2KYUA

The solution structure of the phd3 finger of mll
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The PHD3 domain of MLL acts as a CYP33-regulated switch between MLL-mediated activation and repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase MLL
total genus 9
structure length 67
sequence length 67
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kyuA00
1XWHA 1BORA 3SOUA 1V87A 3PHDA 3O7AA 4WA6A 2VNFA 4AP4A 4UI9B 3M99A 4YATA 4S3OB 4YC9A 4P5OB 2QIZA 4I7CA 4LJNA 2EODA 1WEWA 3DPLR 1N87A 2FUIA 4Q6FA 3EB6A 5LKUA 4L7XA 4QF3A 2G6QA 5KH3A 2MA5A 2UZGA 4AYCB 3SOXA 2YQMA 2YURA 4PTBA 2G45A 2XEUA 4V3LC 4I7BA 2H0DB 1IYMA 2L0BA 2HDPA 5DINA 5I3LA 1FBVA 2KE1A 3NG2A 2YUCA 2YHOA 4ZQLA 5G04B 3T6RA 1G25A 1X4JA 4N4FA 1LDJB 2YSJA 3N9PA 4YABA 4YADA 5LKTA 2C2LA 5EYAF 2M1RA 3HCTA 2LGGA 2PUYA 4F52B 2YSMA 2MUMA 1VYXA 2L5UA 2CT2A 2EGPA 5TDWA 2VJEB 1DVPA 2YU4A 2MD8C 2PNXA 1WEVA 3KV5A 4L58A 5DKAA 2MT5A 2G43A 1E4UA 1VFYA 5AIUA 2ECIA 3VK6A 4MVTA 5FERA 2ECTA 3U5MA 2Y1NA 4AYCA 1WGMA 3HTKC 1WEUA 2F6NA 3V43A 4CA1A 2MA6A 3C5KA 5TABA 4WZ3B 4A4CA 2H0DA 2IDAA 1Z60A 5B8DA 5FB0A 3ASLA 4FIPA 2CKLB 3C6WA 3ZTGA 1WEEA 3PURA 5B76A 4AUQB 1RMDA 4XI1A 1X4IA 1MM3A 3LQHA 3LQIA 4GNEA 2XB1A 4NN2A 2FUUA 4YBMA 4UP0A 2LXHC 4A0CD 4WZ0A 2E6RA 2LQ6A 2VP7A 5JG6A 2F6JA 2L75A 2M3HA 4C9ZA 2ZETC 3IHPA 1LDKC 2LGLA 2VPEA 2VJEA 3T7LA 4LLBA 4GB0A 4FK5A 5B78A 1ZBDB 1MM2A 2KGIA 2VJFB 3M62A 3MHHA 5TBNA 2ECVA 3O70A 2MNZA 3DQVR 4R8PK 2LDRA 2YT5A 4LADB 3ZVZB 4CCGX 5H1TA 5J3XA 2Y1MA 1JOCA 1Z2QA 1X4UA 5AITA 4O64A 3L11A 2LN0A 5FEYA 5TDRA 3RPGB 3ZYQA 2K16A 4B7YC 3RPGC 2DX8A 4YBTA 3MHSA 2K1JA 2QJ0A 3L1XA 3ZNIA 5B79A 5LKZA 2LGKA 2VPDA 5H1VA 5H1UA 2KWOA 1JM7B 1T1HA 2E6SA 4R7EA 3O33A 4LK9A 1FP0A 2I50A 4TKPB 4UP5A 3HCUA 3GL6A 3O36A 2F42A 3SOWA 3L1ZB 2VPBA 2K17A 1WIMA 2VJFA 4AVXA 2C2VS 2LRIC 5B75A 3SHBA 5D1LB 4BHWA 3N9QA 3N9OA 5G0FA 5KH9A 5C11A 3KQIA 4FO9A 2YHNA 1WEMA 1WE9A 1HYJA 5H9MA 4N3WA 1JM7A 3LRQA 3HCSA 2M85A 1HYIA 3O34A 3KNVA 4QF2A 1CHCA 3EB5A 5C13A 2CKLA 2EA6A 5D1MB 2FSAA 2KU3A 3U5OA 2D8SA 3ZVYA 4X3GA 4V3KC 1K2FA 4GNFA 2MNYA 4IC2A 2LGVA 4S3OC 4ZDTA 2CSZA 2KIZA 1WFKA 2JMIA 5FB1A 2AN6A 3RTRB 3PUQA 5LCWB 5KH7A 1WEQA 3N9NA 4A4BA 1VD4A 1WILA 2JMDA 4YBSA 1WENA 2YREA 1F62A 2NAAA 4MSXA 3QZVA 2MD7B 3GV4A 2K4DA 2ECGA 4YAXA 5D1KB 3M63A 1U6GB 4FJCA 2ECWA 3N9MA 4PPEA 2Y43A 5G05B 4IC3A 1WEOA 2KWKA 2ECNA 3ZPVE 2YW8A 4A49A 2CSYA 3I2DA 2KFTA 2YYRA 2HYED 2JMJA 3O37A 2YQLA 2L43A 4R2YA 3O35A 2KYUA 2LV9A 3ZPV1 2MIQA 2KWJA 1WESA 2BAYA 3LQJA 4ZUXU 5LKXA 4WZ2A 2KR4A 2JRJA 2ECJA 5B77A 3U5PA 2QICA 2KGGA 5TRBA 2RI7A 3U5NA 1WEPA 2L80A 2KWNA 2VPGA 3FL2A 4BBQA 4GNGA 2M6MA 2KREA 4LKAA 4GNDA 2RSDA 4B86C 4W4UA 1Z6UA 3N9LA 2LXPC 4I7DA 2OXQC 3KV6A
