2KYUA

The solution structure of the phd3 finger of mll
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase MLL
publication title The PHD3 domain of MLL acts as a CYP33-regulated switch between MLL-mediated activation and repression.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 67
sequence length 67
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kyuA00
3N9LA 3M63A 2CKLA 3ZVYA 3PURA 2YT5A 5G0FA 3EB6A 5B79A 4R2YA 4R8PK 2F6JA 1Z2QA 4S3OC 4I7DA 2ZETC 3U5NA 2M1RA 5FB0A 4AYCA 1MM3A 4B7YC 1HYJA 3L11A 4YADA 4I7CA 2MNYA 1WILA 2HYED 1Z60A 2EODA 4CA1A 2IDAA 3C6WA 2LRIC 3GL6A 4YABA 2L0BA 4FK5A 4NN2A 3I2DA 2MUMA 2YQLA 1T1HA 2E6RA 1FBVA 2YUCA 1DVPA 4GNEA 3ASLA 1JM7B 3ZPV1 2VPEA 5KH3A 5DKAA 1WIMA 4P5OB 3N9OA 2LQ6A 4ZUXU 2CSZA 2YW8A 5D1MB 2KWJA 4WZ0A 2L5UA 2K17A 2Y43A 1N87A 2KWKA 1WGMA 2K1JA 5KH9A 2YHOA 1X4IA 4LADB 5I3LA 3RPGB 1JM7A 2EA6A 4IC3A 3V43A 3N9MA 1Z6UA 4WA6A 5G04B 3ZTGA 5TDWA 4UI9B 2LDRA 4Q6FA 2XEUA 2XB1A 5C13A 1XWHA 1WEUA 1WEQA 5B78A 4S3OB 3O37A 2L75A 5AITA 2DX8A 5B77A 4MVTA 4V3KC 2MD7B 5EYAF 4GNDA 5FB1A 4N3WA 2L43A 2LGVA 2M3HA 4GB0A 4GNGA 5C11A 5AIUA 3LQHA 2FUIA 4AP4A 2PUYA 4XI1A 4X3GA 5B8DA 3QZVA 3NG2A 2KU3A 5JG6A 2ECJA 4FO9A 2VJFB 2Y1MA 1G25A 4PTBA 2JMIA 2K4DA 3ZPVE 4LLBA 2H0DA 3SOUA 1BORA 1WEMA 4YBSA 2VNFA 3HTKC 4A4CA 4IC2A 3PUQA 4LKAA 2Y1NA 5H1UA 5TABA 2C2VS 2G45A 4LK9A 3LRQA 2KE1A 4AVXA 2KFTA 2LXHC 2M85A 2LGLA 2UZGA 4QF3A 5KH7A 2KR4A 3T7LA 3N9NA 5B75A 3KQIA 2KIZA 3MHHA 2VJEB 4YBMA 2FUUA 2ECWA 4ZDTA 1X4JA 5LKUA 2G6QA 2F42A 5J3XA 4A49A 2YQMA 2YSJA 2EGPA 4QF2A 1WEOA 3U5PA 5LKTA 3T6RA 1LDKC 4YC9A 3VK6A 2RI7A 1CHCA 1WFKA 2MA6A 2VP7A 3HCSA 2PNXA 4UP5A 2KWNA 2VJEA 1VD4A 5DINA 4R7EA 5D1LB 3DQVR 2M6MA 5TBNA 4MSXA 2CKLB 4PPEA 3N9QA 2ECGA 2YU4A 1FP0A 4A4BA 3ZVZB 2MNZA 5LKZA 2MIQA 4A0CD 1WEPA 4FJCA 4B86C 4TKPB 2QJ0A 2F6NA 2RSDA 2G43A 3HCTA 3M62A 2AN6A 3U5OA 2MD8C 2CSYA 2YHNA 5LCWB 4FIPA 3O35A 2LGGA 3GV4A 3RTRB 3C5KA 2QIZA 4C9ZA 4YATA 2C2LA 3SHBA 4L58A 4V3LC 4CCGX 4O64A 3U5MA 4GNFA 3SOWA 2VPGA 2YREA 4WZ3B 2LV9A 2ECNA 3MHSA 3IHPA 5G05B 2MT5A 2KYUA 4ZQLA 1JOCA 3LQJA 4F52B 1K2FA 2JMJA 2KGGA 3FL2A 2LXPC 2I50A 2D8SA 1V87A 2JRJA 2LN0A 2YYRA 5H9MA 1E4UA 2VJFA 5FERA 1WE9A 1VFYA 1X4UA 3ZNIA 3O33A 1LDJB 1WEWA 5H1VA 2BAYA 5B76A 5LKXA 3KNVA 2VPDA 2YSMA 2JMDA 1ZBDB 3O70A 2YURA 3N9PA 5TRBA 1WEVA 3KV5A 1WEEA 4UP0A 5D1KB 4YBTA 3O34A 3DPLR 2NAAA 2FSAA 5TDRA 3HCUA 2MA5A 1RMDA 2CT2A 1WESA 3L1XA 4W4UA 4BHWA 1HYIA 1F62A 4N4FA 4I7BA 2QICA 1IYMA 2VPBA 2KWOA 3L1ZB 4YAXA 1MM2A 2KGIA 5FEYA 3O7AA 2ECVA 2ECIA 4BBQA 4AUQB 3LQIA 4WZ2A 3EB5A 2OXQC 2L80A 5H1TA 2ECTA 1VYXA 4AYCB 3ZYQA 3O36A 3RPGC 4LJNA 3KV6A 2HDPA 2H0DB 3M99A 4L7XA 2KREA 1U6GB 3PHDA 2K16A 3SOXA 2E6SA 2LGKA 1WENA
