2KYUA

The solution structure of the phd3 finger of mll
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PHD3 domain of MLL acts as a CYP33-regulated switch between MLL-mediated activation and repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase MLL
total genus 9
structure length 67
sequence length 67
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kyuA00
3N9LA 2OXQC 4YBTA 4BHWA 4B7YC 1WEPA 5B76A 3C6WA 4MSXA 2XB1A 2LGGA 3ZVZB 4W4UA 4R2YA 3L1ZB 4V3KC 4CCGX 2YQMA 2AN6A 1WGMA 2K17A 4WA6A 3ZNIA 4LKAA 4R7EA 3SOXA 4FJCA 2D8SA 3RTRB 2F6NA 1VD4A 1HYIA 2G6QA 4S3OB 2CKLA 2LXHC 3O7AA 2JRJA 2YUCA 1WIMA 1IYMA 4YABA 4WZ0A 2VNFA 4NN2A 2MNYA 4I7DA 4F52B 1Z60A 2QICA 2JMJA 4IC3A 5J3XA 2FUIA 4FK5A 4WZ3B 4BBQA 2EODA 3KNVA 2BAYA 2IDAA 5B78A 2ECTA 3M99A 2KGGA 2KIZA 5JG6A 2LRIC 2H0DB 3O36A 2MUMA 5KH9A 2CKLB 2K4DA 4UP5A 5KH3A 2LGVA 4QF3A 2LQ6A 2MA6A 4P5OB 2LN0A 2K1JA 1WEVA 2YREA 2QJ0A 3RPGB 1WFKA 2UZGA 2M85A 4QF2A 1N87A 4PTBA 2VPDA 1T1HA 4L7XA 3HCUA 3DPLR 2ECJA 2H0DA 5G05B 5TDRA 5B79A 4FIPA 2MD7B 1VYXA 2MT5A 1LDJB 4ZQLA 2KR4A 4GNDA 1VFYA 1XWHA 3HTKC 2F42A 3PUQA 3RPGC 1X4UA 2KWOA 2MIQA 5LKXA 4LJNA 2KFTA 3QZVA 1BORA 2HDPA 2EGPA 3N9OA 1FP0A 3EB5A 4UP0A 1WENA 3V43A 3NG2A 2YURA 2VJEB 4PPEA 1G25A 2M6MA 3SHBA 3O37A 4N4FA 2VJFA 3IHPA 3C5KA 5TABA 3GL6A 3KQIA 2I50A 4N3WA 3N9QA 4ZUXU 4LADB 2YHOA 2XEUA 3HCSA 3PURA 2M3HA 4S3OC 5FB0A 4AYCA 3O35A 2ECGA 2LGLA 1RMDA 1WEQA 2PUYA 2VPEA 4GNFA 4FO9A 4A0CD 2KE1A 5FEYA 1FBVA 2JMIA 2L5UA 2MNZA 4AYCB 2E6SA 2NAAA 5TRBA 2YU4A 2EA6A 3O33A 4C9ZA 3ZVYA 1WESA 1HYJA 2RI7A 2LGKA 5FERA 5B75A 4UI9B 2ECWA 5D1KB 3VK6A 3O70A 1F62A 3ZPV1 4V3LC 2LXPC 2VPBA 2VPGA 1JM7B 1K2FA 5TBNA 3O34A 5DINA 5C13A 2KGIA 1JM7A 1MM2A 3LQJA 5B8DA 1X4JA 3EB6A 4XI1A 1CHCA 4AVXA 5H9MA 1Z2QA 4L58A 3HCTA 4YADA 2G45A 2VJFB 5DKAA 3T7LA 2YW8A 2K16A 2L75A 1V87A 5LKTA 2ZETC 3SOWA 2VJEA 3ZPVE 4X3GA 4YC9A 4A49A 4GNEA 4YBSA 3SOUA 4A4BA 4O64A 4GNGA 2L43A 3T6RA 2LDRA 4I7CA 5H1TA 4LLBA 5G04B 3MHSA 2MD8C 3DQVR 1X4IA 2ECNA 2KWNA 1WEEA 2CSZA 4I7BA 3KV5A 2ECIA 1E4UA 4LK9A 1WILA 2G43A 2MA5A 2KREA 1DVPA 5AITA 1WEMA 4YATA 4AP4A 2YT5A 3L1XA 1WEOA 3L11A 5LKUA 2C2VS 3MHHA 2JMDA 2CSYA 2VP7A 2Y1MA 3FL2A 2ECVA 2QIZA 1ZBDB 4AUQB 2YHNA 3M63A 2L0BA 3N9PA 5D1MB 3GV4A 2CT2A 3N9NA 4B86C 5KH7A 3N9MA 5LKZA 3KV6A 2Y1NA 3LQIA 1WEWA 3M62A 2E6RA 4YBMA 2RSDA 3U5NA 2FUUA 2KWKA 2LV9A 4Q6FA 5H1VA 3U5MA 3ZYQA 4IC2A 3I2DA 3ZTGA 4WZ2A 4TKPB 1WE9A 1MM3A 5TDWA 3PHDA 1U6GB 1Z6UA 4R8PK 2YYRA 4CA1A 2YQLA 4ZDTA 5D1LB 3LQHA 5B77A 2L80A 2M1RA 1WEUA 2KYUA 3ASLA 5H1UA 5I3LA 2KWJA 2YSJA 3U5PA 5G0FA 5C11A 2KU3A 3U5OA 1JOCA 1LDKC 2F6JA 4A4CA 2YSMA 2DX8A 2Y43A 4GB0A 5FB1A 5LCWB 2C2LA 5AIUA 2FSAA 5EYAF 4YAXA 2HYED 2PNXA 4MVTA 3LRQA
