2KYUA

The solution structure of the phd3 finger of mll
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase MLL
publication title The PHD3 domain of MLL acts as a CYP33-regulated switch between MLL-mediated activation and repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 9
structure length 67
sequence length 67
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kyuA00
3IHPA 4N4FA 2L0BA 5D1MB 2KYUA 1HYJA 2RSDA 4GNGA 4I7DA 3MHHA 3LQHA 2EGPA 2QIZA 5B8DA 2Y1NA 2FUIA 4O64A 3N9PA 2YW8A 2ECTA 4YABA 5AITA 4MVTA 1RMDA 2M3HA 1G25A 3DPLR 5D1LB 2KE1A 4Q6FA 1Z2QA 3FL2A 3N9MA 4L58A 4AP4A 3PURA 2ECNA 2EODA 1Z6UA 2K17A 5FEYA 2JRJA 4GB0A 2XB1A 2OXQC 5LKZA 2MD7B 3T6RA 5TDWA 1HYIA 2CSYA 3ASLA 3HTKC 4A4CA 5B79A 1VYXA 3V43A 2YREA 2VJFA 2MA5A 2LGGA 4NN2A 1FBVA 5FERA 2VPEA 2L75A 1FP0A 2YHOA 1XWHA 4S3OB 2LV9A 2KWNA 2L43A 2PUYA 3RPGB 5DINA 4S3OC 1U6GB 3RPGC 4QF2A 3SOXA 1WILA 2VPBA 3KV5A 3HCUA 1VD4A 2MIQA 2LDRA 4GNDA 4UP5A 1WEVA 3O7AA 3KQIA 3M62A 4YATA 1T1HA 2VJFB 2LGLA 2LN0A 3O35A 4LKAA 5H1UA 5H1VA 5KH7A 2K1JA 1WENA 4GNEA 4L7XA 2D8SA 2L80A 1X4UA 2M1RA 4R2YA 3HCSA 4AYCA 2KFTA 4YBTA 3O34A 2I50A 4V3KC 4BHWA 3HCTA 2YURA 2YQLA 5TBNA 4FK5A 3LQIA 1WFKA 2DX8A 4MSXA 3N9QA 2ECWA 3O37A 1X4IA 2FUUA 2KGGA 3KV6A 1WEUA 2ECVA 3ZVYA 2CKLA 2F42A 3GV4A 3ZPVE 3ZTGA 3T7LA 1WEEA 4C9ZA 4BBQA 2ECJA 4YAXA 3EB6A 2KREA 4AYCB 2ZETC 4P5OB 3U5OA 4YBSA 5G05B 1LDKC 3O70A 2AN6A 3KNVA 3MHSA 1K2FA 4QF3A 4TKPB 4I7BA 5LKUA 1MM2A 5FB0A 2KWKA 2E6SA 4LJNA 2CKLB 3O36A 3QZVA 2KIZA 3LQJA 3I2DA 3U5PA 4YADA 2F6NA 1LDJB 4FO9A 4YBMA 3C5KA 2MNZA 2YSJA 1WE9A 2YSMA 2YYRA 3M63A 1Z60A 2LXPC 4PPEA 3SHBA 3GL6A 3ZYQA 4PTBA 4R8PK 3RTRB 4LADB 1WEQA 4LK9A 4N3WA 4R7EA 3VK6A 2RI7A 4CA1A 2JMJA 5LKXA 1IYMA 2QJ0A 4W4UA 5LKTA 3U5NA 1WESA 2MNYA 4LLBA 4A4BA 2BAYA 1N87A 2PNXA 1WEOA 2CSZA 4ZUXU 2C2LA 3L1ZB 3C6WA 2JMDA 4UI9B 4FIPA 5EYAF 4B7YC 5KH3A 2VP7A 4AUQB 5C11A 2KWJA 5B75A 2KGIA 1JM7A 4B86C 5C13A 2LGVA 4XI1A 2KWOA 1WEMA 1BORA 2C2VS 2KU3A 4IC3A 5JG6A 3O33A 1V87A 2E6RA 4V3LC 2F6JA 1WGMA 5B76A 5DKAA 2VNFA 4WA6A 3U5MA 5I3LA 5G04B 5TDRA 4I7CA 2YU4A 5B77A 2Y43A 4WZ2A 3LRQA 1F62A 2FSAA 3N9OA 2CT2A 5LCWB 3NG2A 2XEUA 5H1TA 1E4UA 2KR4A 1JM7B 2LRIC 2VPGA 5J3XA 5FB1A 2M85A 2NAAA 4ZDTA 3N9NA 2IDAA 3SOUA 2QICA 2ECGA 2MA6A 3L11A 2HYED 1X4JA 2K16A 1WEWA 4WZ3B 2MUMA 3M99A 2JMIA 2UZGA 1VFYA 1WIMA 1WEPA 1MM3A 2G43A 3PUQA 3PHDA 2Y1MA 3ZPV1 2M6MA 4WZ0A 1DVPA 4CCGX 2L5UA 3ZVZB 5D1KB 2MT5A 5AIUA 3SOWA 2H0DA 2VPDA 4A0CD 3ZNIA 5H9MA 4UP0A 2EA6A 2YHNA 2VJEA 2LGKA 2LXHC 2G6QA 2LQ6A 2YT5A 4F52B 2K4DA 4AVXA 4X3GA 2MD8C 3DQVR 1JOCA 2YUCA 5TRBA 2G45A 3EB5A 5TABA 2ECIA 2H0DB 4FJCA 2VJEB 2YQMA 2HDPA 4A49A 1ZBDB 5B78A 1CHCA 3N9LA 4YC9A 4GNFA 4IC2A 4ZQLA 5G0FA 3L1XA 5KH9A