chains in the Genus database with same CATH superfamily
2LAUA 3N9LA 3M63A 2CKLA 3JUEA 2DJAA 3ZVYA 3PURA 2YT5A 5G0FA 3EB6A 5B79A 4R2YA 2FFWA 4R8PK 2F6JA 1Z2QA 4S3OC 4I7DA 2ZETC 3U5NA 2P57A 2E61A 2M1RA 5FB0A 4AYCA 1MM3A 4B7YC 1HYJA 3L11A 4YADA 4I7CA 2MNYA 1WILA 2HYED 1Z60A 2EODA 4CA1A 2IDAA 3C6WA 2LRIC 5SVIA 3GL6A 4YABA 2L0BA 4FK5A 4NN2A 5SVYA 3I2DA 2MUMA 2YQLA 1T1HA 2E6RA 1FBVA 2YUCA 2MKEA 1DVPA 4GNEA 3ASLA 3FM8C 1JM7B 3ZPV1 2VPEA 5KH3A 5DKAA 1WIMA 4P5OB 3N9OA 2LQ6A 4ZUXU 2CSZA 2YW8A 5D1MB 2KKYA 2KWJA 4WZ0A 2L5UA 2K17A 2Y43A 1N87A 2KWKA 1WGMA 2FD4A 2K1JA 5KH9A 2YHOA 1X4IA 4LADB 5I3LA 3RPGB 1JM7A 3LDYA 2EA6A 4IC3A 3V43A 3N9MA 1Z6UA 4WA6A 5G04B 3ZTGA 5TDWA 4UI9B 2LDRA 4Q6FA 2XEUA 3FJUB 2XB1A 5C13A 1XWHA 1WEUA 1WEQA 5B78A 4S3OB 3O37A 2L75A 2EGMA 5AITA 2DX8A 5B77A 4MVTA 4V3KC 2MD7B 5EYAF 4GNDA 5FB1A 4N3WA 2L43A 1DCQA 2LGVA 2YVRA 2M3HA 4GB0A 4GNGA 5C11A 5AIUA 3LQHA 2FUIA 4AP4A 2PUYA 4XI1A 4X3GA 5B8DA 3QZVA 3NG2A 2KU3A 5JG6A 2M13A 2ECJA 4FO9A 2VJFB 2Y1MA 3FANA 4OGEA 4PTBA 1G25A 2JMIA 2K4DA 3ZPVE 2CRWA 4LLBA 2H0DA 3SOUA 1BORA 1WEMA 3FEHA 4Z0RA 4YBSA 2VNFA 3HTKC 4A4CA 4IC2A 3PUQA 2XP0A 4LKAA 2Y1NA 5H1UA 5TABA 2C2VS 2G45A 4LK9A 3LRQA 2DSMA 2KE1A 4AVXA 2KFTA 2CRRA 2LXHC 4H9DA 2M85A 2LGLA 2UZGA 4QF3A 5KH7A 2KR4A 3T7LA 3N9NA 5B75A 4QQ4A 3KQIA 2KIZA 3MHHA 2VJEB 4YBMA 3M7KA 2FUUA 2ECWA 2KKXA 1X4JA 4ZDTA 3FAOA 5LKUA 2G6QA 2F42A 5J3XA 4A49A 2EXUA 2YQMA 2YSJA 2EGPA 4QF2A 2XOCA 1WEOA 3U5PA 5LKTA 3T6RA 1LDKC 4YC9A 3VK6A 2RI7A 1CHCA 3O47A 1WFKA 2MA6A 2VP7A 3HCSA 2PNXA 4UP5A 3MDBC 2KWNA 2VJEA 1VD4A 5DINA 4R7EA 5D1LB 3DQVR 2M6MA 5TBNA 4MSXA 2CKLB 4PPEA 2JUNA 3LJUX 2RR4A 3N9QA 2ECGA 2YU4A 1FP0A 3DWDA 4A4BA 3ZVZB 2MNZA 5LKZA 2MIQA 4A0CD 1WEPA 3E2DA 4FJCA 4B86C 4TKPB 5SVXA 3Q1DA 2QJ0A 2F6NA 2RSDA 2B0OE 2G43A 3HCTA 3M62A 4O62A 2IQJA 2AN6A 3U5OA 2MD8C 2CONA 2CSYA 3H7HA 2YHNA 5LCWB 4FIPA 3O35A 2LGGA 3GV4A 3RTRB 5K3QA 3C5KA 2QIZA 4C9ZA 4YATA 2C2LA 3SHBA 3LVRE 4L58A 4V3LC 4CCGX 4O64A 3U5MA 4GNFA 5SVIB 3SOWA 2VPGA 2YREA 4WZ3B 2CSVA 2LV9A 3T9KA 2ECNA 3MHSA 3IHPA 5G05B 2MT5A 2KYUA 2JM3A 4ZQLA 1JOCA 