chains in the Genus database with same CATH superfamily
2JM3A 1XWHA 1BORA 3SOUA 4QQ4A 1V87A 3PHDA 3O7AA 4WA6A 2VNFA 2CONA 4AP4A 4UI9B 3M99A 4YATA 4S3OB 4YC9A 4P5OB 2QIZA 4I7CA 4LJNA 2EODA 1WEWA 3DPLR 1N87A 2FUIA 4Q6FA 3EB6A 5LKUA 4L7XA 4QF3A 2P57A 2G6QA 5KH3A 2MA5A 2UZGA 4AYCB 2FFWA 3SOXA 2YQMA 2YURA 4PTBA 2G45A 3DWDA 2XEUA 4V3LC 4I7BA 2H0DB 2E61A 1IYMA 2L0BA 2HDPA 5DINA 5I3LA 1FBVA 5K3QA 2KE1A 2KKYA 3NG2A 2YUCA 2YHOA 4ZQLA 2MKEA 2L7PA 3MDBC 5G04B 3T6RA 1G25A 1X4JA 4N4FA 2DSMA 1LDJB 2YSJA 3N9PA 4YABA 4YADA 5LKTA 2C2LA 5EYAF 2M1RA 3JUEA 3HCTA 2LGGA 2PUYA 4F52B 2YSMA 2MUMA 1VYXA 2L5UA 2CT2A 2EGPA 4OGCA 5TDWA 3SUBA 2VJEB 1DVPA 2YU4A 2EGMA 2MD8C 2PNXA 1WEVA 3KV5A 4L58A 2CSVA 5DKAA 5SVIB 2MT5A 2G43A 1E4UA 1VFYA 5AIUA 2ECIA 3VK6A 4MVTA 5FERA 3Q1DA 2ECTA 3U5MA 2Y1NA 4AYCA 1WGMA 3HTKC 1WEUA 2F6NA 3V43A 4CA1A 2MA6A 3C5KA 5TABA 4WZ3B 4A4CA 2H0DA 2IDAA 1Z60A 5B8DA 5FB0A 2OWAA 3FAOA 3ASLA 4FIPA 2CKLB 3C6WA 3ZTGA 1WEEA 3PURA 5B76A 4AUQB 1RMDA 4XI1A 1X4IA 1MM3A 3LQHA 3LQIA 4GNEA 2XB1A 2D8UA 4NN2A 2FUUA 4YBMA 3DDTA 4UP0A 2LXHC 4A0CD 4WZ0A 2E6RA 2LQ6A 3FM8C 2LAUA 2VP7A 5JG6A 2F6JA 2L75A 2M3HA 4C9ZA 2ZETC 3IHPA 1LDKC 2FD4A 2LGLA 2VPEA 2VJEA 3T7LA 4LLBA 4GB0A 4FK5A 5B78A 1ZBDB 1MM2A 2KGIA 2VJFB 3M62A 3MHHA 2DJAA 2KKXA 5TBNA 2ECVA 3O70A 3T9KA 2MNZA 2CRRA 3DQVR 4R8PK 2LDRA 2YT5A 4LADB 3LVQE 3ZVZB 4CCGX 5H1TA 4Z0RA 5J3XA 2Y1MA 1JOCA 1Z2QA 1X4UA 2JUNA 5AITA 3FJUB 4O64A 3L11A 2LN0A 5FEYA 5TDRA 3RPGB 3ZYQA 2K16A 4B7YC 3RPGC 2DX8A 4YBTA 3MHSA 2K1JA 2QJ0A 3L1XA 4OGEA 3ZNIA 5B79A 5LKZA 2LGKA 2VPDA 5H1VA 5H1UA 2KWOA 1JM7B 3FANA 1T1HA 2E6SA 4R7EA 3FEHA 3O33A 4LK9A 1FP0A 2I50A 4TKPB 4UP5A 3HCUA 3GL6A 3O36A 2F42A 3SOWA 3L1ZB 2VPBA 4H9DA 4O62A 2K17A 1WIMA 2VJFA 4AVXA 2C2VS 2LRIC 5B75A 3KDEC 5SVYA 3SHBA 2XOCA 4F1PA 5D1LB 4BHWA 3N9QA 3N9OA 5G0FA 5KH9A 5C11A 3KQIA 4FO9A 2YHNA 1WEMA 1WE9A 2XOZA 1HYJA 4N3WA 5H9MA 1JM7A 3LRQA 3HCSA 3PLWA 2M85A 1HYIA 3O34A 3KNVA 4QF2A 1CHCA 3EB5A 5C13A 2CKLA 2EA6A 5SVXA 5D1MB 2FSAA 2KU3A 3U5OA 2D8SA 3ZVYA 4X3GA 4V3KC 1K2FA 4GNFA 2MNYA 4IC2A 3M7KA 3LDYA 2LGVA 2YVRA 