chains in the Genus database with same CATH superfamily
3IHPA 4QQ4A 4N4FA 2L0BA 5D1MB 2KYUA 1HYJA 2RSDA 4GNGA 4I7DA 3MHHA 3LQHA 2EGPA 2QIZA 5B8DA 2Y1NA 2FUIA 3JUEA 4O64A 3FM8C 3N9PA 2YW8A 2ECTA 4YABA 5AITA 4MVTA 1RMDA 2M3HA 1G25A 3DPLR 5D1LB 2KE1A 2CSVA 4Q6FA 1Z2QA 3FL2A 3FANA 3N9MA 4L58A 2RR4A 4AP4A 3PURA 2ECNA 2EODA 3MDBC 1Z6UA 2DJAA 2K17A 5FEYA 2JRJA 4GB0A 2XB1A 2OXQC 3SUBA 5LKZA 2MD7B 3T6RA 2MKEA 5TDWA 1HYIA 2CSYA 3O47A 3ASLA 3HTKC 4A4CA 5B79A 4O62A 1VYXA 3V43A 4OGEA 2YREA 2VJFA 2MA5A 2LGGA 4NN2A 1FBVA 3FAOA 5FERA 1DCQA 2VPEA 2L75A 1FP0A 2YHOA 1XWHA 4S3OB 3H7HA 2LV9A 4Z0RA 2KWNA 4H9DA 2L43A 2PUYA 3RPGB 5DINA 4S3OC 1U6GB 3RPGC 4QF2A 3SOXA 1WILA 2VPBA 3KV5A 3HCUA 1VD4A 2MIQA 2LDRA 3PLWA 4GNDA 3LVRE 4UP5A 1WEVA 3LJUX 3O7AA 2XP0A 3KQIA 3M62A 4YATA 1T1HA 2VJFB 2LGLA 2LN0A 3O35A 4LKAA 5H1UA 5H1VA 3LVQE 5KH7A 2K1JA 1WENA 4GNEA 3DWDA 4L7XA 2D8SA 2L80A 1X4UA 2M1RA 4R2YA 3HCSA 4AYCA 2KFTA 4YBTA 3O34A 2I50A 4V3KC 2CONA 4BHWA 3HCTA 2OWAA 2YURA 2YQLA 5TBNA 4FK5A 3LQIA 1WFKA 2DX8A 4MSXA 3N9QA 2ECWA 3O37A 1X4IA 2FUUA 4OGCA 2KGGA 3KV6A 1WEUA 2ECVA 3ZVYA 5SVYA 2DSMA 2CKLA 2F42A 3GV4A 3ZPVE 3ZTGA 3T7LA 1WEEA 4C9ZA 4BBQA 3M7KA 2ECJA 4YAXA 3EB6A 2KREA 4AYCB 2IQJA 2ZETC 4P5OB 3U5OA 4YBSA 5G05B 1LDKC 3O70A 2AN6A 3KNVA 3MHSA 1K2FA 4QF3A 4TKPB 4I7BA 5LKUA 3FJUB 1MM2A 5FB0A 2KWKA 2E6SA 2EGMA 4LJNA 2CKLB 2KKXA 3O36A 3DDTA 3Q1DA 3T9KA 3QZVA 2KIZA 3LQJA 3I2DA 3U5PA 4YADA 2F6NA 1LDJB 4FO9A 4YBMA 3C5KA 2MNZA 2JM3A 2YSJA 1WE9A 2YSMA 2YYRA 3M63A 1Z60A 2LXPC 4PPEA 3FEHA 3SHBA 3GL6A 3ZYQA 4PTBA 4R8PK 4Z0OA 3RTRB 4LADB 1WEQA 2B0OE 4LK9A 4N3WA 4R7EA 2JUNA 3VK6A 5SVIA 2RI7A 2FD4A 4CA1A 2JMJA 5LKXA 1IYMA 2QJ0A 2EXUA 1MBMA 4W4UA 5LKTA 3U5NA 1WESA 2E61A 2MNYA 4LLBA 2FFWA 4A4BA 2BAYA 2D8UA 1N87A 2PNXA 2L7PA 1WEOA 3E2DA 2CSZA 4ZUXU 2C2LA 3L1ZB 3C6WA 2JMDA 4UI9B 4FIPA 5EYAF 4B7YC 2KKYA 5SVIB 2VP7A 5KH3A 4AUQB 5C11A 2KWJA 5B75A 2KGIA 1JM7A 4B86C 5C13A 2LGVA 5SVXA 4XI1A 2KWOA 1WEMA 2M13A 1BORA 2C2VS 2KU3A 4IC3A 5JG6A 3O33A 1V87A 2E6RA 4V3LC 2F6JA 1WGMA 5B76A 5DKAA 2VNFA 4WA6A 3U5MA 5K3QA 5I3LA 