3LQJA 4F52B 1K2FA 2JMJA 2KGGA 3FL2A 2LXPC 2I50A 2D8SA 1V87A 2XOZA 2JRJA 2LN0A 2YYRA 5H9MA 1E4UA 2VJFA 5FERA 1WE9A 1VFYA 1X4UA 3SUBA 3ZNIA 1MBMA 3O33A 1LDJB 1WEWA 5H1VA 2BAYA 3LVQE 5B76A 5LKXA 3KNVA 2VPDA 3PLWA 2YSMA 2JMDA 2D8UA 1ZBDB 3O70A 2YURA 3N9PA 5TRBA 1WEVA 3KV5A 1WEEA 4UP0A 5D1KB 4YBTA 3O34A 3DPLR 2NAAA 2FSAA 5TDRA 3HCUA 2MA5A 1RMDA 2CT2A 1WESA 3L1XA 4W4UA 4BHWA 1HYIA 1F62A 4N4FA 4I7BA 2QICA 3KDEC 1IYMA 2VPBA 4F1PA 2KWOA 2XOYA 3L1ZB 4YAXA 1MM2A 2OWAA 2KGIA 5FEYA 3O7AA 4Z0OA 4OGCA 2ECVA 2ECIA 4BBQA 4AUQB 3LQIA 4WZ2A 3EB5A 2OXQC 2L80A 5H1TA 2L7PA 2ECTA 3DDTA 1VYXA 4AYCB 3ZYQA 3O36A 4LJNA 3RPGC 3KV6A 2HDPA 2H0DB 3M99A 4L7XA 2KREA 1U6GB 3PHDA 2K16A 3SOXA 2E6SA 2LGKA 1WENA
chains in the Genus database with same CATH topology
3N9LA 3M63A 2CKLA 3ZVYA 3PURA 2YT5A 5G0FA 3EB6A 5B79A 4R2YA 4R8PK 2F6JA 1Z2QA 4S3OC 4I7DA 2ZETC 3U5NA 2M1RA 5FB0A 4AYCA 1MM3A 4B7YC 1HYJA 3L11A 4YADA 4I7CA 2MNYA 1WILA 2HYED 1Z60A 2EODA 4CA1A 2IDAA 3C6WA 2LRIC 3GL6A 4YABA 2L0BA 4FK5A 4NN2A 3I2DA 2MUMA 2YQLA 1T1HA 2E6RA 1FBVA 2YUCA 1DVPA 4GNEA 3ASLA 1JM7B 3ZPV1 2VPEA 5KH3A 5DKAA 1WIMA 4P5OB 3N9OA 2LQ6A 4ZUXU 2CSZA 2YW8A 5D1MB 2KWJA 4WZ0A 2L5UA 2K17A 2Y43A 1N87A 2KWKA 1WGMA 2K1JA 5KH9A 2YHOA 1X4IA 4LADB 5I3LA 3RPGB 1JM7A 2EA6A 4IC3A 3V43A 3N9MA 1Z6UA 4WA6A 5G04B 3ZTGA 5TDWA 4UI9B 2LDRA 4Q6FA 2XEUA 2XB1A 5C13A 1XWHA 1WEUA 1WEQA 5B78A 4S3OB 3O37A 2L75A 5AITA 2DX8A 5B77A 4MVTA 4V3KC 2MD7B 5EYAF 4GNDA 5FB1A 4N3WA 2L43A 2LGVA 2M3HA 4GB0A 4GNGA 5C11A 5AIUA 3LQHA 2FUIA 4AP4A 2PUYA 4XI1A 4X3GA 5B8DA 3QZVA 3NG2A 2KU3A 5JG6A 2ECJA 4FO9A 2VJFB 2Y1MA 1G25A 4PTBA 2JMIA 2K4DA 3ZPVE 4LLBA 2H0DA 3SOUA 1BORA 1WEMA 4YBSA 2VNFA 3HTKC 4A4CA 4IC2A 3PUQA 4LKAA 2Y1NA 5H1UA 5TABA 2C2VS 2G45A 4LK9A 3LRQA 2KE1A 4AVXA 2KFTA 2LXHC 2M85A 2LGLA 2UZGA 4QF3A 5KH7A 2KR4A 3T7LA 3N9NA 5B75A 3KQIA 2KIZA 3MHHA 2VJEB 4YBMA 2FUUA 2ECWA 4ZDTA 1X4JA 5LKUA 2G6QA 2F42A 5J3XA 4A49A 2YQMA 2YSJA 2EGPA 4QF2A 1WEOA 3U5PA 5LKTA 3T6RA 1LDKC 4YC9A 3VK6A 2RI7A 1CHCA 1WFKA 2MA6A 2VP7A 3HCSA 2PNXA 4UP5A 2KWNA 2VJEA 1VD4A 5DINA 4R7EA 5D1LB 3DQVR 2M6MA 5TBNA 4MSXA 2CKLB 4PPEA 3N9QA 2ECGA 2YU4A 1FP0A 4A4BA 3ZVZB 2MNZA 5LKZA 2MIQA 4A0CD 1WEPA 4FJCA 4B86C 4TKPB 2QJ0A 2F6NA 2RSDA 2G43A 3HCTA 3M62A 2AN6A 3U5OA 2MD8C 2CSYA 2YHNA 5LCWB 4FIPA 3O35A 2LGGA 3GV4A 3RTRB 3C5KA 2QIZA 4C9ZA 4YATA 2C2LA 3SHBA 4L58A 4V3LC 4CCGX 4O64A 3U5MA 4GNFA 3SOWA 2VPGA 