4S3OC 4ZDTA 2CSZA 2KIZA 1WFKA 2JMIA 5FB1A 2AN6A 3RTRB 3PUQA 5SVIA 3E2DA 5LCWB 5KH7A 1WEQA 3N9NA 2XOYA 4A4BA 3LVRE 3O47A 1VD4A 1WILA 2JMDA 4Z0OA 4YBSA 1WENA 2YREA 1F62A 2NAAA 4MSXA 3QZVA 2MD7B 3H7HA 3GV4A 2K4DA 2ECGA 4YAXA 5D1KB 3M63A 1U6GB 4FJCA 2ECWA 3N9MA 4PPEA 2Y43A 5G05B 4IC3A 1MBMA 1WEOA 2KWKA 2M13A 2ECNA 3ZPVE 2YW8A 3LJUX 4A49A 2CSYA 2CRWA 1DCQA 3I2DA 2KFTA 2YYRA 2RR4A 2HYED 2JMJA 3O37A 2YQLA 2L43A 4R2YA 3O35A 2KYUA 2XP0A 2LV9A 3ZPV1 2MIQA 2KWJA 1WESA 2BAYA 3LQJA 2B0OE 4ZUXU 5LKXA 4WZ2A 2KR4A 2JRJA 2ECJA 5B77A 3U5PA 2QICA 2KGGA 5TRBA 2RI7A 3U5NA 1WEPA 2L80A 2KWNA 2VPGA 3FL2A 4BBQA 4GNGA 2M6MA 2KREA 4LKAA 4GNDA 2RSDA 4B86C 2EXUA 2IQJA 4W4UA 1Z6UA 3N9LA 2LXPC 4I7DA 2OXQC 3KV6A
chains in the Genus database with same CATH topology
1XWHA 1BORA 3SOUA 1V87A 3PHDA 3O7AA 4WA6A 2VNFA 4AP4A 4UI9B 3M99A 4YATA 4S3OB 4YC9A 4P5OB 2QIZA 4I7CA 4LJNA 2EODA 1WEWA 3DPLR 1N87A 2FUIA 4Q6FA 3EB6A 5LKUA 4L7XA 4QF3A 2G6QA 5KH3A 2MA5A 2UZGA 4AYCB 3SOXA 2YQMA 2YURA 4PTBA 2G45A 2XEUA 4V3LC 4I7BA 2H0DB 1IYMA 2L0BA 2HDPA 5DINA 5I3LA 1FBVA 2KE1A 3NG2A 2YUCA 2YHOA 4ZQLA 5G04B 3T6RA 1G25A 1X4JA 4N4FA 1LDJB 2YSJA 3N9PA 4YABA 4YADA 5LKTA 2C2LA 5EYAF 2M1RA 3HCTA 2LGGA 2PUYA 4F52B 2YSMA 2MUMA 1VYXA 2L5UA 2CT2A 2EGPA 5TDWA 2VJEB 1DVPA 2YU4A 2MD8C 2PNXA 1WEVA 3KV5A 4L58A 5DKAA 2MT5A 2G43A 1E4UA 1VFYA 5AIUA 2ECIA 3VK6A 4MVTA 5FERA 2ECTA 3U5MA 2Y1NA 4AYCA 1WGMA 3HTKC 1WEUA 2F6NA 3V43A 4CA1A 2MA6A 3C5KA 5TABA 4WZ3B 4A4CA 2H0DA 2IDAA 1Z60A 5B8DA 5FB0A 3ASLA 4FIPA 2CKLB 3C6WA 3ZTGA 1WEEA 3PURA 5B76A 4AUQB 1RMDA 4XI1A 1X4IA 1MM3A 3LQHA 3LQIA 4GNEA 2XB1A 4NN2A 2FUUA 4YBMA 4UP0A 2LXHC 4A0CD 4WZ0A 2E6RA 2LQ6A 2VP7A 5JG6A 2F6JA 2L75A 2M3HA 4C9ZA 2ZETC 3IHPA 1LDKC 2LGLA 2VPEA 2VJEA 3T7LA 4LLBA 4GB0A 4FK5A 5B78A 1ZBDB 1MM2A 2KGIA 2VJFB 3M62A 3MHHA 5TBNA 2ECVA 3O70A 2MNZA 3DQVR 4R8PK 2LDRA 2YT5A 4LADB 3ZVZB 4CCGX 5H1TA 5J3XA 2Y1MA 1JOCA 1Z2QA 1X4UA 5AITA 4O64A 3L11A 2LN0A 5FEYA 5TDRA 3RPGB 3ZYQA 2K16A 4B7YC 3RPGC 2DX8A 4YBTA 3MHSA 2K1JA 2QJ0A 3L1XA 3ZNIA 5B79A 5LKZA 2LGKA 2VPDA 5H1VA 5H1UA 2KWOA 1JM7B 1T1HA 2E6SA 4R7EA 3O33A 4LK9A 1FP0A 2I50A 4TKPB 4UP5A 3HCUA 3GL6A 3O36A 2F42A 3SOWA 3L1ZB 2VPBA 2K17A 1WIMA 2VJFA 4AVXA 2C2VS 2LRIC 5B75A 3SHBA 5D1LB 4BHWA 3N9QA 3N9OA 5G0FA 5KH9A 5C11A 3KQIA 4FO9A 2YHNA 1WEMA 1WE9A 1HYJA 5H9MA 4N3WA 1JM7A 3LRQA 3HCSA 2M85A 1HYIA 3O34A 3KNVA 4QF2A 1CHCA 3EB5A 5C13A 2CKLA 2EA6A 