3L1ZB

Crystal structure of the u-box domain of human e4b ubiquitin ligase in complex with ubch5c e2 ubiquitin conjugating enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
b'IDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1zB01
2KGGA 2K16A 3MHSA 2F6NA 2CKLB 2I50A 2ECJA 2VPBA 3U5OA 1Z2QA 2ZETC 4GNGA 3N9QA 1LDJB 1V87A 3N9NA 4L7XA 4YAXA 1RMDA 4I7DA 4ZQLA 2YUCA 3U5NA 2LQ6A 4QF3A 2K17A 5FB1A 5H1VA 1WENA 3LQIA 3RPGB 2G45A 5D1KB 2L75A 4A0CD 2M6MA 1WE9A 4GNDA 2C2VS 4QF2A 3U5PA 2RSDA 4C9ZA 2JMJA 5B75A 2K4DA 2YHNA 2YQLA 4LADB 4BBQA 2KE1A 4UP5A 2VPGA 5H1UA 4PTBA 3O36A 2KR4A 2VJEB 2YT5A 3U5MA 2YHOA 4A4BA 5TDWA 2EODA 4AYCB 3T7LA 4L58A 5EYAF 2G6QA 5AIUA 5I3LA 4Q6FA 3HCTA 4PPEA 3N9LA 2ECWA 3GL6A 1X4IA 2QIZA 3FL2A 4YATA 2VJFB 5TABA 3O7AA 4BHWA 2DX8A 2FUUA 1WESA 2LXPC 5KH9A 5JG6A 4B7YC 5LCWB 1JM7B 2LGLA 2MT5A 2YQMA 2NAAA 3M99A 2ECTA 3PUQA 4R2YA 5G0FA 3C6WA 3PHDA 5LKUA 3M62A 3LRQA 3ZNIA 4UP0A 4B86C 4S3OC 2CSYA 3SHBA 1MM2A 5D1LB 2Y1MA 3L1ZB 1MM3A 2KIZA 3KV6A 4V3LC 4F52B 2LGKA 5G04B 2EA6A 5B77A 2OXQC 5LKXA 1Z6UA 4N4FA 2UZGA 2YREA 4ZDTA 2CSZA 4I7CA 3ZPV1 2LN0A 5H9MA 3T6RA 2KYUA 2Y1NA 2H0DB 1T1HA 2AN6A 4LKAA 2QJ0A 2VPEA 1WEPA 5FEYA 4A4CA 3ZPVE 3L1XA 5KH3A 4WZ0A 1WFKA 2IDAA 3N9PA 2VNFA 1LDKC 2MIQA 4R7EA 4FO9A 4UI9B 1X4JA 4AP4A 3M63A 1FBVA 2KFTA 2YW8A 4YBMA 4FIPA 2RI7A 4CCGX 1WEQA 5J3XA 2YYRA 4TKPB 3EB5A 2E6RA 1F62A 3RPGC 3I2DA 4GNEA 2M3HA 2C2LA 3KV5A 4NN2A 2CKLA 2KWOA 2LV9A 4A49A 3V43A 3ZVYA 4LK9A 5H1TA 3ZTGA 1VYXA 2K1JA 2XEUA 1K2FA 3QZVA 2KWNA 1WIMA 5TBNA 2KWJA 3VK6A 2PUYA 2FSAA 2KU3A 2MD8C 3EB6A 2E6SA 4FK5A 4YC9A 4LJNA 4YBTA 2PNXA 2MNYA 2F6JA 3SOUA 1WEEA 3C5KA 3LQJA 2QICA 3O70A 4I7BA 4YADA 3GV4A 1E4UA 2BAYA 3KQIA 3LQHA 2L43A 2JRJA 3O37A 3L11A 1X4UA 5G05B 2VJEA 4R8PK 2L0BA 3DQVR 2EGPA 4V3KC 2G43A 5B8DA 1CHCA 2XB1A 4AYCA 1WEVA 2ECVA 4W4UA 3HTKC 2HYED 4MVTA 1HYJA 2L5UA 2VJFA 1WEMA 2FUIA 1WEUA 3N9OA 5LKZA 5FB0A 4GNFA 2MA6A 2YURA 4N3WA 2MNZA 4XI1A 2JMDA 5AITA 1JM7A 1U6GB 4WZ2A 2YU4A 3PURA 5C13A 3DPLR 2ECIA 4CA1A 4ZUXU 5FERA 1JOCA 2MD7B 4WA6A 1WILA 1DVPA 2D8SA 2KGIA 4X3GA 1Z60A 3SOXA 4IC2A 3SOWA 5C11A 1WEOA 