2YREA 4WZ3B 2LV9A 2ECNA 3MHSA 3IHPA 5G05B 2MT5A 2KYUA 4ZQLA 1JOCA 3LQJA 4F52B 1K2FA 2JMJA 2KGGA 3FL2A 2LXPC 2I50A 2D8SA 1V87A 2JRJA 2LN0A 2YYRA 5H9MA 1E4UA 2VJFA 5FERA 1WE9A 1VFYA 1X4UA 3ZNIA 3O33A 1LDJB 1WEWA 5H1VA 2BAYA 5B76A 5LKXA 3KNVA 2VPDA 2YSMA 2JMDA 1ZBDB 3O70A 2YURA 3N9PA 5TRBA 1WEVA 3KV5A 1WEEA 4UP0A 5D1KB 4YBTA 3O34A 3DPLR 2NAAA 2FSAA 5TDRA 3HCUA 2MA5A 1RMDA 2CT2A 1WESA 3L1XA 4W4UA 4BHWA 1HYIA 1F62A 4N4FA 4I7BA 2QICA 1IYMA 2VPBA 2KWOA 3L1ZB 4YAXA 1MM2A 2KGIA 5FEYA 3O7AA 2ECVA 2ECIA 4BBQA 4AUQB 3LQIA 4WZ2A 3EB5A 2OXQC 2L80A 5H1TA 2ECTA 1VYXA 4AYCB 3ZYQA 3O36A 3RPGC 4LJNA 3KV6A 2HDPA 2H0DB 3M99A 4L7XA 2KREA 1U6GB 3PHDA 2K16A 3SOXA 2E6SA 2LGKA 1WENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9L A;  3M63 A;  2CKL A;  3ZVY A;  3PUR A;  2YT5 A;  5G0F A;  3EB6 A;  5B79 A;  4R2Y A;  4R8P K;  2F6J A;  1Z2Q A;  4S3O C;  4I7D A;  2ZET C;  3U5N A;  2M1R A;  5FB0 A;  4AYC A;  1MM3 A;  4B7Y C;  1HYJ A;  3L11 A;  4YAD A;  4I7C A;  2MNY A;  1WIL A;  2HYE D;  1Z60 A;  2EOD A;  4CA1 A;  2IDA A;  3C6W A;  2LRI C;  3GL6 A;  4YAB A;  2L0B A;  4FK5 A;  4NN2 A;  3I2D A;  2MUM A;  2YQL A;  1T1H A;  2E6R A;  1FBV A;  2YUC A;  1DVP A;  4GNE A;  3ASL A;  1JM7 B;  3ZPV 1;  2VPE A;  5KH3 A;  5DKA A;  1WIM A;  4P5O B;  3N9O A;  2LQ6 A;  4ZUX U;  2CSZ A;  2YW8 A;  5D1M B;  2KWJ A;  4WZ0 A;  2L5U A;  2K17 A;  2Y43 A;  1N87 A;  2KWK A;  1WGM A;  2K1J A;  5KH9 A;  2YHO A;  1X4I A;  4LAD B;  5I3L A;  3RPG B;  1JM7 A;  2EA6 A;  4IC3 A;  3V43 A;  3N9M A;  1Z6U A;  4WA6 A;  5G04 B;  3ZTG A;  5TDW A;  4UI9 B;  2LDR A;  4Q6F A;  2XEU A;  2XB1 A;  5C13 A;  1XWH A;  1WEU A;  1WEQ A;  5B78 A;  4S3O B;  3O37 A;  2L75 A;  5AIT A;  2DX8 A;  5B77 A;  4MVT A;  4V3K C;  2MD7 B;  5EYA F;  4GND A;  5FB1 A;  4N3W A;  2L43 A;  2LGV A;  2M3H A;  4GB0 A;  4GNG A;  5C11 A;  5AIU A;  3LQH A;  2FUI A;  4AP4 A;  2PUY A;  4XI1 A;  4X3G A;  5B8D A;  3QZV A;  3NG2 A;  2KU3 A;  5JG6 A;  2ECJ A;  4FO9 A;  2VJF B;  2Y1M A;  1G25 A;  4PTB A;  2JMI A;  2K4D A;  3ZPV E;  4LLB A;  2H0D A;  3SOU A;  1BOR A;  1WEM A;  4YBS A;  2VNF A;  3HTK C;  4A4C A;  4IC2 A;  3PUQ A;  4LKA A;  2Y1N A;  5H1U A;  5TAB A;  2C2V S;  2G45 A;  4LK9 A;  3LRQ A;  2KE1 A;  4AVX A;  2KFT A;  2LXH C;  2M85 A;  2LGL A;  2UZG A;  4QF3 A;  5KH7 A;  2KR4 A;  3T7L A;  3N9N A;  5B75 A;  3KQI A;  2KIZ A;  3MHH A;  2VJE B;  4YBM A;  2FUU A;  