G2AA 1N1YA 4OUMA 3I7DA 3POJA 4BH9A 2QE3A 1JHNA 2ZM2A 3AZWA 5IK5A 4XAEA 5FZFA 1SE7A 4Q8KA 4JCKA 2LE8A 3Q9DA 2SPCA 3ZSTA 4DBRA 4CU9A 1VBE3 3RVHA 2ATFA 5J1XA 1SBFA 1UU6A 3SOUA 5C9AB 2KSRA 4QX3A 4BQYA 2BW8A 4X5TA 2ZTNA 2F4LA 4YHJA 4AI0A 1SPPB 2FZ2A 4A7KA 1PK6B 1N3QA 3I2JA 5FPAA 4LK7A 3WNLA 2VXJA 3O33A 4UP0A 4COWA 3E97A 3H7HA 1QY4A 1I3HA 2PMWB 3ZN6B 5AQSB 4E4ZA 5BNOC 5JG6A 3BPSA 5FMOS 3NKGA 4H9SE 3LVRE 1IQDC 1AUYA 4WV8A 2JG9B 5HPOA 1W9SA 2Y0OA 4FAHA 2ES3A 3RTRB 2VZOA 4TSVA 1V87A 1TMF1 2LHRA 3AE7A 2D6OX 4M3CA 4OGEA 3U4XA 3R4UA 3VN4A 1MIWA 2BEOA 3O9XA 2XMLA 4K1ZA 4LLFA 4YM3A 2DSMA 2PHUA 4K8FA 3SWHA 1RL3A 2X5IC 1LU1A 4G63A 4I0WB 2NWBA 4CI3B 1LU2A 1MACA 4I50E 4YZ3A 5FBZA 5AQNB 5JVDE 4IDQA 5HWXA 5TBNA 1WYBA 1XZYA 3U78A 3GGLA 1A8MA 2WZR3 1V9DA 3BIEA 2GK9A 3ZC0A 4UV9B 4HVRA 3G7DA 2A75A 5TDWA 5ANQA 3S4UA 2JQKA 3M99A 3O47A 2BYVE 1RVF2 4A97A 5EZWA 2XH6A 4PIZA 2IVIB 3WVJA 4N53C 4ES8A 1IKQA 3K3OA 5H1UA 2WLQA 3KNVA 1DQ2A 5KMGP 2W2IA 1VB2A 3J26N 2H7OA 3ZFFB 4WM8C 2I50A 3P8CD 5DUUA 4CDXC 4J25A 5HXEA 5JDQA 4AHXA 2E32A 2VVEA 1ZM1A 2Y64A 1UZ0A 2J1RA 3QOFA 4AFCA 5LBMA 3ECQA 1BXHA 1NQJA 3WUCA 2XBO3 4E4HA 2VZTA 5FY9A 2CL2A 4KBZA 1O8PA 4YW6A 2DTYA 2MEV2 3OEBA 5IVEA 2OZ6A 3IT8A 1N34T 5L7OB 5GZEA 1KNRA 3S30A 2XQXA 2W68A 1WR6A 5GONE 1CZTA 4OULA 1O6UA 2JE7A 4PF1A 1KK7A 3IN9A 1RVF1 4XFGA 5ABJC 1H2NA 2WO3A 2P3IA 1UYZA 2X53S 2XWBB 2J22A 3EJKA 3E6CC 5C4WA 3UU5A 2PJQA 3KCXA 2C5DA 4V1Av 2DX8A 1IYMA 4LA2A 3ZM8A 2LXHC 3BOWA 1WCUA 3BQIA 5HXSA 4QKNA 3R4DB 2E7QA 5HAXA 4YAXA 1XU1A 3WAJA 2WFF3 2LSKA 4NN0A 5HCMA 3MGUA 4DNDA 3WT3A 2G19A 4XUOA 5JOWA 2ZXQA 3WDUA 1JMUB 4X1IE 2LV9A 5BNNB 3CZUA 3RYPA 4MHRA 5BNOA 4JKKA 3FZ3A 2QJ0A 3FE5A 2RE9A 3LZZA 3POFA 2HWB3 2X9HA 2PA7A 5C9AC 3N2KE 2MEV1 5AC92 1WD3A 4ILBA 1PGSA 3J7Yq 1RUG2 4Q8LA 3NWIA 5BXXA 1VMFA 1W6PB 3ZYIB 4D6QA 2Y1NA 1PK6C 3GZEA 2CWSA 3HR0A 2ZJCA 4XDQA 2D5HA 4ERRA 1GQEA 3O5SA 3ZVZB 5ABFB 3IAPA 1UZVA 1HXS2 5LWBA 3LVQE 1J3QA 2PHTA 2Q9QA 2D6LX 4HWCA 4MGKE 3TRSB 4ZHQE 1UMIA 1WMDA 2JG9C 2JX9A 3IAQA 4QXKA 3N9LA 1XSRA 2E33A 2C5IT 4M00A 1V9U3 1T8BA 1DLLA 2YSJA 3EVYA 4CP9B 4IDPA 4AUQB 4QU2A 3ES4A 5KHKA 3FZKB 4FVVA 