chains in the Genus database with same CATH superfamily
3N9LA 2OXQC 4YBTA 4BHWA 5SVXA 4B7YC 3LDYA 1WEPA 5B76A 3C6WA 4MSXA 2XB1A 2LGGA 3ZVZB 4W4UA 4R2YA 3L1ZB 4V3KC 4CCGX 2YQMA 2AN6A 1WGMA 2K17A 4WA6A 5SVIB 3ZNIA 4LKAA 4R7EA 3SOXA 3LJUX 4FJCA 2D8SA 3RTRB 2F6NA 3M7KA 1VD4A 1HYIA 3H7HA 2G6QA 4S3OB 2CKLA 2LXHC 3O7AA 2JRJA 2YUCA 1WIMA 1IYMA 4YABA 4WZ0A 2CRWA 2VNFA 4NN2A 2MNYA 5SVYA 4I7DA 4F52B 1Z60A 2QICA 2CSVA 2JMJA 4IC3A 5J3XA 2FUIA 4O62A 4FK5A 2B0OE 3FEHA 4WZ3B 4BBQA 2EODA 3KNVA 2BAYA 2IDAA 5B78A 2FD4A 2ECTA 3M99A 2KGGA 2DJAA 2KIZA 3FANA 5JG6A 2LRIC 2H0DB 3O36A 3T9KA 2MUMA 5KH9A 2CKLB 2K4DA 4UP5A 5KH3A 2LGVA 4QF3A 2LQ6A 2MA6A 4P5OB 2LN0A 2K1JA 2XOYA 2JM3A 1WEVA 3O47A 2YREA 2QJ0A 3RPGB 1WFKA 2UZGA 2M85A 4QF2A 1N87A 4PTBA 2VPDA 1T1HA 2M13A 2FFWA 4L7XA 3HCUA 3DPLR 2ECJA 2H0DA 5G05B 5TDRA 5B79A 2DSMA 4FIPA 2MD7B 1VYXA 2MT5A 1LDJB 4ZQLA 2KR4A 4GNDA 1VFYA 1XWHA 3HTKC 2F42A 3PUQA 3RPGC 1X4UA 2KWOA 4OGCA 2MIQA 5LKXA 4LJNA 2KFTA 3QZVA 1BORA 2HDPA 2EGPA 3N9OA 1FP0A 3EB5A 3LVRE 4UP0A 1WENA 3V43A 3NG2A 2YURA 2VJEB 4PPEA 1G25A 2M6MA 4Z0OA 3SHBA 4Z0RA 3O37A 2MKEA 4N4FA 2VJFA 3IHPA 3C5KA 5TABA 3GL6A 3KQIA 2I50A 4N3WA 3N9QA 4ZUXU 2JUNA 4LADB 2YHOA 2XEUA 3HCSA 3PURA 2M3HA 4QQ4A 3MDBC 4S3OC 5FB0A 4AYCA 3O35A 2ECGA 2LGLA 1RMDA 1WEQA 2PUYA 2VPEA 4GNFA 4FO9A 4A0CD 2KE1A 2OWAA 3FAOA 5FEYA 1FBVA 2JMIA 2L5UA 2MNZA 4AYCB 2E6SA 2NAAA 2D8UA 2KKXA 5TRBA 2YU4A 2EA6A 3O33A 4C9ZA 3ZVYA 1WESA 2E61A 1HYJA 2RI7A 2CONA 2LGKA 5FERA 5B75A 4UI9B 2ECWA 5D1KB 3VK6A 3O70A 1F62A 3ZPV1 4V3LC 2LXPC 2VPBA 2VPGA 1JM7B 1K2FA 5TBNA 3O34A 5DINA 5C13A 4H9DA 2KGIA 1JM7A 1MM2A 3LQJA 5B8DA 1X4JA 3EB6A 4XI1A 1CHCA 5H9MA 4AVXA 1Z2QA 3FM8C 4L58A 3HCTA 4YADA 2G45A 2KKYA 2CRRA 2VJFB 5DKAA 1MBMA 2IQJA 3T7LA 2YW8A 2K16A 2L75A 1V87A 2EGMA 5LKTA 2ZETC 3SOWA 3KDEC 5K3QA 2VJEA 4OGEA 2XOZA 3ZPVE 4X3GA 4YC9A 4A49A 4GNEA 4YBSA 3SOUA 4A4BA 4O64A 4GNGA 2L43A 3T6RA 2LDRA 4I7CA 5H1TA 4LLBA 5G04B 3MHSA 2MD8C 3DQVR 3DWDA 1X4IA 2ECNA 2KWNA 1WEEA 2CSZA 4I7BA 3KV5A 2ECIA 1E4UA 4LK9A 1WILA 2G43A 2MA5A 2KREA 1DVPA 5AITA 1WEMA 4YATA 4AP4A 