2ECW A;  4ZDT A;  1X4J A;  5LKU A;  2G6Q A;  2F42 A;  5J3X A;  4A49 A;  2YQM A;  2YSJ A;  2EGP A;  4QF2 A;  1WEO A;  3U5P A;  5LKT A;  3T6R A;  1LDK C;  4YC9 A;  3VK6 A;  2RI7 A;  1CHC A;  1WFK A;  2MA6 A;  2VP7 A;  3HCS A;  2PNX A;  4UP5 A;  2KWN A;  2VJE A;  1VD4 A;  5DIN A;  4R7E A;  5D1L B;  3DQV R;  2M6M A;  5TBN A;  4MSX A;  2CKL B;  4PPE A;  3N9Q A;  2ECG A;  2YU4 A;  1FP0 A;  4A4B A;  3ZVZ B;  2MNZ A;  5LKZ A;  2MIQ A;  4A0C D;  1WEP A;  4FJC A;  4B86 C;  4TKP B;  2QJ0 A;  2F6N A;  2RSD A;  2G43 A;  3HCT A;  3M62 A;  2AN6 A;  3U5O A;  2MD8 C;  2CSY A;  2YHN A;  5LCW B;  4FIP A;  3O35 A;  2LGG A;  3GV4 A;  3RTR B;  3C5K A;  2QIZ A;  4C9Z A;  4YAT A;  2C2L A;  3SHB A;  4L58 A;  4V3L C;  4CCG X;  4O64 A;  3U5M A;  4GNF A;  3SOW A;  2VPG A;  2YRE A;  4WZ3 B;  2LV9 A;  2ECN A;  3MHS A;  3IHP A;  5G05 B;  2MT5 A;  2KYU A;  4ZQL A;  1JOC A;  3LQJ A;  4F52 B;  1K2F A;  2JMJ A;  2KGG A;  3FL2 A;  2LXP C;  2I50 A;  2D8S A;  1V87 A;  2JRJ A;  2LN0 A;  2YYR A;  5H9M A;  1E4U A;  2VJF A;  5FER A;  1WE9 A;  1VFY A;  1X4U A;  3ZNI A;  3O33 A;  1LDJ B;  1WEW A;  5H1V A;  2BAY A;  5B76 A;  5LKX A;  3KNV A;  2VPD A;  2YSM A;  2JMD A;  1ZBD B;  3O70 A;  2YUR A;  3N9P A;  5TRB A;  1WEV A;  3KV5 A;  1WEE A;  4UP0 A;  5D1K B;  4YBT A;  3O34 A;  3DPL R;  2NAA A;  2FSA A;  5TDR A;  3HCU A;  2MA5 A;  1RMD A;  2CT2 A;  1WES A;  3L1X A;  4W4U A;  4BHW A;  1HYI A;  1F62 A;  4N4F A;  4I7B A;  2QIC A;  1IYM A;  2VPB A;  2KWO A;  3L1Z B;  4YAX A;  1MM2 A;  2KGI A;  5FEY A;  3O7A A;  2ECV A;  2ECI A;  4BBQ A;  4AUQ B;  3LQI A;  4WZ2 A;  3EB5 A;  2OXQ C;  2L80 A;  5H1T A;  2ECT A;  1VYX A;  4AYC B;  3ZYQ A;  3O36 A;  3RPG C;  4LJN A;  3KV6 A;  2HDP A;  2H0D B;  3M99 A;  4L7X A;  2KRE A;  1U6G B;  3PHD A;  2K16 A;  3SOX A;  2E6S A;  2LGK A;  1WEN A; 
#chains in the Genus database with same CATH topology
 2LAU A;  3N9L A;  3M63 A;  2CKL A;  3JUE A;  2DJA A;  3ZVY A;  3PUR A;  2YT5 A;  5G0F A;  3EB6 A;  5B79 A;  4R2Y A;  2FFW A;  4R8P K;  2F6J A;  1Z2Q A;  4S3O C;  4I7D A;  2ZET C;  3U5N A;  2P57 A;  2E61 A;  2M1R A;  5FB0 A;  4AYC A;  1MM3 A;  4B7Y C;  1HYJ A;  3L11 A;  4YAD A;  4I7C A;  2MNY A;  1WIL A;  2HYE D;  1Z60 A;  2EOD A;  4CA1 A;  2IDA A;  3C6W A;  2LRI C;  5SVI A;  3GL6 A;  4YAB A;  2L0B A;  4FK5 A;  4NN2 A;  5SVY A;  3I2D A;  2MUM A;  2YQL A;  1T1H A;  2E6R A;  1FBV A;  2YUC