1O3TA 3DKWA 5IAXA 2A6VA 3NKZA 2VCAA 1H9PA 5FMNA 3UUBA 3PU3A 3IIAA 3ZX7A 2JG8B 5EQUA 1DGLA 3OKQA 1W8FA 1WW5A 3KM5A 5E16A 4FI9A 4D7SA 2HWC1 2L5UA 4ANJA 3NMBA 5CB7A 3VBRA 3K75B 5HXVA 5AC91 4YC9A 1D0YA 5JRCB 3OUJA 1RUG1 1VAMA 2FMYA 1VP6A 3A4UA 5D1MB 3VD5A 3BUCA 4MHUA 5JOZA 5LKUA 1BR4A 4NN2A 4OHFA 2FDFA 3TKLB 4XZPA 5L3GB 4E8CA 5FZEA 1BZWA 2A72A 1HXS1 1XE0A 5BYNA 4X66T 2VECA 3RPQA 4Q1RA 4AIUA 2CAVA 3VBHB 3ZSMA 5C5UA 1GP4A 3ZFFC 3P50A 1OPOA 4A6OA 3W58A 2I07B 3WSOA 2QZ2A 5AVAA 5AQOB 5BY5A 3T6RA 1HRV2 1SMVA 3THDA 4IE4A 1YQ5A 3BB6A 4CI2B 3VBOA 5L4HA 2VL4A 4M4RA 5FZCA 4JI2T 2W0XA 2FDJA 1W0AA 1MBMA 2Q0AA 1POV0 3GXUA 4CN1A 2QQNA 3VRAA 1AR93 1OSGA 1HTJF 3VHPA 3WNNA 4AK3A 3A23A 2RPAA 2CV6A 4QHBA 4BXSV 2LGKA 3GNEA 4DINB 1FMD2 5L7OC 4DUVA 3J9SA 4DXSA 4DY3A 1OH4A 4HFEA 2K9ZA 1NEKA 5IK8A 4S3OB 3VDDC 4LF5T 4JDNA 1QH7A 3PUGA 4DO0A 3O1HA 3WEZA 4WZ3B 3C4ZA 2RS32 2HWF2 2JM3A 4FI5A 4FPGA 4DMWA 4ISRA 3OD4A 1W90A 5F5CA 2XB6C 4ZI2D 2UY8A 1UXZA 1HYIA 2OZJA 4AQSA 1CIWA 2OVUA 1OKOA 2A7AA 2NPIA 2PHWA 2ZX2A 2WS93 1LULA 1LOFA 1POV3 2VXRA 2A9UA 1QMJA 1KJLA 4E2SA 1O4ZA 4MXWB 4LNVA 2VTXJ 1E2AA 3U5MA 2XQ5A 1B35A 1OC1A 2B7YA 2YROA 1W9FA 5T52A 2XAJB 4HKLA 4Z0OA 3PV0F 3Q5WA 4KWJA 1AX2A 4R52A 2CXFA 1HRV1 2KXPB 1FOD3 3MW4A 4MSVA 2DUOA 1HNXT 2UUCT 1DYPA 3ZN6A 5BNNC 5G0FA 4UV8B 3O1OA 3ZMTB 4PF5A 1GZ9A 5CG8A 3LWCA 2WDVA 2NYYA 3EI0A 3V65A 1CJDA 2JEMA 3WP5A 4JGYA 4WZ2A 1DYOA 1LOAA 3VU7H 3Q8AA 5I0UA 1OA2A 4FJCA 4FTSA 1FMD1 3ZXEA 3RKGA 2P2KA 2O8QA 3WCSA 2HHHT 2ECGA 1LCLA 4LMLA 4NXMT 1R64A 1DQ4A 2VTFA 1M06G 2V8SV 4YW7A 4DR1T 2RS31 2N1GA 3D0JA 3GYDA 4OYUA 3ESLA 3N7KA 3M3CA 2M6BA 1PVC2 4QX7A 2YZ4A 3IPVA 5FOBB 2ZGNA 1WEOA 4HTEA 1DZQA 4AKIA 1XDOA 2ACZA 2PQQA 4AVVA 4X20E 3UK9A 5FYCA 1QNYA 1PMJX 2XQYA 3V5SA 1W04A 1GQGA 2E2AA 4O64A 1BBT2 3VBSB 4DUYT 2W66A 3ATGA 4IREA 5LY2A 4NUUA 3POBA 4YABA 2ET1A 3I0OA 1OVPA 2E7TA 2JG8C 3MICA 4FOVA 2LSGA 1HB4A 3HT1A 5IFPA 2XP0A 4DR6T 3ZMSB 2YU4A 2IC6A 3S57A 1MM2A 3ZFFA 2AZ5A 3T0BA 1F8VA 4AVSA 2BGCA 1NCQB 1WILA 5C8CB 2R16A 4A6SA 1Q8VA 1OPMA 1QXJA 1HJFA 4KBBA 4EIWA 3FLPA 5EIYB 3DXTA 4GMP0 3MHZA 1AR83 4UIGA 1GMMA 3JQXA 1LRHA 2J1AA 1V6JA