2YT5A 3L1XA 1WEOA 3L11A 5LKUA 2C2VS 3MHHA 2JMDA 2CSYA 3E2DA 2VP7A 2Y1MA 3FL2A 2ECVA 2QIZA 1ZBDB 3PLWA 4AUQB 2YHNA 3M63A 2L0BA 3N9PA 5D1MB 3GV4A 2CT2A 3N9NA 4B86C 5KH7A 3Q1DA 3N9MA 5LKZA 3KV6A 2Y1NA 3LQIA 1WEWA 3M62A 3DDTA 2E6RA 4YBMA 2EXUA 2RSDA 2RR4A 3U5NA 2FUUA 2KWKA 2LV9A 4Q6FA 5H1VA 3U5MA 3ZYQA 4IC2A 3I2DA 3ZTGA 4WZ2A 4TKPB 1WE9A 1MM3A 5TDWA 3PHDA 4F1PA 1U6GB 1Z6UA 4R8PK 2YYRA 4CA1A 2XP0A 2YQLA 4ZDTA 5D1LB 3LQHA 5B77A 2L80A 2M1RA 1WEUA 2KYUA 3ASLA 5H1UA 5I3LA 2KWJA 3FJUB 2YSJA 2L7PA 3U5PA 1DCQA 2YVRA 5SVIA 5G0FA 5C11A 2KU3A 3U5OA 1JOCA 1LDKC 2F6JA 4A4CA 2YSMA 2DX8A 2Y43A 4GB0A 5FB1A 2LAUA 3SUBA 5LCWB 2C2LA 3LVQE 5AIUA 2FSAA 2XOCA 2P57A 5EYAF 4YAXA 2HYED 2PNXA 4MVTA 3LRQA 3JUEA
chains in the Genus database with same CATH topology
3N9LA 2OXQC 4YBTA 4BHWA 4B7YC 1WEPA 5B76A 3C6WA 4MSXA 2XB1A 2LGGA 3ZVZB 4W4UA 4R2YA 3L1ZB 4V3KC 4CCGX 2YQMA 2AN6A 1WGMA 2K17A 4WA6A 3ZNIA 4LKAA 4R7EA 3SOXA 4FJCA 2D8SA 3RTRB 2F6NA 1VD4A 1HYIA 2G6QA 4S3OB 2CKLA 2LXHC 3O7AA 2JRJA 2YUCA 1WIMA 1IYMA 4YABA 4WZ0A 2VNFA 4NN2A 2MNYA 4I7DA 4F52B 1Z60A 2QICA 2JMJA 4IC3A 5J3XA 2FUIA 4FK5A 4WZ3B 4BBQA 2EODA 3KNVA 2BAYA 2IDAA 5B78A 2ECTA 3M99A 2KGGA 2KIZA 5JG6A 2LRIC 2H0DB 3O36A 2MUMA 5KH9A 2CKLB 2K4DA 4UP5A 5KH3A 2LGVA 4QF3A 2LQ6A 2MA6A 4P5OB 2LN0A 2K1JA 1WEVA 2YREA 2QJ0A 3RPGB 1WFKA 2UZGA 2M85A 4QF2A 1N87A 4PTBA 2VPDA 1T1HA 4L7XA 3HCUA 3DPLR 2ECJA 2H0DA 5G05B 5TDRA 5B79A 4FIPA 2MD7B 1VYXA 2MT5A 1LDJB 4ZQLA 2KR4A 4GNDA 1VFYA 1XWHA 3HTKC 2F42A 3PUQA 3RPGC 1X4UA 2KWOA 2MIQA 5LKXA 4LJNA 2KFTA 3QZVA 1BORA 2HDPA 2EGPA 3N9OA 1FP0A 3EB5A 4UP0A 1WENA 3V43A 3NG2A 2YURA 2VJEB 4PPEA 1G25A 2M6MA 3SHBA 3O37A 4N4FA 2VJFA 3IHPA 3C5KA 5TABA 3GL6A 3KQIA 2I50A 4N3WA 3N9QA 4ZUXU 4LADB 2YHOA 2XEUA 3HCSA 3PURA 2M3HA 4S3OC 5FB0A 4AYCA 3O35A 2ECGA 2LGLA 1RMDA 1WEQA 2PUYA 2VPEA 4GNFA 4FO9A 4A0CD 2KE1A 5FEYA 1FBVA 2JMIA 2L5UA 2MNZA 4AYCB 2E6SA 2NAAA 5TRBA 2YU4A 2EA6A 3O33A 4C9ZA 3ZVYA 1WESA 1HYJA 2RI7A 2LGKA 5FERA 5B75A 4UI9B 2ECWA 5D1KB 3VK6A 3O70A 1F62A 3ZPV1 4V3LC 2LXPC 2VPBA 2VPGA 1JM7B 1K2FA 5TBNA 3O34A 5DINA 5C13A 2KGIA 1JM7A 1MM2A 3LQJA 5B8DA 1X4JA 3EB6A 4XI1A 1CHCA 4AVXA 5H9MA 1Z2QA 4L58A 3HCTA 4YADA 2G45A 2VJFB 5DKAA 3T7LA 2YW8A 2K16A 2L75A 1V87A 5LKTA 2ZETC 3SOWA 2VJEA 3ZPVE 4X3GA 4YC9A 4A49A 4GNEA 4YBSA 3SOUA 4A4BA 4O64A 4GNGA 2L43A 3T6RA 2LDRA 4I7CA 5H1TA 4LLBA 5G04B 3MHSA 2MD8C 3DQVR 1X4IA 2ECNA 2KWNA 