5G04B 5TDRA 4I7CA 2YU4A 5B77A 2Y43A 4WZ2A 3LRQA 1F62A 2FSAA 3N9OA 2CT2A 5LCWB 3NG2A 2XEUA 5H1TA 1E4UA 2KR4A 2CRWA 1JM7B 2LRIC 2XOZA 2VPGA 4F1PA 5J3XA 5FB1A 2M85A 2NAAA 4ZDTA 3N9NA 2IDAA 3SOUA 2QICA 2ECGA 2MA6A 3L11A 2HYED 1X4JA 2K16A 1WEWA 4WZ3B 2MUMA 3M99A 2JMIA 2UZGA 2LAUA 1VFYA 1WIMA 1WEPA 1MM3A 2G43A 3PUQA 3PHDA 2Y1MA 3ZPV1 2M6MA 4WZ0A 1DVPA 4CCGX 2L5UA 3ZVZB 5D1KB 2MT5A 5AIUA 3SOWA 2H0DA 2VPDA 4A0CD 3ZNIA 5H9MA 4UP0A 2EA6A 2YHNA 2VJEA 2LGKA 2LXHC 2G6QA 2LQ6A 2YT5A 2CRRA 4F52B 2K4DA 4AVXA 3LDYA 4X3GA 2MD8C 3DQVR 1JOCA 2YUCA 5TRBA 3KDEC 2YVRA 2G45A 3EB5A 5TABA 2ECIA 2H0DB 4FJCA 2XOCA 2VJEB 2XOYA 2YQMA 2HDPA 4A49A 1ZBDB 5B78A 1CHCA 3N9LA 4YC9A 4GNFA 4IC2A 4ZQLA 5G0FA 2P57A 3L1XA 5KH9A
chains in the Genus database with same CATH topology
3IHPA 4N4FA 2L0BA 5D1MB 2KYUA 1HYJA 2RSDA 4GNGA 4I7DA 3MHHA 3LQHA 2EGPA 2QIZA 5B8DA 2Y1NA 2FUIA 4O64A 3N9PA 2YW8A 2ECTA 4YABA 5AITA 4MVTA 1RMDA 2M3HA 1G25A 3DPLR 5D1LB 2KE1A 4Q6FA 1Z2QA 3FL2A 3N9MA 4L58A 4AP4A 3PURA 2ECNA 2EODA 1Z6UA 2K17A 5FEYA 2JRJA 4GB0A 2XB1A 2OXQC 5LKZA 2MD7B 3T6RA 5TDWA 1HYIA 2CSYA 3ASLA 3HTKC 4A4CA 5B79A 1VYXA 3V43A 2YREA 2VJFA 2MA5A 2LGGA 4NN2A 1FBVA 5FERA 2VPEA 2L75A 1FP0A 2YHOA 1XWHA 4S3OB 2LV9A 2KWNA 2L43A 2PUYA 3RPGB 5DINA 4S3OC 1U6GB 3RPGC 4QF2A 3SOXA 1WILA 2VPBA 3KV5A 3HCUA 1VD4A 2MIQA 2LDRA 4GNDA 4UP5A 1WEVA 3O7AA 3KQIA 3M62A 4YATA 1T1HA 2VJFB 2LGLA 2LN0A 3O35A 4LKAA 5H1UA 5H1VA 5KH7A 2K1JA 1WENA 4GNEA 4L7XA 2D8SA 2L80A 1X4UA 2M1RA 4R2YA 3HCSA 4AYCA 2KFTA 4YBTA 3O34A 2I50A 4V3KC 4BHWA 3HCTA 2YURA 2YQLA 5TBNA 4FK5A 3LQIA 1WFKA 2DX8A 4MSXA 3N9QA 2ECWA 3O37A 1X4IA 2FUUA 2KGGA 3KV6A 1WEUA 2ECVA 3ZVYA 2CKLA 2F42A 3GV4A 3ZPVE 3ZTGA 3T7LA 1WEEA 4C9ZA 4BBQA 2ECJA 4YAXA 3EB6A 2KREA 4AYCB 2ZETC 4P5OB 3U5OA 4YBSA 5G05B 1LDKC 3O70A 2AN6A 3KNVA 3MHSA 1K2FA 4QF3A 4TKPB 4I7BA 5LKUA 1MM2A 5FB0A 2KWKA 2E6SA 4LJNA 2CKLB 3O36A 3QZVA 2KIZA 3LQJA 3I2DA 3U5PA 4YADA 2F6NA 1LDJB 4FO9A 4YBMA 3C5KA 2MNZA 2YSJA 1WE9A 2YSMA 2YYRA 3M63A 1Z60A 2LXPC 4PPEA 3SHBA 3GL6A 3ZYQA 4PTBA 4R8PK 3RTRB 4LADB 1WEQA 4LK9A 4N3WA 4R7EA 3VK6A 2RI7A 4CA1A 2JMJA 5LKXA 1IYMA 2QJ0A 4W4UA 5LKTA 3U5NA 1WESA 2MNYA 4LLBA 4A4BA 2BAYA 1N87A 2PNXA 1WEOA 2CSZA 4ZUXU 2C2LA 3L1ZB 3C6WA 2JMDA 4UI9B 4FIPA 5EYAF 4B7YC 5KH3A 2VP7A 4AUQB 5C11A 2KWJA 5B75A 2KGIA 1JM7A 4B86C 5C13A 2LGVA 4XI1A 2KWOA 1WEMA 1BORA 2C2VS 2KU3A 4IC3A 5JG6A 3O33A 1V87A 2E6RA 4V3LC 2F6JA 