5D1MB 2FSAA 2KU3A 3U5OA 2D8SA 3ZVYA 4X3GA 4V3KC 1K2FA 4GNFA 2MNYA 4IC2A 2LGVA 4S3OC 4ZDTA 2CSZA 2KIZA 1WFKA 2JMIA 5FB1A 2AN6A 3RTRB 3PUQA 5LCWB 5KH7A 1WEQA 3N9NA 4A4BA 1VD4A 1WILA 2JMDA 4YBSA 1WENA 2YREA 1F62A 2NAAA 4MSXA 3QZVA 2MD7B 3GV4A 2K4DA 2ECGA 4YAXA 5D1KB 3M63A 1U6GB 4FJCA 2ECWA 3N9MA 4PPEA 2Y43A 5G05B 4IC3A 1WEOA 2KWKA 2ECNA 3ZPVE 2YW8A 4A49A 2CSYA 3I2DA 2KFTA 2YYRA 2HYED 2JMJA 3O37A 2YQLA 2L43A 4R2YA 3O35A 2KYUA 2LV9A 3ZPV1 2MIQA 2KWJA 1WESA 2BAYA 3LQJA 4ZUXU 5LKXA 4WZ2A 2KR4A 2JRJA 2ECJA 5B77A 3U5PA 2QICA 2KGGA 5TRBA 2RI7A 3U5NA 1WEPA 2L80A 2KWNA 2VPGA 3FL2A 4BBQA 4GNGA 2M6MA 2KREA 4LKAA 4GNDA 2RSDA 4B86C 4W4UA 1Z6UA 3N9LA 2LXPC 4I7DA 2OXQC 3KV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWH A;  1BOR A;  3SOU A;  1V87 A;  3PHD A;  3O7A A;  4WA6 A;  2VNF A;  4AP4 A;  4UI9 B;  3M99 A;  4YAT A;  4S3O B;  4YC9 A;  4P5O B;  2QIZ A;  4I7C A;  4LJN A;  2EOD A;  1WEW A;  3DPL R;  1N87 A;  2FUI A;  4Q6F A;  3EB6 A;  5LKU A;  4L7X A;  4QF3 A;  2G6Q A;  5KH3 A;  2MA5 A;  2UZG A;  4AYC B;  3SOX A;  2YQM A;  2YUR A;  4PTB A;  2G45 A;  2XEU A;  4V3L C;  4I7B A;  2H0D B;  1IYM A;  2L0B A;  2HDP A;  5DIN A;  5I3L A;  1FBV A;  2KE1 A;  3NG2 A;  2YUC A;  2YHO A;  4ZQL A;  5G04 B;  3T6R A;  1G25 A;  1X4J A;  4N4F A;  1LDJ B;  2YSJ A;  3N9P A;  4YAB A;  4YAD A;  5LKT A;  2C2L A;  5EYA F;  2M1R A;  3HCT A;  2LGG A;  2PUY A;  4F52 B;  2YSM A;  2MUM A;  1VYX A;  2L5U A;  2CT2 A;  2EGP A;  5TDW A;  2VJE B;  1DVP A;  2YU4 A;  2MD8 C;  2PNX A;  1WEV A;  3KV5 A;  4L58 A;  5DKA A;  2MT5 A;  2G43 A;  1E4U A;  1VFY A;  5AIU A;  2ECI A;  3VK6 A;  4MVT A;  5FER A;  2ECT A;  3U5M A;  2Y1N A;  4AYC A;  1WGM A;  3HTK C;  1WEU A;  2F6N A;  3V43 A;  4CA1 A;  2MA6 A;  3C5K A;  5TAB A;  4WZ3 B;  4A4C A;  2H0D A;  2IDA A;  1Z60 A;  5B8D A;  5FB0 A;  3ASL A;  4FIP A;  2CKL B;  3C6W A;  3ZTG A;  1WEE A;  3PUR A;  5B76 A;  4AUQ B;  1RMD A;  4XI1 A;  1X4I A;  1MM3 A;  3LQH A;  3LQI A;  4GNE A;  2XB1 A;  4NN2 A;  2FUU A;  4YBM A;  4UP0 A;  2LXH C;  4A0C D;  4WZ0 A;  2E6R A;  2LQ6 A;  2VP7 A;  5JG6 A;  2F6J A;  2L75 A;  2M3H A;  4C9Z A;  2ZET C;  3IHP A;  1LDK C;  2LGL A;  2VPE A;  2VJE A;  3T7L A;  4LLB A;  4GB0 A;  4FK5 A;  5B78 A;  1ZBD B;  1MM2 A;  2KGI A;  2VJF B;  3M62 A;  3MHH A;  5TBN A;  2ECV A;  3O70 A;  2MNZ A;  3DQV R;  4R8P K;  2LDR A;  2YT5 A;  4LAD B;  3ZVZ B;  4CCG X;  