1WEEA 2CSZA 4I7BA 3KV5A 2ECIA 1E4UA 4LK9A 1WILA 2G43A 2MA5A 2KREA 1DVPA 5AITA 1WEMA 4YATA 4AP4A 2YT5A 3L1XA 1WEOA 3L11A 5LKUA 2C2VS 3MHHA 2JMDA 2CSYA 2VP7A 2Y1MA 3FL2A 2ECVA 2QIZA 1ZBDB 4AUQB 2YHNA 3M63A 2L0BA 3N9PA 5D1MB 3GV4A 2CT2A 3N9NA 4B86C 5KH7A 3N9MA 5LKZA 3KV6A 2Y1NA 3LQIA 1WEWA 3M62A 2E6RA 4YBMA 2RSDA 3U5NA 2FUUA 2KWKA 2LV9A 4Q6FA 5H1VA 3U5MA 3ZYQA 4IC2A 3I2DA 3ZTGA 4WZ2A 4TKPB 1WE9A 1MM3A 5TDWA 3PHDA 1U6GB 1Z6UA 4R8PK 2YYRA 4CA1A 2YQLA 4ZDTA 5D1LB 3LQHA 5B77A 2L80A 2M1RA 1WEUA 2KYUA 3ASLA 5H1UA 5I3LA 2KWJA 2YSJA 3U5PA 5G0FA 5C11A 2KU3A 3U5OA 1JOCA 1LDKC 2F6JA 4A4CA 2YSMA 2DX8A 2Y43A 4GB0A 5FB1A 5LCWB 2C2LA 5AIUA 2FSAA 5EYAF 4YAXA 2HYED 2PNXA 4MVTA 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9L A;  2OXQ C;  4YBT A;  4BHW A;  4B7Y C;  1WEP A;  5B76 A;  3C6W A;  4MSX A;  2XB1 A;  2LGG A;  3ZVZ B;  4W4U A;  4R2Y A;  3L1Z B;  4V3K C;  4CCG X;  2YQM A;  2AN6 A;  1WGM A;  2K17 A;  4WA6 A;  3ZNI A;  4LKA A;  4R7E A;  3SOX A;  4FJC A;  2D8S A;  3RTR B;  2F6N A;  1VD4 A;  1HYI A;  2G6Q A;  4S3O B;  2CKL A;  2LXH C;  3O7A A;  2JRJ A;  2YUC A;  1WIM A;  1IYM A;  4YAB A;  4WZ0 A;  2VNF A;  4NN2 A;  2MNY A;  4I7D A;  4F52 B;  1Z60 A;  2QIC A;  2JMJ A;  4IC3 A;  5J3X A;  2FUI A;  4FK5 A;  4WZ3 B;  4BBQ A;  2EOD A;  3KNV A;  2BAY A;  2IDA A;  5B78 A;  2ECT A;  3M99 A;  2KGG A;  2KIZ A;  5JG6 A;  2LRI C;  2H0D B;  3O36 A;  2MUM A;  5KH9 A;  2CKL B;  2K4D A;  4UP5 A;  5KH3 A;  2LGV A;  4QF3 A;  2LQ6 A;  2MA6 A;  4P5O B;  2LN0 A;  2K1J A;  1WEV A;  2YRE A;  2QJ0 A;  3RPG B;  1WFK A;  2UZG A;  2M85 A;  4QF2 A;  1N87 A;  4PTB A;  2VPD A;  1T1H A;  4L7X A;  3HCU A;  3DPL R;  2ECJ A;  2H0D A;  5G05 B;  5TDR A;  5B79 A;  4FIP A;  2MD7 B;  1VYX A;  2MT5 A;  1LDJ B;  4ZQL A;  2KR4 A;  4GND A;  1VFY A;  1XWH A;  3HTK C;  2F42 A;  3PUQ A;  3RPG C;  1X4U A;  2KWO A;  2MIQ A;  5LKX A;  4LJN A;  2KFT A;  3QZV A;  1BOR A;  2HDP A;  2EGP A;  3N9O A;  1FP0 A;  3EB5 A;  4UP0 A;  1WEN A;  3V43 A;  3NG2 A;  2YUR A;  2VJE B;  4PPE A;  1G25 A;  2M6M A;  3SHB A;  3O37 A;  4N4F A;  2VJF A;  3IHP A;  3C5K A;  5TAB A;  3GL6 A;  3KQI A;  2I50 A;  4N3W A;  3N9Q A;  4ZUX U;  4LAD B;  2YHO A;  2XEU A;  3HCS A;  3PUR A;  2M3H A;  4S3O C;  5FB0 A;  4AYC A;  3O35 A;  2ECG A;  2LGL A;  1RMD A;  1WEQ A;  2PUY A;  2VPE A;  4GNF A;  4FO9 A;  4A0C D;  2KE1 A;  5FEY A;  1FBV A;  2JMI A;  