A;  2MKE A;  1DVP A;  4GNE A;  3ASL A;  3FM8 C;  1JM7 B;  3ZPV 1;  2VPE A;  5KH3 A;  5DKA A;  1WIM A;  4P5O B;  3N9O A;  2LQ6 A;  4ZUX U;  2CSZ A;  2YW8 A;  5D1M B;  2KKY A;  2KWJ A;  4WZ0 A;  2L5U A;  2K17 A;  2Y43 A;  1N87 A;  2KWK A;  1WGM A;  2FD4 A;  2K1J A;  5KH9 A;  2YHO A;  1X4I A;  4LAD B;  5I3L A;  3RPG B;  1JM7 A;  3LDY A;  2EA6 A;  4IC3 A;  3V43 A;  3N9M A;  1Z6U A;  4WA6 A;  5G04 B;  3ZTG A;  5TDW A;  4UI9 B;  2LDR A;  4Q6F A;  2XEU A;  3FJU B;  2XB1 A;  5C13 A;  1XWH A;  1WEU A;  1WEQ A;  5B78 A;  4S3O B;  3O37 A;  2L75 A;  2EGM A;  5AIT A;  2DX8 A;  5B77 A;  4MVT A;  4V3K C;  2MD7 B;  5EYA F;  4GND A;  5FB1 A;  4N3W A;  2L43 A;  1DCQ A;  2LGV A;  2YVR A;  2M3H A;  4GB0 A;  4GNG A;  5C11 A;  5AIU A;  3LQH A;  2FUI A;  4AP4 A;  2PUY A;  4XI1 A;  4X3G A;  5B8D A;  3QZV A;  3NG2 A;  2KU3 A;  5JG6 A;  2M13 A;  2ECJ A;  4FO9 A;  2VJF B;  2Y1M A;  3FAN A;  4OGE A;  4PTB A;  1G25 A;  2JMI A;  2K4D A;  3ZPV E;  2CRW A;  4LLB A;  2H0D A;  3SOU A;  1BOR A;  1WEM A;  3FEH A;  4Z0R A;  4YBS A;  2VNF A;  3HTK C;  4A4C A;  4IC2 A;  3PUQ A;  2XP0 A;  4LKA A;  2Y1N A;  5H1U A;  5TAB A;  2C2V S;  2G45 A;  4LK9 A;  3LRQ A;  2DSM A;  2KE1 A;  4AVX A;  2KFT A;  2CRR A;  2LXH C;  4H9D A;  2M85 A;  2LGL A;  2UZG A;  4QF3 A;  5KH7 A;  2KR4 A;  3T7L A;  3N9N A;  5B75 A;  4QQ4 A;  3KQI A;  2KIZ A;  3MHH A;  2VJE B;  4YBM A;  3M7K A;  2FUU A;  2ECW A;  2KKX A;  1X4J A;  4ZDT A;  3FAO A;  5LKU A;  2G6Q A;  2F42 A;  5J3X A;  4A49 A;  2EXU A;  2YQM A;  2YSJ A;  2EGP A;  4QF2 A;  2XOC A;  1WEO A;  3U5P A;  5LKT A;  3T6R A;  1LDK C;  4YC9 A;  3VK6 A;  2RI7 A;  1CHC A;  3O47 A;  1WFK A;  2MA6 A;  2VP7 A;  3HCS A;  2PNX A;  4UP5 A;  3MDB C;  2KWN A;  2VJE A;  1VD4 A;  5DIN A;  4R7E A;  5D1L B;  3DQV R;  2M6M A;  5TBN A;  4MSX A;  2CKL B;  4PPE A;  2JUN A;  3LJU X;  2RR4 A;  3N9Q A;  2ECG A;  2YU4 A;  1FP0 A;  3DWD A;  4A4B A;  3ZVZ B;  2MNZ A;  5LKZ A;  2MIQ A;  4A0C D;  1WEP A;  3E2D A;  4FJC A;  4B86 C;  4TKP B;  5SVX A;  3Q1D A;  2QJ0 A;  2F6N A;  2RSD A;  2B0O E;  2G43 A;  3HCT A;  3M62 A;  4O62 A;  2IQJ A;  2AN6 A;  3U5O A;  2MD8 C;  2CON A;  2CSY A;  3H7H A;  2YHN A;  5LCW B;  4FIP A;  3O35 A;  2LGG A;  3GV4 A;  3RTR B;  5K3Q A;  3C5K A;  2QIZ A;  4C9Z A;  4YAT A;  2C2L A;  3SHB A;  3LVR E;  4L58 A;  4V3L C;  4CCG X;  4O64 A;  3U5M A;  4GNF A;  5SVI B;  3SOW A;  2VPG