1WGMA 5B76A 5DKAA 2VNFA 4WA6A 3U5MA 5I3LA 5G04B 5TDRA 4I7CA 2YU4A 5B77A 2Y43A 4WZ2A 3LRQA 1F62A 2FSAA 3N9OA 2CT2A 5LCWB 3NG2A 2XEUA 5H1TA 1E4UA 2KR4A 1JM7B 2LRIC 2VPGA 5J3XA 5FB1A 2M85A 2NAAA 4ZDTA 3N9NA 2IDAA 3SOUA 2QICA 2ECGA 2MA6A 3L11A 2HYED 1X4JA 2K16A 1WEWA 4WZ3B 2MUMA 3M99A 2JMIA 2UZGA 1VFYA 1WIMA 1WEPA 1MM3A 2G43A 3PUQA 3PHDA 2Y1MA 3ZPV1 2M6MA 4WZ0A 1DVPA 4CCGX 2L5UA 3ZVZB 5D1KB 2MT5A 5AIUA 3SOWA 2H0DA 2VPDA 4A0CD 3ZNIA 5H9MA 4UP0A 2EA6A 2YHNA 2VJEA 2LGKA 2LXHC 2G6QA 2LQ6A 2YT5A 4F52B 2K4DA 4AVXA 4X3GA 2MD8C 3DQVR 1JOCA 2YUCA 5TRBA 2G45A 3EB5A 5TABA 2ECIA 2H0DB 4FJCA 2VJEB 2YQMA 2HDPA 4A49A 1ZBDB 5B78A 1CHCA 3N9LA 4YC9A 4GNFA 4IC2A 4ZQLA 5G0FA 3L1XA 5KH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHP A;  4N4F A;  2L0B A;  5D1M B;  2KYU A;  1HYJ A;  2RSD A;  4GNG A;  4I7D A;  3MHH A;  3LQH A;  2EGP A;  2QIZ A;  5B8D A;  2Y1N A;  2FUI A;  4O64 A;  3N9P A;  2YW8 A;  2ECT A;  4YAB A;  5AIT A;  4MVT A;  1RMD A;  2M3H A;  1G25 A;  3DPL R;  5D1L B;  2KE1 A;  4Q6F A;  1Z2Q A;  3FL2 A;  3N9M A;  4L58 A;  4AP4 A;  3PUR A;  2ECN A;  2EOD A;  1Z6U A;  2K17 A;  5FEY A;  2JRJ A;  4GB0 A;  2XB1 A;  2OXQ C;  5LKZ A;  2MD7 B;  3T6R A;  5TDW A;  1HYI A;  2CSY A;  3ASL A;  3HTK C;  4A4C A;  5B79 A;  1VYX A;  3V43 A;  2YRE A;  2VJF A;  2MA5 A;  2LGG A;  4NN2 A;  1FBV A;  5FER A;  2VPE A;  2L75 A;  1FP0 A;  2YHO A;  1XWH A;  4S3O B;  2LV9 A;  2KWN A;  2L43 A;  2PUY A;  3RPG B;  5DIN A;  4S3O C;  1U6G B;  3RPG C;  4QF2 A;  3SOX A;  1WIL A;  2VPB A;  3KV5 A;  3HCU A;  1VD4 A;  2MIQ A;  2LDR A;  4GND A;  4UP5 A;  1WEV A;  3O7A A;  3KQI A;  3M62 A;  4YAT A;  1T1H A;  2VJF B;  2LGL A;  2LN0 A;  3O35 A;  4LKA A;  5H1U A;  5H1V A;  5KH7 A;  2K1J A;  1WEN A;  4GNE A;  4L7X A;  2D8S A;  2L80 A;  1X4U A;  2M1R A;  4R2Y A;  3HCS A;  4AYC A;  2KFT A;  4YBT A;  3O34 A;  2I50 A;  4V3K C;  4BHW A;  3HCT A;  2YUR A;  2YQL A;  5TBN A;  4FK5 A;  3LQI A;  1WFK A;  2DX8 A;  4MSX A;  3N9Q A;  2ECW A;  3O37 A;  1X4I A;  2FUU A;  2KGG A;  3KV6 A;  1WEU A;  2ECV A;  3ZVY A;  2CKL A;  2F42 A;  3GV4 A;  3ZPV E;  3ZTG A;  3T7L A;  1WEE A;  4C9Z A;  4BBQ A;  2ECJ A;  4YAX A;  3EB6 A;  2KRE A;  4AYC B;  2ZET C;  4P5O B;  3U5O A;  4YBS A;  5G05 B;  1LDK C;  3O70 A;  2AN6 A;  3KNV A;  3MHS A;  1K2F A;  4QF3 A;  4TKP B;  4I7B A;  5LKU A;  1MM2 A;  5FB0 A;  2KWK A;  2E6S A;  4LJN A;  2CKL B;  3O36 