2L5U A;  2MNZ A;  4AYC B;  2E6S A;  2NAA A;  5TRB A;  2YU4 A;  2EA6 A;  3O33 A;  4C9Z A;  3ZVY A;  1WES A;  1HYJ A;  2RI7 A;  2LGK A;  5FER A;  5B75 A;  4UI9 B;  2ECW A;  5D1K B;  3VK6 A;  3O70 A;  1F62 A;  3ZPV 1;  4V3L C;  2LXP C;  2VPB A;  2VPG A;  1JM7 B;  1K2F A;  5TBN A;  3O34 A;  5DIN A;  5C13 A;  2KGI A;  1JM7 A;  1MM2 A;  3LQJ A;  5B8D A;  1X4J A;  3EB6 A;  4XI1 A;  1CHC A;  4AVX A;  5H9M A;  1Z2Q A;  4L58 A;  3HCT A;  4YAD A;  2G45 A;  2VJF B;  5DKA A;  3T7L A;  2YW8 A;  2K16 A;  2L75 A;  1V87 A;  5LKT A;  2ZET C;  3SOW A;  2VJE A;  3ZPV E;  4X3G A;  4YC9 A;  4A49 A;  4GNE A;  4YBS A;  3SOU A;  4A4B A;  4O64 A;  4GNG A;  2L43 A;  3T6R A;  2LDR A;  4I7C A;  5H1T A;  4LLB A;  5G04 B;  3MHS A;  2MD8 C;  3DQV R;  1X4I A;  2ECN A;  2KWN A;  1WEE A;  2CSZ A;  4I7B A;  3KV5 A;  2ECI A;  1E4U A;  4LK9 A;  1WIL A;  2G43 A;  2MA5 A;  2KRE A;  1DVP A;  5AIT A;  1WEM A;  4YAT A;  4AP4 A;  2YT5 A;  3L1X A;  1WEO A;  3L11 A;  5LKU A;  2C2V S;  3MHH A;  2JMD A;  2CSY A;  2VP7 A;  2Y1M A;  3FL2 A;  2ECV A;  2QIZ A;  1ZBD B;  4AUQ B;  2YHN A;  3M63 A;  2L0B A;  3N9P A;  5D1M B;  3GV4 A;  2CT2 A;  3N9N A;  4B86 C;  5KH7 A;  3N9M A;  5LKZ A;  3KV6 A;  2Y1N A;  3LQI A;  1WEW A;  3M62 A;  2E6R A;  4YBM A;  2RSD A;  3U5N A;  2FUU A;  2KWK A;  2LV9 A;  4Q6F A;  5H1V A;  3U5M A;  3ZYQ A;  4IC2 A;  3I2D A;  3ZTG A;  4WZ2 A;  4TKP B;  1WE9 A;  1MM3 A;  5TDW A;  3PHD A;  1U6G B;  1Z6U A;  4R8P K;  2YYR A;  4CA1 A;  2YQL A;  4ZDT A;  5D1L B;  3LQH A;  5B77 A;  2L80 A;  2M1R A;  1WEU A;  2KYU A;  3ASL A;  5H1U A;  5I3L A;  2KWJ A;  2YSJ A;  3U5P A;  5G0F A;  5C11 A;  2KU3 A;  3U5O A;  1JOC A;  1LDK C;  2F6J A;  4A4C A;  2YSM A;  2DX8 A;  2Y43 A;  4GB0 A;  5FB1 A;  5LCW B;  2C2L A;  5AIU A;  2FSA A;  5EYA F;  4YAX A;  2HYE D;  2PNX A;  4MVT A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 3N9L A;  2OXQ C;  4YBT A;  4BHW A;  5SVX A;  4B7Y C;  3LDY A;  1WEP A;  5B76 A;  3C6W A;  4MSX A;  2XB1 A;  2LGG A;  3ZVZ B;  4W4U A;  4R2Y A;  3L1Z B;  4V3K C;  4CCG X;  2YQM A;  2AN6 A;  1WGM A;  2K17 A;  4WA6 A;  5SVI B;  3ZNI A;  4LKA A;  4R7E A;  3SOX A;  3LJU X;  4FJC A;  2D8S A;  3RTR B;  2F6N A;  3M7K A;  1VD4 A;  1HYI A;  3H7H A;  2G6Q A;  4S3O B;  2CKL A;  2LXH C;  3O7A A;  2JRJ A;  2YUC A;  1WIM A;  1IYM A;  4YAB A;  4WZ0 A;  2CRW A;  2VNF A;  4NN2 A;  2MNY A;  5SVY A;  4I7D