A;  2YRE A;  4WZ3 B;  2CSV A;  2LV9 A;  3T9K A;  2ECN A;  3MHS A;  3IHP A;  5G05 B;  2MT5 A;  2KYU A;  2JM3 A;  4ZQL A;  1JOC A;  3LQJ A;  4F52 B;  1K2F A;  2JMJ A;  2KGG A;  3FL2 A;  2LXP C;  2I50 A;  2D8S A;  1V87 A;  2XOZ A;  2JRJ A;  2LN0 A;  2YYR A;  5H9M A;  1E4U A;  2VJF A;  5FER A;  1WE9 A;  1VFY A;  1X4U A;  3SUB A;  3ZNI A;  1MBM A;  3O33 A;  1LDJ B;  1WEW A;  5H1V A;  2BAY A;  3LVQ E;  5B76 A;  5LKX A;  3KNV A;  2VPD A;  3PLW A;  2YSM A;  2JMD A;  2D8U A;  1ZBD B;  3O70 A;  2YUR A;  3N9P A;  5TRB A;  1WEV A;  3KV5 A;  1WEE A;  4UP0 A;  5D1K B;  4YBT A;  3O34 A;  3DPL R;  2NAA A;  2FSA A;  5TDR A;  3HCU A;  2MA5 A;  1RMD A;  2CT2 A;  1WES A;  3L1X A;  4W4U A;  4BHW A;  1HYI A;  1F62 A;  4N4F A;  4I7B A;  2QIC A;  3KDE C;  1IYM A;  2VPB A;  4F1P A;  2KWO A;  2XOY A;  3L1Z B;  4YAX A;  1MM2 A;  2OWA A;  2KGI A;  5FEY A;  3O7A A;  4Z0O A;  4OGC A;  2ECV A;  2ECI A;  4BBQ A;  4AUQ B;  3LQI A;  4WZ2 A;  3EB5 A;  2OXQ C;  2L80 A;  5H1T A;  2L7P A;  2ECT A;  3DDT A;  1VYX A;  4AYC B;  3ZYQ A;  3O36 A;  4LJN A;  3RPG C;  3KV6 A;  2HDP A;  2H0D B;  3M99 A;  4L7X A;  2KRE A;  1U6G B;  3PHD A;  2K16 A;  3SOX A;  2E6S A;  2LGK A;  1WEN A; 
#chains in the Genus database with same CATH homology
 3N9L A;  3M63 A;  2CKL A;  3ZVY A;  3PUR A;  2YT5 A;  5G0F A;  3EB6 A;  5B79 A;  4R2Y A;  4R8P K;  2F6J A;  1Z2Q A;  4S3O C;  4I7D A;  2ZET C;  3U5N A;  2M1R A;  5FB0 A;  4AYC A;  1MM3 A;  4B7Y C;  1HYJ A;  3L11 A;  4YAD A;  4I7C A;  2MNY A;  1WIL A;  2HYE D;  1Z60 A;  2EOD A;  4CA1 A;  2IDA A;  3C6W A;  2LRI C;  3GL6 A;  4YAB A;  2L0B A;  4FK5 A;  4NN2 A;  3I2D A;  2MUM A;  2YQL A;  1T1H A;  2E6R A;  1FBV A;  2YUC A;  1DVP A;  4GNE A;  3ASL A;  1JM7 B;  3ZPV 1;  2VPE A;  5KH3 A;  5DKA A;  1WIM A;  4P5O B;  3N9O A;  2LQ6 A;  4ZUX U;  2CSZ A;  2YW8 A;  5D1M B;  2KWJ A;  4WZ0 A;  2L5U A;  2K17 A;  2Y43 A;  1N87 A;  2KWK A;  1WGM A;  2K1J A;  5KH9 A;  2YHO A;  1X4I A;  4LAD B;  5I3L A;  3RPG B;  1JM7 A;  2EA6 A;  4IC3 A;  3V43 A;  3N9M A;  1Z6U A;  4WA6 A;  5G04 B;  3ZTG A;  5TDW A;  4UI9 B;  2LDR A;  4Q6F A;  2XEU A;  2XB1 A;  5C13 A;  1XWH A;  1WEU A;  1WEQ A;  5B78 A;  4S3O B;  3O37 A;  2L75 A;  5AIT A;  2DX8 A;  5B77 A;  4MVT A;  4V3K C;  2MD7 B;  5EYA F;  4GND A;  5FB1 A;  4N3W A;  2L43 A;  2LGV A;  2M3H A;  4GB0 A;  4GNG A;  5C11 A;  5AIU A;  3LQH A;  2FUI A;  4AP4 A;  