5H1T A;  5J3X A;  2Y1M A;  1JOC A;  1Z2Q A;  1X4U A;  5AIT A;  4O64 A;  3L11 A;  2LN0 A;  5FEY A;  5TDR A;  3RPG B;  3ZYQ A;  2K16 A;  4B7Y C;  3RPG C;  2DX8 A;  4YBT A;  3MHS A;  2K1J A;  2QJ0 A;  3L1X A;  3ZNI A;  5B79 A;  5LKZ A;  2LGK A;  2VPD A;  5H1V A;  5H1U A;  2KWO A;  1JM7 B;  1T1H A;  2E6S A;  4R7E A;  3O33 A;  4LK9 A;  1FP0 A;  2I50 A;  4TKP B;  4UP5 A;  3HCU A;  3GL6 A;  3O36 A;  2F42 A;  3SOW A;  3L1Z B;  2VPB A;  2K17 A;  1WIM A;  2VJF A;  4AVX A;  2C2V S;  2LRI C;  5B75 A;  3SHB A;  5D1L B;  4BHW A;  3N9Q A;  3N9O A;  5G0F A;  5KH9 A;  5C11 A;  3KQI A;  4FO9 A;  2YHN A;  1WEM A;  1WE9 A;  1HYJ A;  5H9M A;  4N3W A;  1JM7 A;  3LRQ A;  3HCS A;  2M85 A;  1HYI A;  3O34 A;  3KNV A;  4QF2 A;  1CHC A;  3EB5 A;  5C13 A;  2CKL A;  2EA6 A;  5D1M B;  2FSA A;  2KU3 A;  3U5O A;  2D8S A;  3ZVY A;  4X3G A;  4V3K C;  1K2F A;  4GNF A;  2MNY A;  4IC2 A;  2LGV A;  4S3O C;  4ZDT A;  2CSZ A;  2KIZ A;  1WFK A;  2JMI A;  5FB1 A;  2AN6 A;  3RTR B;  3PUQ A;  5LCW B;  5KH7 A;  1WEQ A;  3N9N A;  4A4B A;  1VD4 A;  1WIL A;  2JMD A;  4YBS A;  1WEN A;  2YRE A;  1F62 A;  2NAA A;  4MSX A;  3QZV A;  2MD7 B;  3GV4 A;  2K4D A;  2ECG A;  4YAX A;  5D1K B;  3M63 A;  1U6G B;  4FJC A;  2ECW A;  3N9M A;  4PPE A;  2Y43 A;  5G05 B;  4IC3 A;  1WEO A;  2KWK A;  2ECN A;  3ZPV E;  2YW8 A;  4A49 A;  2CSY A;  3I2D A;  2KFT A;  2YYR A;  2HYE D;  2JMJ A;  3O37 A;  2YQL A;  2L43 A;  4R2Y A;  3O35 A;  2KYU A;  2LV9 A;  3ZPV 1;  2MIQ A;  2KWJ A;  1WES A;  2BAY A;  3LQJ A;  4ZUX U;  5LKX A;  4WZ2 A;  2KR4 A;  2JRJ A;  2ECJ A;  5B77 A;  3U5P A;  2QIC A;  2KGG A;  5TRB A;  2RI7 A;  3U5N A;  1WEP A;  2L80 A;  2KWN A;  2VPG A;  3FL2 A;  4BBQ A;  4GNG A;  2M6M A;  2KRE A;  4LKA A;  4GND A;  2RSD A;  4B86 C;  4W4U A;  1Z6U A;  3N9L A;  2LXP C;  4I7D A;  2OXQ C;  3KV6 A; 
#chains in the Genus database with same CATH topology
 2JM3 A;  1XWH A;  1BOR A;  3SOU A;  4QQ4 A;  1V87 A;  3PHD A;  3O7A A;  4WA6 A;  2VNF A;  2CON A;  4AP4 A;  4UI9 B;  3M99 A;  4YAT A;  4S3O B;  4YC9 A;  4P5O B;  2QIZ A;  4I7C A;  4LJN A;  2EOD A;  1WEW A;  3DPL R;  1N87 A;  2FUI A;  4Q6F A;  3EB6 A;  5LKU A;  4L7X A;  4QF3 A;  2P57 A;  2G6Q A;  5KH3 A;  2MA5 A;  2UZG A;  4AYC B;  2FFW A;  3SOX A;  2YQM A;  2YUR A;  4PTB A;  2G45 A;  3DWD A;  2XEU A;  4V3L C;  4I7B A;  2H0D B;  2E61 A;  1IYM A;  2L0B A;  2HDP A;  5DIN A;  5I3L A;  