A;  4F52 B;  1Z60 A;  2QIC A;  2CSV A;  2JMJ A;  4IC3 A;  5J3X A;  2FUI A;  4O62 A;  4FK5 A;  2B0O E;  3FEH A;  4WZ3 B;  4BBQ A;  2EOD A;  3KNV A;  2BAY A;  2IDA A;  5B78 A;  2FD4 A;  2ECT A;  3M99 A;  2KGG A;  2DJA A;  2KIZ A;  3FAN A;  5JG6 A;  2LRI C;  2H0D B;  3O36 A;  3T9K A;  2MUM A;  5KH9 A;  2CKL B;  2K4D A;  4UP5 A;  5KH3 A;  2LGV A;  4QF3 A;  2LQ6 A;  2MA6 A;  4P5O B;  2LN0 A;  2K1J A;  2XOY A;  2JM3 A;  1WEV A;  3O47 A;  2YRE A;  2QJ0 A;  3RPG B;  1WFK A;  2UZG A;  2M85 A;  4QF2 A;  1N87 A;  4PTB A;  2VPD A;  1T1H A;  2M13 A;  2FFW A;  4L7X A;  3HCU A;  3DPL R;  2ECJ A;  2H0D A;  5G05 B;  5TDR A;  5B79 A;  2DSM A;  4FIP A;  2MD7 B;  1VYX A;  2MT5 A;  1LDJ B;  4ZQL A;  2KR4 A;  4GND A;  1VFY A;  1XWH A;  3HTK C;  2F42 A;  3PUQ A;  3RPG C;  1X4U A;  2KWO A;  4OGC A;  2MIQ A;  5LKX A;  4LJN A;  2KFT A;  3QZV A;  1BOR A;  2HDP A;  2EGP A;  3N9O A;  1FP0 A;  3EB5 A;  3LVR E;  4UP0 A;  1WEN A;  3V43 A;  3NG2 A;  2YUR A;  2VJE B;  4PPE A;  1G25 A;  2M6M A;  4Z0O A;  3SHB A;  4Z0R A;  3O37 A;  2MKE A;  4N4F A;  2VJF A;  3IHP A;  3C5K A;  5TAB A;  3GL6 A;  3KQI A;  2I50 A;  4N3W A;  3N9Q A;  4ZUX U;  2JUN A;  4LAD B;  2YHO A;  2XEU A;  3HCS A;  3PUR A;  2M3H A;  4QQ4 A;  3MDB C;  4S3O C;  5FB0 A;  4AYC A;  3O35 A;  2ECG A;  2LGL A;  1RMD A;  1WEQ A;  2PUY A;  2VPE A;  4GNF A;  4FO9 A;  4A0C D;  2KE1 A;  2OWA A;  3FAO A;  5FEY A;  1FBV A;  2JMI A;  2L5U A;  2MNZ A;  4AYC B;  2E6S A;  2NAA A;  2D8U A;  2KKX A;  5TRB A;  2YU4 A;  2EA6 A;  3O33 A;  4C9Z A;  3ZVY A;  1WES A;  2E61 A;  1HYJ A;  2RI7 A;  2CON A;  2LGK A;  5FER A;  5B75 A;  4UI9 B;  2ECW A;  5D1K B;  3VK6 A;  3O70 A;  1F62 A;  3ZPV 1;  4V3L C;  2LXP C;  2VPB A;  2VPG A;  1JM7 B;  1K2F A;  5TBN A;  3O34 A;  5DIN A;  5C13 A;  4H9D A;  2KGI A;  1JM7 A;  1MM2 A;  3LQJ A;  5B8D A;  1X4J A;  3EB6 A;  4XI1 A;  1CHC A;  5H9M A;  4AVX A;  1Z2Q A;  3FM8 C;  4L58 A;  3HCT A;  4YAD A;  2G45 A;  2KKY A;  2CRR A;  2VJF B;  5DKA A;  1MBM A;  2IQJ A;  3T7L A;  2YW8 A;  2K16 A;  2L75 A;  1V87 A;  2EGM A;  5LKT A;  2ZET C;  3SOW A;  3KDE C;  5K3Q A;  2VJE A;  4OGE A;  2XOZ A;  3ZPV E;  4X3G A;  4YC9 A;  4A49 A;  4GNE A;  4YBS A;  3SOU A;  4A4B A;  4O64 A;  4GNG A;  2L43 A;  3T6R A;  2LDR A;  4I7C A;  5H1T A;  4LLB A;  5G04 B;  3MHS A;  2MD8 C;  3DQV R;  3DWD A;  1X4I A;  2ECN A;  2KWN A;  1WEE A;  2CSZ A;  4I7B