2PUY A;  4XI1 A;  4X3G A;  5B8D A;  3QZV A;  3NG2 A;  2KU3 A;  5JG6 A;  2ECJ A;  4FO9 A;  2VJF B;  2Y1M A;  1G25 A;  4PTB A;  2JMI A;  2K4D A;  3ZPV E;  4LLB A;  2H0D A;  3SOU A;  1BOR A;  1WEM A;  4YBS A;  2VNF A;  3HTK C;  4A4C A;  4IC2 A;  3PUQ A;  4LKA A;  2Y1N A;  5H1U A;  5TAB A;  2C2V S;  2G45 A;  4LK9 A;  3LRQ A;  2KE1 A;  4AVX A;  2KFT A;  2LXH C;  2M85 A;  2LGL A;  2UZG A;  4QF3 A;  5KH7 A;  2KR4 A;  3T7L A;  3N9N A;  5B75 A;  3KQI A;  2KIZ A;  3MHH A;  2VJE B;  4YBM A;  2FUU A;  2ECW A;  4ZDT A;  1X4J A;  5LKU A;  2G6Q A;  2F42 A;  5J3X A;  4A49 A;  2YQM A;  2YSJ A;  2EGP A;  4QF2 A;  1WEO A;  3U5P A;  5LKT A;  3T6R A;  1LDK C;  4YC9 A;  3VK6 A;  2RI7 A;  1CHC A;  1WFK A;  2MA6 A;  2VP7 A;  3HCS A;  2PNX A;  4UP5 A;  2KWN A;  2VJE A;  1VD4 A;  5DIN A;  4R7E A;  5D1L B;  3DQV R;  2M6M A;  5TBN A;  4MSX A;  2CKL B;  4PPE A;  3N9Q A;  2ECG A;  2YU4 A;  1FP0 A;  4A4B A;  3ZVZ B;  2MNZ A;  5LKZ A;  2MIQ A;  4A0C D;  1WEP A;  4FJC A;  4B86 C;  4TKP B;  2QJ0 A;  2F6N A;  2RSD A;  2G43 A;  3HCT A;  3M62 A;  2AN6 A;  3U5O A;  2MD8 C;  2CSY A;  2YHN A;  5LCW B;  4FIP A;  3O35 A;  2LGG A;  3GV4 A;  3RTR B;  3C5K A;  2QIZ A;  4C9Z A;  4YAT A;  2C2L A;  3SHB A;  4L58 A;  4V3L C;  4CCG X;  4O64 A;  3U5M A;  4GNF A;  3SOW A;  2VPG A;  2YRE A;  4WZ3 B;  2LV9 A;  2ECN A;  3MHS A;  3IHP A;  5G05 B;  2MT5 A;  2KYU A;  4ZQL A;  1JOC A;  3LQJ A;  4F52 B;  1K2F A;  2JMJ A;  2KGG A;  3FL2 A;  2LXP C;  2I50 A;  2D8S A;  1V87 A;  2JRJ A;  2LN0 A;  2YYR A;  5H9M A;  1E4U A;  2VJF A;  5FER A;  1WE9 A;  1VFY A;  1X4U A;  3ZNI A;  3O33 A;  1LDJ B;  1WEW A;  5H1V A;  2BAY A;  5B76 A;  5LKX A;  3KNV A;  2VPD A;  2YSM A;  2JMD A;  1ZBD B;  3O70 A;  2YUR A;  3N9P A;  5TRB A;  1WEV A;  3KV5 A;  1WEE A;  4UP0 A;  5D1K B;  4YBT A;  3O34 A;  3DPL R;  2NAA A;  2FSA A;  5TDR A;  3HCU A;  2MA5 A;  1RMD A;  2CT2 A;  1WES A;  3L1X A;  4W4U A;  4BHW A;  1HYI A;  1F62 A;  4N4F A;  4I7B A;  2QIC A;  1IYM A;  2VPB A;  2KWO A;  3L1Z B;  4YAX A;  1MM2 A;  2KGI A;  5FEY A;  3O7A A;  2ECV A;  2ECI A;  4BBQ A;  4AUQ B;  3LQI A;  4WZ2 A;  3EB5 A;  2OXQ C;  2L80 A;  5H1T A;  2ECT A;  1VYX A;  4AYC B;  3ZYQ A;  3O36 A;  3RPG C;  4LJN A;  3KV6 A;  2HDP A;  2H0D B;  3M99 A;  4L7X A;  2KRE A;  1U6G B;  3PHD A;  2K16 A;  3SOX A;  2E6S A;  2LGK A;  1WEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...