1FBV A;  5K3Q A;  2KE1 A;  2KKY A;  3NG2 A;  2YUC A;  2YHO A;  4ZQL A;  2MKE A;  2L7P A;  3MDB C;  5G04 B;  3T6R A;  1G25 A;  1X4J A;  4N4F A;  2DSM A;  1LDJ B;  2YSJ A;  3N9P A;  4YAB A;  4YAD A;  5LKT A;  2C2L A;  5EYA F;  2M1R A;  3JUE A;  3HCT A;  2LGG A;  2PUY A;  4F52 B;  2YSM A;  2MUM A;  1VYX A;  2L5U A;  2CT2 A;  2EGP A;  4OGC A;  5TDW A;  3SUB A;  2VJE B;  1DVP A;  2YU4 A;  2EGM A;  2MD8 C;  2PNX A;  1WEV A;  3KV5 A;  4L58 A;  2CSV A;  5DKA A;  5SVI B;  2MT5 A;  2G43 A;  1E4U A;  1VFY A;  5AIU A;  2ECI A;  3VK6 A;  4MVT A;  5FER A;  3Q1D A;  2ECT A;  3U5M A;  2Y1N A;  4AYC A;  1WGM A;  3HTK C;  1WEU A;  2F6N A;  3V43 A;  4CA1 A;  2MA6 A;  3C5K A;  5TAB A;  4WZ3 B;  4A4C A;  2H0D A;  2IDA A;  1Z60 A;  5B8D A;  5FB0 A;  2OWA A;  3FAO A;  3ASL A;  4FIP A;  2CKL B;  3C6W A;  3ZTG A;  1WEE A;  3PUR A;  5B76 A;  4AUQ B;  1RMD A;  4XI1 A;  1X4I A;  1MM3 A;  3LQH A;  3LQI A;  4GNE A;  2XB1 A;  2D8U A;  4NN2 A;  2FUU A;  4YBM A;  3DDT A;  4UP0 A;  2LXH C;  4A0C D;  4WZ0 A;  2E6R A;  2LQ6 A;  3FM8 C;  2LAU A;  2VP7 A;  5JG6 A;  2F6J A;  2L75 A;  2M3H A;  4C9Z A;  2ZET C;  3IHP A;  1LDK C;  2FD4 A;  2LGL A;  2VPE A;  2VJE A;  3T7L A;  4LLB A;  4GB0 A;  4FK5 A;  5B78 A;  1ZBD B;  1MM2 A;  2KGI A;  2VJF B;  3M62 A;  3MHH A;  2DJA A;  2KKX A;  5TBN A;  2ECV A;  3O70 A;  3T9K A;  2MNZ A;  2CRR A;  3DQV R;  4R8P K;  2LDR A;  2YT5 A;  4LAD B;  3LVQ E;  3ZVZ B;  4CCG X;  5H1T A;  4Z0R A;  5J3X A;  2Y1M A;  1JOC A;  1Z2Q A;  1X4U A;  2JUN A;  5AIT A;  3FJU B;  4O64 A;  3L11 A;  2LN0 A;  5FEY A;  5TDR A;  3RPG B;  3ZYQ A;  2K16 A;  4B7Y C;  3RPG C;  2DX8 A;  4YBT A;  3MHS A;  2K1J A;  2QJ0 A;  3L1X A;  4OGE A;  3ZNI A;  5B79 A;  5LKZ A;  2LGK A;  2VPD A;  5H1V A;  5H1U A;  2KWO A;  1JM7 B;  3FAN A;  1T1H A;  2E6S A;  4R7E A;  3FEH A;  3O33 A;  4LK9 A;  1FP0 A;  2I50 A;  4TKP B;  4UP5 A;  3HCU A;  3GL6 A;  3O36 A;  2F42 A;  3SOW A;  3L1Z B;  2VPB A;  4H9D A;  4O62 A;  2K17 A;  1WIM A;  2VJF A;  4AVX A;  2C2V S;  2LRI C;  5B75 A;  3KDE C;  5SVY A;  3SHB A;  2XOC A;  4F1P A;  5D1L B;  4BHW A;  3N9Q A;  3N9O A;  5G0F A;  5KH9 A;  5C11 A;  3KQI A;  4FO9 A;  2YHN A;  1WEM A;  1WE9 A;  2XOZ A;  1HYJ A;  4N3W A;  5H9M A;  1JM7 A;  3LRQ A;  3HCS A;  3PLW A;  2M85 A;  1HYI A;  3O34 A;  3KNV A;  4QF2 A;  1CHC A;  3EB5 A;  5C13 A;  2CKL A;  2EA6 A;  5SVX A;  5D1M B;  2FSA A;  2KU3 