A;  3QZV A;  2KIZ A;  3LQJ A;  3I2D A;  3U5P A;  4YAD A;  2F6N A;  1LDJ B;  4FO9 A;  4YBM A;  3C5K A;  2MNZ A;  2YSJ A;  1WE9 A;  2YSM A;  2YYR A;  3M63 A;  1Z60 A;  2LXP C;  4PPE A;  3SHB A;  3GL6 A;  3ZYQ A;  4PTB A;  4R8P K;  3RTR B;  4LAD B;  1WEQ A;  4LK9 A;  4N3W A;  4R7E A;  3VK6 A;  2RI7 A;  4CA1 A;  2JMJ A;  5LKX A;  1IYM A;  2QJ0 A;  4W4U A;  5LKT A;  3U5N A;  1WES A;  2MNY A;  4LLB A;  4A4B A;  2BAY A;  1N87 A;  2PNX A;  1WEO A;  2CSZ A;  4ZUX U;  2C2L A;  3L1Z B;  3C6W A;  2JMD A;  4UI9 B;  4FIP A;  5EYA F;  4B7Y C;  5KH3 A;  2VP7 A;  4AUQ B;  5C11 A;  2KWJ A;  5B75 A;  2KGI A;  1JM7 A;  4B86 C;  5C13 A;  2LGV A;  4XI1 A;  2KWO A;  1WEM A;  1BOR A;  2C2V S;  2KU3 A;  4IC3 A;  5JG6 A;  3O33 A;  1V87 A;  2E6R A;  4V3L C;  2F6J A;  1WGM A;  5B76 A;  5DKA A;  2VNF A;  4WA6 A;  3U5M A;  5I3L A;  5G04 B;  5TDR A;  4I7C A;  2YU4 A;  5B77 A;  2Y43 A;  4WZ2 A;  3LRQ A;  1F62 A;  2FSA A;  3N9O A;  2CT2 A;  5LCW B;  3NG2 A;  2XEU A;  5H1T A;  1E4U A;  2KR4 A;  1JM7 B;  2LRI C;  2VPG A;  5J3X A;  5FB1 A;  2M85 A;  2NAA A;  4ZDT A;  3N9N A;  2IDA A;  3SOU A;  2QIC A;  2ECG A;  2MA6 A;  3L11 A;  2HYE D;  1X4J A;  2K16 A;  1WEW A;  4WZ3 B;  2MUM A;  3M99 A;  2JMI A;  2UZG A;  1VFY A;  1WIM A;  1WEP A;  1MM3 A;  2G43 A;  3PUQ A;  3PHD A;  2Y1M A;  3ZPV 1;  2M6M A;  4WZ0 A;  1DVP A;  4CCG X;  2L5U A;  3ZVZ B;  5D1K B;  2MT5 A;  5AIU A;  3SOW A;  2H0D A;  2VPD A;  4A0C D;  3ZNI A;  5H9M A;  4UP0 A;  2EA6 A;  2YHN A;  2VJE A;  2LGK A;  2LXH C;  2G6Q A;  2LQ6 A;  2YT5 A;  4F52 B;  2K4D A;  4AVX A;  4X3G A;  2MD8 C;  3DQV R;  1JOC A;  2YUC A;  5TRB A;  2G45 A;  3EB5 A;  5TAB A;  2ECI A;  2H0D B;  4FJC A;  2VJE B;  2YQM A;  2HDP A;  4A49 A;  1ZBD B;  5B78 A;  1CHC A;  3N9L A;  4YC9 A;  4GNF A;  4IC2 A;  4ZQL A;  5G0F A;  3L1X A;  5KH9 A; 
#chains in the Genus database with same CATH topology
 3IHP A;  4QQ4 A;  4N4F A;  2L0B A;  5D1M B;  2KYU A;  1HYJ A;  2RSD A;  4GNG A;  4I7D A;  3MHH A;  3LQH A;  2EGP A;  2QIZ A;  5B8D A;  2Y1N A;  2FUI A;  3JUE A;  4O64 A;  3FM8 C;  3N9P A;  2YW8 A;  2ECT A;  4YAB A;  5AIT A;  4MVT A;  1RMD A;  2M3H A;  1G25 A;  3DPL R;  5D1L B;  2KE1 A;  2CSV A;  4Q6F A;  1Z2Q A;  3FL2 A;  3FAN A;  3N9M A;  4L58 A;  2RR4 A;  4AP4 A;  3PUR A;  2ECN A;  2EOD A;  3MDB C;  1Z6U A;  2DJA A;  2K17 A;  5FEY A;  2JRJ A;  4GB0 A;  2XB1 A;  2OXQ C;  3SUB A;  