A;  3KV5 A;  2ECI A;  1E4U A;  4LK9 A;  1WIL A;  2G43 A;  2MA5 A;  2KRE A;  1DVP A;  5AIT A;  1WEM A;  4YAT A;  4AP4 A;  2YT5 A;  3L1X A;  1WEO A;  3L11 A;  5LKU A;  2C2V S;  3MHH A;  2JMD A;  2CSY A;  3E2D A;  2VP7 A;  2Y1M A;  3FL2 A;  2ECV A;  2QIZ A;  1ZBD B;  3PLW A;  4AUQ B;  2YHN A;  3M63 A;  2L0B A;  3N9P A;  5D1M B;  3GV4 A;  2CT2 A;  3N9N A;  4B86 C;  5KH7 A;  3Q1D A;  3N9M A;  5LKZ A;  3KV6 A;  2Y1N A;  3LQI A;  1WEW A;  3M62 A;  3DDT A;  2E6R A;  4YBM A;  2EXU A;  2RSD A;  2RR4 A;  3U5N A;  2FUU A;  2KWK A;  2LV9 A;  4Q6F A;  5H1V A;  3U5M A;  3ZYQ A;  4IC2 A;  3I2D A;  3ZTG A;  4WZ2 A;  4TKP B;  1WE9 A;  1MM3 A;  5TDW A;  3PHD A;  4F1P A;  1U6G B;  1Z6U A;  4R8P K;  2YYR A;  4CA1 A;  2XP0 A;  2YQL A;  4ZDT A;  5D1L B;  3LQH A;  5B77 A;  2L80 A;  2M1R A;  1WEU A;  2KYU A;  3ASL A;  5H1U A;  5I3L A;  2KWJ A;  3FJU B;  2YSJ A;  2L7P A;  3U5P A;  1DCQ A;  2YVR A;  5SVI A;  5G0F A;  5C11 A;  2KU3 A;  3U5O A;  1JOC A;  1LDK C;  2F6J A;  4A4C A;  2YSM A;  2DX8 A;  2Y43 A;  4GB0 A;  5FB1 A;  2LAU A;  3SUB A;  5LCW B;  2C2L A;  3LVQ E;  5AIU A;  2FSA A;  2XOC A;  2P57 A;  5EYA F;  4YAX A;  2HYE D;  2PNX A;  4MVT A;  3LRQ A;  3JUE A; 
#chains in the Genus database with same CATH homology
 3N9L A;  2OXQ C;  4YBT A;  4BHW A;  4B7Y C;  1WEP A;  5B76 A;  3C6W A;  4MSX A;  2XB1 A;  2LGG A;  3ZVZ B;  4W4U A;  4R2Y A;  3L1Z B;  4V3K C;  4CCG X;  2YQM A;  2AN6 A;  1WGM A;  2K17 A;  4WA6 A;  3ZNI A;  4LKA A;  4R7E A;  3SOX A;  4FJC A;  2D8S A;  3RTR B;  2F6N A;  1VD4 A;  1HYI A;  2G6Q A;  4S3O B;  2CKL A;  2LXH C;  3O7A A;  2JRJ A;  2YUC A;  1WIM A;  1IYM A;  4YAB A;  4WZ0 A;  2VNF A;  4NN2 A;  2MNY A;  4I7D A;  4F52 B;  1Z60 A;  2QIC A;  2JMJ A;  4IC3 A;  5J3X A;  2FUI A;  4FK5 A;  4WZ3 B;  4BBQ A;  2EOD A;  3KNV A;  2BAY A;  2IDA A;  5B78 A;  2ECT A;  3M99 A;  2KGG A;  2KIZ A;  5JG6 A;  2LRI C;  2H0D B;  3O36 A;  2MUM A;  5KH9 A;  2CKL B;  2K4D A;  4UP5 A;  5KH3 A;  2LGV A;  4QF3 A;  2LQ6 A;  2MA6 A;  4P5O B;  2LN0 A;  2K1J A;  1WEV A;  2YRE A;  2QJ0 A;  3RPG B;  1WFK A;  2UZG A;  2M85 A;  4QF2 A;  1N87 A;  4PTB A;  2VPD A;  1T1H A;  4L7X A;  3HCU A;  3DPL R;  2ECJ A;  2H0D A;  5G05 B;  5TDR A;  5B79 A;  4FIP A;  2MD7 B;  1VYX A;  2MT5 A;  1LDJ B;  4ZQL A;  2KR4 A;  4GND A;  1VFY A;  1XWH A;  3HTK C;  2F42 A;  3PUQ A;  3RPG C;  1X4U A;  2KWO A;  2MIQ A;  5LKX