A;  3U5O A;  2D8S A;  3ZVY A;  4X3G A;  4V3K C;  1K2F A;  4GNF A;  2MNY A;  4IC2 A;  3M7K A;  3LDY A;  2LGV A;  2YVR A;  4S3O C;  4ZDT A;  2CSZ A;  2KIZ A;  1WFK A;  2JMI A;  5FB1 A;  2AN6 A;  3RTR B;  3PUQ A;  5SVI A;  3E2D A;  5LCW B;  5KH7 A;  1WEQ A;  3N9N A;  2XOY A;  4A4B A;  3LVR E;  3O47 A;  1VD4 A;  1WIL A;  2JMD A;  4Z0O A;  4YBS A;  1WEN A;  2YRE A;  1F62 A;  2NAA A;  4MSX A;  3QZV A;  2MD7 B;  3H7H A;  3GV4 A;  2K4D A;  2ECG A;  4YAX A;  5D1K B;  3M63 A;  1U6G B;  4FJC A;  2ECW A;  3N9M A;  4PPE A;  2Y43 A;  5G05 B;  4IC3 A;  1MBM A;  1WEO A;  2KWK A;  2M13 A;  2ECN A;  3ZPV E;  2YW8 A;  3LJU X;  4A49 A;  2CSY A;  2CRW A;  1DCQ A;  3I2D A;  2KFT A;  2YYR A;  2RR4 A;  2HYE D;  2JMJ A;  3O37 A;  2YQL A;  2L43 A;  4R2Y A;  3O35 A;  2KYU A;  2XP0 A;  2LV9 A;  3ZPV 1;  2MIQ A;  2KWJ A;  1WES A;  2BAY A;  3LQJ A;  2B0O E;  4ZUX U;  5LKX A;  4WZ2 A;  2KR4 A;  2JRJ A;  2ECJ A;  5B77 A;  3U5P A;  2QIC A;  2KGG A;  5TRB A;  2RI7 A;  3U5N A;  1WEP A;  2L80 A;  2KWN A;  2VPG A;  3FL2 A;  4BBQ A;  4GNG A;  2M6M A;  2KRE A;  4LKA A;  4GND A;  2RSD A;  4B86 C;  2EXU A;  2IQJ A;  4W4U A;  1Z6U A;  3N9L A;  2LXP C;  4I7D A;  2OXQ C;  3KV6 A; 
#chains in the Genus database with same CATH homology
 1XWH A;  1BOR A;  3SOU A;  1V87 A;  3PHD A;  3O7A A;  4WA6 A;  2VNF A;  4AP4 A;  4UI9 B;  3M99 A;  4YAT A;  4S3O B;  4YC9 A;  4P5O B;  2QIZ A;  4I7C A;  4LJN A;  2EOD A;  1WEW A;  3DPL R;  1N87 A;  2FUI A;  4Q6F A;  3EB6 A;  5LKU A;  4L7X A;  4QF3 A;  2G6Q A;  5KH3 A;  2MA5 A;  2UZG A;  4AYC B;  3SOX A;  2YQM A;  2YUR A;  4PTB A;  2G45 A;  2XEU A;  4V3L C;  4I7B A;  2H0D B;  1IYM A;  2L0B A;  2HDP A;  5DIN A;  5I3L A;  1FBV A;  2KE1 A;  3NG2 A;  2YUC A;  2YHO A;  4ZQL A;  5G04 B;  3T6R A;  1G25 A;  1X4J A;  4N4F A;  1LDJ B;  2YSJ A;  3N9P A;  4YAB A;  4YAD A;  5LKT A;  2C2L A;  5EYA F;  2M1R A;  3HCT A;  2LGG A;  2PUY A;  4F52 B;  2YSM A;  2MUM A;  1VYX A;  2L5U A;  2CT2 A;  2EGP A;  5TDW A;  2VJE B;  1DVP A;  2YU4 A;  2MD8 C;  2PNX A;  1WEV A;  3KV5 A;  4L58 A;  5DKA A;  2MT5 A;  2G43 A;  1E4U A;  1VFY A;  5AIU A;  2ECI A;  3VK6 A;  4MVT A;  5FER A;  2ECT A;  3U5M A;  2Y1N A;  4AYC A;  1WGM A;  3HTK C;  1WEU A;  2F6N A;  3V43 A;  4CA1 A;  2MA6 A;  3C5K A;  5TAB A;  4WZ3 B;  4A4C A;  2H0D A;  2IDA A;  1Z60 A;  5B8D A;  5FB0 A;  3ASL A;  4FIP A;  2CKL B;  3C6W A;  3ZTG A;  