5LKZ A;  2MD7 B;  3T6R A;  2MKE A;  5TDW A;  1HYI A;  2CSY A;  3O47 A;  3ASL A;  3HTK C;  4A4C A;  5B79 A;  4O62 A;  1VYX A;  3V43 A;  4OGE A;  2YRE A;  2VJF A;  2MA5 A;  2LGG A;  4NN2 A;  1FBV A;  3FAO A;  5FER A;  1DCQ A;  2VPE A;  2L75 A;  1FP0 A;  2YHO A;  1XWH A;  4S3O B;  3H7H A;  2LV9 A;  4Z0R A;  2KWN A;  4H9D A;  2L43 A;  2PUY A;  3RPG B;  5DIN A;  4S3O C;  1U6G B;  3RPG C;  4QF2 A;  3SOX A;  1WIL A;  2VPB A;  3KV5 A;  3HCU A;  1VD4 A;  2MIQ A;  2LDR A;  3PLW A;  4GND A;  3LVR E;  4UP5 A;  1WEV A;  3LJU X;  3O7A A;  2XP0 A;  3KQI A;  3M62 A;  4YAT A;  1T1H A;  2VJF B;  2LGL A;  2LN0 A;  3O35 A;  4LKA A;  5H1U A;  5H1V A;  3LVQ E;  5KH7 A;  2K1J A;  1WEN A;  4GNE A;  3DWD A;  4L7X A;  2D8S A;  2L80 A;  1X4U A;  2M1R A;  4R2Y A;  3HCS A;  4AYC A;  2KFT A;  4YBT A;  3O34 A;  2I50 A;  4V3K C;  2CON A;  4BHW A;  3HCT A;  2OWA A;  2YUR A;  2YQL A;  5TBN A;  4FK5 A;  3LQI A;  1WFK A;  2DX8 A;  4MSX A;  3N9Q A;  2ECW A;  3O37 A;  1X4I A;  2FUU A;  4OGC A;  2KGG A;  3KV6 A;  1WEU A;  2ECV A;  3ZVY A;  5SVY A;  2DSM A;  2CKL A;  2F42 A;  3GV4 A;  3ZPV E;  3ZTG A;  3T7L A;  1WEE A;  4C9Z A;  4BBQ A;  3M7K A;  2ECJ A;  4YAX A;  3EB6 A;  2KRE A;  4AYC B;  2IQJ A;  2ZET C;  4P5O B;  3U5O A;  4YBS A;  5G05 B;  1LDK C;  3O70 A;  2AN6 A;  3KNV A;  3MHS A;  1K2F A;  4QF3 A;  4TKP B;  4I7B A;  5LKU A;  3FJU B;  1MM2 A;  5FB0 A;  2KWK A;  2E6S A;  2EGM A;  4LJN A;  2CKL B;  2KKX A;  3O36 A;  3DDT A;  3Q1D A;  3T9K A;  3QZV A;  2KIZ A;  3LQJ A;  3I2D A;  3U5P A;  4YAD A;  2F6N A;  1LDJ B;  4FO9 A;  4YBM A;  3C5K A;  2MNZ A;  2JM3 A;  2YSJ A;  1WE9 A;  2YSM A;  2YYR A;  3M63 A;  1Z60 A;  2LXP C;  4PPE A;  3FEH A;  3SHB A;  3GL6 A;  3ZYQ A;  4PTB A;  4R8P K;  4Z0O A;  3RTR B;  4LAD B;  1WEQ A;  2B0O E;  4LK9 A;  4N3W A;  4R7E A;  2JUN A;  3VK6 A;  5SVI A;  2RI7 A;  2FD4 A;  4CA1 A;  2JMJ A;  5LKX A;  1IYM A;  2QJ0 A;  2EXU A;  1MBM A;  4W4U A;  5LKT A;  3U5N A;  1WES A;  2E61 A;  2MNY A;  4LLB A;  2FFW A;  4A4B A;  2BAY A;  2D8U A;  1N87 A;  2PNX A;  2L7P A;  1WEO A;  3E2D A;  2CSZ A;  4ZUX U;  2C2L A;  3L1Z B;  3C6W A;  2JMD A;  4UI9 B;  4FIP A;  5EYA F;  4B7Y C;  2KKY A;  5SVI B;  2VP7 A;  5KH3 A;  4AUQ B;  5C11 A;  2KWJ A;  5B75 A;  2KGI A;  1JM7 A;  4B86 C;  5C13 A;  2LGV A;  5SVX A;  4XI1 A;  2KWO A;  1WEM A;  2M13 A;  1BOR A;  2C2V S;  2KU3 A;  4IC3 A;  5JG6 A;  3O33 