A;  4LJN A;  2KFT A;  3QZV A;  1BOR A;  2HDP A;  2EGP A;  3N9O A;  1FP0 A;  3EB5 A;  4UP0 A;  1WEN A;  3V43 A;  3NG2 A;  2YUR A;  2VJE B;  4PPE A;  1G25 A;  2M6M A;  3SHB A;  3O37 A;  4N4F A;  2VJF A;  3IHP A;  3C5K A;  5TAB A;  3GL6 A;  3KQI A;  2I50 A;  4N3W A;  3N9Q A;  4ZUX U;  4LAD B;  2YHO A;  2XEU A;  3HCS A;  3PUR A;  2M3H A;  4S3O C;  5FB0 A;  4AYC A;  3O35 A;  2ECG A;  2LGL A;  1RMD A;  1WEQ A;  2PUY A;  2VPE A;  4GNF A;  4FO9 A;  4A0C D;  2KE1 A;  5FEY A;  1FBV A;  2JMI A;  2L5U A;  2MNZ A;  4AYC B;  2E6S A;  2NAA A;  5TRB A;  2YU4 A;  2EA6 A;  3O33 A;  4C9Z A;  3ZVY A;  1WES A;  1HYJ A;  2RI7 A;  2LGK A;  5FER A;  5B75 A;  4UI9 B;  2ECW A;  5D1K B;  3VK6 A;  3O70 A;  1F62 A;  3ZPV 1;  4V3L C;  2LXP C;  2VPB A;  2VPG A;  1JM7 B;  1K2F A;  5TBN A;  3O34 A;  5DIN A;  5C13 A;  2KGI A;  1JM7 A;  1MM2 A;  3LQJ A;  5B8D A;  1X4J A;  3EB6 A;  4XI1 A;  1CHC A;  4AVX A;  5H9M A;  1Z2Q A;  4L58 A;  3HCT A;  4YAD A;  2G45 A;  2VJF B;  5DKA A;  3T7L A;  2YW8 A;  2K16 A;  2L75 A;  1V87 A;  5LKT A;  2ZET C;  3SOW A;  2VJE A;  3ZPV E;  4X3G A;  4YC9 A;  4A49 A;  4GNE A;  4YBS A;  3SOU A;  4A4B A;  4O64 A;  4GNG A;  2L43 A;  3T6R A;  2LDR A;  4I7C A;  5H1T A;  4LLB A;  5G04 B;  3MHS A;  2MD8 C;  3DQV R;  1X4I A;  2ECN A;  2KWN A;  1WEE A;  2CSZ A;  4I7B A;  3KV5 A;  2ECI A;  1E4U A;  4LK9 A;  1WIL A;  2G43 A;  2MA5 A;  2KRE A;  1DVP A;  5AIT A;  1WEM A;  4YAT A;  4AP4 A;  2YT5 A;  3L1X A;  1WEO A;  3L11 A;  5LKU A;  2C2V S;  3MHH A;  2JMD A;  2CSY A;  2VP7 A;  2Y1M A;  3FL2 A;  2ECV A;  2QIZ A;  1ZBD B;  4AUQ B;  2YHN A;  3M63 A;  2L0B A;  3N9P A;  5D1M B;  3GV4 A;  2CT2 A;  3N9N A;  4B86 C;  5KH7 A;  3N9M A;  5LKZ A;  3KV6 A;  2Y1N A;  3LQI A;  1WEW A;  3M62 A;  2E6R A;  4YBM A;  2RSD A;  3U5N A;  2FUU A;  2KWK A;  2LV9 A;  4Q6F A;  5H1V A;  3U5M A;  3ZYQ A;  4IC2 A;  3I2D A;  3ZTG A;  4WZ2 A;  4TKP B;  1WE9 A;  1MM3 A;  5TDW A;  3PHD A;  1U6G B;  1Z6U A;  4R8P K;  2YYR A;  4CA1 A;  2YQL A;  4ZDT A;  5D1L B;  3LQH A;  5B77 A;  2L80 A;  2M1R A;  1WEU A;  2KYU A;  3ASL A;  5H1U A;  5I3L A;  2KWJ A;  2YSJ A;  3U5P A;  5G0F A;  5C11 A;  2KU3 A;  3U5O A;  1JOC A;  1LDK C;  2F6J A;  4A4C A;  2YSM A;  2DX8 A;  2Y43 A;  4GB0 A;  5FB1 A;  5LCW B;  2C2L A;  5AIU A;  2FSA A;  5EYA F;  4YAX A;  2HYE D;  2PNX A;  4MVT A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...