1WEE A;  3PUR A;  5B76 A;  4AUQ B;  1RMD A;  4XI1 A;  1X4I A;  1MM3 A;  3LQH A;  3LQI A;  4GNE A;  2XB1 A;  4NN2 A;  2FUU A;  4YBM A;  4UP0 A;  2LXH C;  4A0C D;  4WZ0 A;  2E6R A;  2LQ6 A;  2VP7 A;  5JG6 A;  2F6J A;  2L75 A;  2M3H A;  4C9Z A;  2ZET C;  3IHP A;  1LDK C;  2LGL A;  2VPE A;  2VJE A;  3T7L A;  4LLB A;  4GB0 A;  4FK5 A;  5B78 A;  1ZBD B;  1MM2 A;  2KGI A;  2VJF B;  3M62 A;  3MHH A;  5TBN A;  2ECV A;  3O70 A;  2MNZ A;  3DQV R;  4R8P K;  2LDR A;  2YT5 A;  4LAD B;  3ZVZ B;  4CCG X;  5H1T A;  5J3X A;  2Y1M A;  1JOC A;  1Z2Q A;  1X4U A;  5AIT A;  4O64 A;  3L11 A;  2LN0 A;  5FEY A;  5TDR A;  3RPG B;  3ZYQ A;  2K16 A;  4B7Y C;  3RPG C;  2DX8 A;  4YBT A;  3MHS A;  2K1J A;  2QJ0 A;  3L1X A;  3ZNI A;  5B79 A;  5LKZ A;  2LGK A;  2VPD A;  5H1V A;  5H1U A;  2KWO A;  1JM7 B;  1T1H A;  2E6S A;  4R7E A;  3O33 A;  4LK9 A;  1FP0 A;  2I50 A;  4TKP B;  4UP5 A;  3HCU A;  3GL6 A;  3O36 A;  2F42 A;  3SOW A;  3L1Z B;  2VPB A;  2K17 A;  1WIM A;  2VJF A;  4AVX A;  2C2V S;  2LRI C;  5B75 A;  3SHB A;  5D1L B;  4BHW A;  3N9Q A;  3N9O A;  5G0F A;  5KH9 A;  5C11 A;  3KQI A;  4FO9 A;  2YHN A;  1WEM A;  1WE9 A;  1HYJ A;  5H9M A;  4N3W A;  1JM7 A;  3LRQ A;  3HCS A;  2M85 A;  1HYI A;  3O34 A;  3KNV A;  4QF2 A;  1CHC A;  3EB5 A;  5C13 A;  2CKL A;  2EA6 A;  5D1M B;  2FSA A;  2KU3 A;  3U5O A;  2D8S A;  3ZVY A;  4X3G A;  4V3K C;  1K2F A;  4GNF A;  2MNY A;  4IC2 A;  2LGV A;  4S3O C;  4ZDT A;  2CSZ A;  2KIZ A;  1WFK A;  2JMI A;  5FB1 A;  2AN6 A;  3RTR B;  3PUQ A;  5LCW B;  5KH7 A;  1WEQ A;  3N9N A;  4A4B A;  1VD4 A;  1WIL A;  2JMD A;  4YBS A;  1WEN A;  2YRE A;  1F62 A;  2NAA A;  4MSX A;  3QZV A;  2MD7 B;  3GV4 A;  2K4D A;  2ECG A;  4YAX A;  5D1K B;  3M63 A;  1U6G B;  4FJC A;  2ECW A;  3N9M A;  4PPE A;  2Y43 A;  5G05 B;  4IC3 A;  1WEO A;  2KWK A;  2ECN A;  3ZPV E;  2YW8 A;  4A49 A;  2CSY A;  3I2D A;  2KFT A;  2YYR A;  2HYE D;  2JMJ A;  3O37 A;  2YQL A;  2L43 A;  4R2Y A;  3O35 A;  2KYU A;  2LV9 A;  3ZPV 1;  2MIQ A;  2KWJ A;  1WES A;  2BAY A;  3LQJ A;  4ZUX U;  5LKX A;  4WZ2 A;  2KR4 A;  2JRJ A;  2ECJ A;  5B77 A;  3U5P A;  2QIC A;  2KGG A;  5TRB A;  2RI7 A;  3U5N A;  1WEP A;  2L80 A;  2KWN A;  2VPG A;  3FL2 A;  4BBQ A;  4GNG A;  2M6M A;  2KRE A;  4LKA A;  4GND A;  2RSD A;  4B86 C;  4W4U A;  1Z6U A;  3N9L A;  2LXP C;  4I7D A;  2OXQ C;  3KV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...