A;  1V87 A;  2E6R A;  4V3L C;  2F6J A;  1WGM A;  5B76 A;  5DKA A;  2VNF A;  4WA6 A;  3U5M A;  5K3Q A;  5I3L A;  5G04 B;  5TDR A;  4I7C A;  2YU4 A;  5B77 A;  2Y43 A;  4WZ2 A;  3LRQ A;  1F62 A;  2FSA A;  3N9O A;  2CT2 A;  5LCW B;  3NG2 A;  2XEU A;  5H1T A;  1E4U A;  2KR4 A;  2CRW A;  1JM7 B;  2LRI C;  2XOZ A;  2VPG A;  4F1P A;  5J3X A;  5FB1 A;  2M85 A;  2NAA A;  4ZDT A;  3N9N A;  2IDA A;  3SOU A;  2QIC A;  2ECG A;  2MA6 A;  3L11 A;  2HYE D;  1X4J A;  2K16 A;  1WEW A;  4WZ3 B;  2MUM A;  3M99 A;  2JMI A;  2UZG A;  2LAU A;  1VFY A;  1WIM A;  1WEP A;  1MM3 A;  2G43 A;  3PUQ A;  3PHD A;  2Y1M A;  3ZPV 1;  2M6M A;  4WZ0 A;  1DVP A;  4CCG X;  2L5U A;  3ZVZ B;  5D1K B;  2MT5 A;  5AIU A;  3SOW A;  2H0D A;  2VPD A;  4A0C D;  3ZNI A;  5H9M A;  4UP0 A;  2EA6 A;  2YHN A;  2VJE A;  2LGK A;  2LXH C;  2G6Q A;  2LQ6 A;  2YT5 A;  2CRR A;  4F52 B;  2K4D A;  4AVX A;  3LDY A;  4X3G A;  2MD8 C;  3DQV R;  1JOC A;  2YUC A;  5TRB A;  3KDE C;  2YVR A;  2G45 A;  3EB5 A;  5TAB A;  2ECI A;  2H0D B;  4FJC A;  2XOC A;  2VJE B;  2XOY A;  2YQM A;  2HDP A;  4A49 A;  1ZBD B;  5B78 A;  1CHC A;  3N9L A;  4YC9 A;  4GNF A;  4IC2 A;  4ZQL A;  5G0F A;  2P57 A;  3L1X A;  5KH9 A; 
#chains in the Genus database with same CATH homology
 3IHP A;  4N4F A;  2L0B A;  5D1M B;  2KYU A;  1HYJ A;  2RSD A;  4GNG A;  4I7D A;  3MHH A;  3LQH A;  2EGP A;  2QIZ A;  5B8D A;  2Y1N A;  2FUI A;  4O64 A;  3N9P A;  2YW8 A;  2ECT A;  4YAB A;  5AIT A;  4MVT A;  1RMD A;  2M3H A;  1G25 A;  3DPL R;  5D1L B;  2KE1 A;  4Q6F A;  1Z2Q A;  3FL2 A;  3N9M A;  4L58 A;  4AP4 A;  3PUR A;  2ECN A;  2EOD A;  1Z6U A;  2K17 A;  5FEY A;  2JRJ A;  4GB0 A;  2XB1 A;  2OXQ C;  5LKZ A;  2MD7 B;  3T6R A;  5TDW A;  1HYI A;  2CSY A;  3ASL A;  3HTK C;  4A4C A;  5B79 A;  1VYX A;  3V43 A;  2YRE A;  2VJF A;  2MA5 A;  2LGG A;  4NN2 A;  1FBV A;  5FER A;  2VPE A;  2L75 A;  1FP0 A;  2YHO A;  1XWH A;  4S3O B;  2LV9 A;  2KWN A;  2L43 A;  2PUY A;  3RPG B;  5DIN A;  4S3O C;  1U6G B;  3RPG C;  4QF2 A;  3SOX A;  1WIL A;  2VPB A;  3KV5 A;  3HCU A;  1VD4 A;  2MIQ A;  2LDR A;  4GND A;  4UP5 A;  1WEV A;  3O7A A;  3KQI A;  3M62 A;  4YAT A;  1T1H A;  2VJF B;  2LGL A;  2LN0 A;  3O35 A;  4LKA A;  5H1U A;  5H1V A;  5KH7 A;  2K1J A;  1WEN A;  4GNE A;  4L7X A;  2D8S A;  2L80 A;  1X4U A;  2M1R A;  4R2Y A;  3HCS A;  4AYC A;  2KFT A;  4YBT A;  3O34 A;  2I50 A;  4V3K C;  4BHW A;  3HCT A;  2YUR A;  2YQL A;  5TBN A;  4FK5 A;  3LQI A;  1WFK A;  2DX8 A;  4MSX A;  3N9Q A;  2ECW A;  3O37 A;  1X4I A;  2FUU A;  2KGG A;  3KV6 A;  1WEU A;  2ECV A;  3ZVY A;  2CKL A;  2F42 A;  3GV4 A;  3ZPV E;  3ZTG A;  3T7L A;  1WEE A;  4C9Z A;  4BBQ A;  2ECJ A;  4YAX A;  3EB6 A;  2KRE A;  4AYC B;  2ZET C;  4P5O B;  3U5O A;  4YBS A;  5G05 B;  1LDK C;  3O70 A;  2AN6 A;  3KNV A;  3MHS A;  1K2F A;  4QF3 A;  4TKP B;  4I7B A;  5LKU A;  1MM2 A;  5FB0 A;  2KWK A;  2E6S A;  4LJN A;  2CKL B;  3O36 A;  3QZV A;  2KIZ A;  3LQJ A;  3I2D A;  3U5P A;  4YAD A;  2F6N A;  1LDJ B;  4FO9 A;  4YBM A;  3C5K A;  2MNZ A;  2YSJ A;  1WE9 A;  2YSM A;  2YYR A;  3M63 A;  1Z60 A;  2LXP C;  4PPE A;  3SHB A;  3GL6 A;  3ZYQ A;  4PTB A;  4R8P K;  3RTR B;  4LAD B;  1WEQ A;  4LK9 A;  4N3W A;  4R7E A;  3VK6 A;  2RI7 A;  4CA1 A;  2JMJ A;  5LKX A;  1IYM A;  2QJ0 A;  4W4U A;  5LKT A;  3U5N A;  1WES A;  2MNY A;  4LLB A;  4A4B A;  2BAY A;  1N87 A;  2PNX A;  1WEO A;  2CSZ A;  4ZUX U;  2C2L A;  3L1Z B;  3C6W A;  2JMD A;  4UI9 B;  4FIP A;  5EYA F;  4B7Y C;  5KH3 A;  2VP7 A;  4AUQ B;  5C11 A;  2KWJ A;  5B75 A;  2KGI A;  1JM7 A;  4B86 C;  5C13 A;  2LGV A;  4XI1 A;  2KWO A;  1WEM A;  1BOR A;  2C2V S;  2KU3 A;  4IC3 A;  5JG6 A;  3O33 A;  1V87 A;  2E6R A;  4V3L C;  2F6J A;  1WGM A;  5B76 A;  5DKA A;  2VNF A;  4WA6 A;  3U5M A;  5I3L A;  5G04 B;  5TDR A;  4I7C A;  2YU4 A;  5B77 A;  2Y43 A;  4WZ2 A;  3LRQ A;  1F62 A;  2FSA A;  3N9O A;  2CT2 A;  5LCW B;  3NG2 A;  2XEU A;  5H1T A;  1E4U A;  2KR4 A;  1JM7 B;  2LRI C;  2VPG A;  5J3X A;  5FB1 A;  2M85 A;  2NAA A;  4ZDT A;  3N9N A;  2IDA A;  3SOU A;  2QIC A;  2ECG A;  2MA6 A;  3L11 A;  2HYE D;  1X4J A;  2K16 A;  1WEW A;  4WZ3 B;  2MUM A;  3M99 A;  2JMI A;  2UZG A;  1VFY A;  1WIM A;  1WEP A;  1MM3 A;  2G43 A;  3PUQ A;  3PHD A;  2Y1M A;  3ZPV 1;  2M6M A;  4WZ0 A;  1DVP A;  4CCG X;  2L5U A;  3ZVZ B;  5D1K B;  2MT5 A;  5AIU A;  3SOW A;  2H0D A;  2VPD A;  4A0C D;  3ZNI A;  5H9M A;  4UP0 A;  2EA6 A;  2YHN A;  2VJE A;  2LGK A;  2LXH C;  2G6Q A;  2LQ6 A;  2YT5 A;  4F52 B;  2K4D A;  4AVX A;  4X3G A;  2MD8 C;  3DQV R;  1JOC A;  2YUC A;  5TRB A;  2G45 A;  3EB5 A;  5TAB A;  2ECI A;  2H0D B;  4FJC A;  2VJE B;  2YQM A;  2HDP A;  4A49 A;  1ZBD B;  5B78 A;  1CHC A;  3N9L A;  4YC9 A;  4GNF A;  4IC2 A;  4ZQL A;  5G0F A;  3L1X A;  5KH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...