4YBSA 3O35A 5B79A 3KNVA 5TRBA 2JMIA 1VFYA 5TDRA 2F42A 3N9MA 5DKAA 5LKTA 2LDRA 2M1RA 1FP0A 1ZBDB 2H0DA 4P5OB 2VP7A 3HCSA 5D1MB 3IHPA 4AUQB 2CT2A 5KH7A 2MA5A 3ZYQA 2LGVA 2LGGA 3MHHA 2Y43A 3NG2A 2L80A 2ECGA 2YSJA 2LRIC 3O33A 4LLBA 3ASLA 1WGMA 1G25A 4YABA 1BORA 2ECNA 4O64A 2LXHC 1XWHA 5B76A 2KWKA 4IC3A 1N87A 2MUMA 4AVXA 4S3OB 5B78A 1WEWA 4MSXA 2VPDA 4GB0A 3RTRB 2M85A 5DINA 1VD4A 3ZVZB 1HYIA 3O34A 4FJCA 4WZ3B 2YSMA 2KREA 3HCUA 2HDPA 1IYMA
chains in the Genus database with same CATH superfamily
2IQJA 2KGGA 2K16A 3MHSA 2F6NA 2CKLB 2I50A 2ECJA 2VPBA 3U5OA 1Z2QA 2ZETC 4GNGA 2OWAA 3N9QA 1LDJB 1V87A 2LAUA 2YVRA 3N9NA 4L7XA 4YAXA 3FM8C 1RMDA 4I7DA 4ZQLA 2YUCA 3U5NA 2LQ6A 4QF3A 2K17A 5FB1A 5H1VA 2JM3A 1WENA 3LQIA 3RPGB 2G45A 2D8UA 5D1KB 2L75A 4A0CD 2M6MA 1WE9A 2JUNA 4GNDA 2C2VS 4QF2A 4QQ4A 3U5PA 2RSDA 4C9ZA 2JMJA 5B75A 2K4DA 2YHNA 2YQLA 4LADB 4BBQA 2KE1A 4UP5A 2VPGA 5H1UA 4PTBA 3O36A 2KR4A 2VJEB 2YT5A 3U5MA 2YHOA 4A4BA 3FAOA 5TDWA 2EODA 4AYCB 3T7LA 4L58A 5EYAF 4OGEA 2G6QA 5AIUA 5I3LA 2EXUA 4Q6FA 3HCTA 4PPEA 1DCQA 3N9LA 2ECWA 3GL6A 1X4IA 2QIZA 3FL2A 4YATA 2VJFB 4Z0RA 5TABA 3O7AA 5SVYA 4BHWA 2DX8A 2FUUA 1WESA 2LXPC 5KH9A 5JG6A 4B7YC 5LCWB 1JM7B 3DWDA 2LGLA 2MT5A 2YQMA 2NAAA 3M99A 2ECTA 3PUQA 4R2YA 5G0FA 3JUEA 3C6WA 3PHDA 5LKUA 3M62A 3LRQA 3ZNIA 4UP0A 4B86C 3PLWA 4S3OC 2CSYA 2L7PA 3SHBA 1MM2A 5D1LB 2Y1MA 3L1ZB 1MM3A 2KIZA 3FEHA 2E61A 3KV6A 4V3LC 4F52B 2LGKA 5G04B 2EA6A 5B77A 2OXQC 5LKXA 3KDEC 1Z6UA 4N4FA 2UZGA 2FD4A 2YREA 4ZDTA 2CSZA 2XOZA 3O47A 4I7CA 3ZPV1 2LN0A 5H9MA 3T6RA 2KYUA 5K3QA 2Y1NA 3FJUB 2H0DB 1T1HA 2AN6A 4LKAA 2QJ0A 2VPEA 1WEPA 5FEYA 4A4CA 3ZPVE 3L1XA 5KH3A 4WZ0A 1WFKA 2IDAA 3N9PA 2VNFA 1LDKC 2MIQA 4R7EA 4FO9A 4UI9B 1X4JA 4AP4A 3M63A 1FBVA 2KFTA 2YW8A 4YBMA 4FIPA 2M13A 2RI7A 4CCGX 1WEQA 5J3XA 2YYRA 4TKPB 3EB5A 2E6RA 1F62A 3RPGC 3I2DA 3LDYA 4GNEA 2M3HA 2C2LA 3KV5A 4NN2A 2CKLA 2KWOA 2LV9A 2XOCA 2CSVA 3LJUX 4A49A 3V43A 3ZVYA 4LK9A 3FANA 5H1TA 3ZTGA 1VYXA 2K1JA 2XEUA 1K2FA 3QZVA 2KWNA 1WIMA 2KKXA 4Z0OA 5SVIB 5TBNA 2KWJA 2DSMA 3VK6A 2PUYA 2FSAA 2KU3A 2MD8C 3EB6A 2E6SA 4FK5A 4H9DA 4YC9A 4LJNA 4YBTA 3LVQE 2PNXA 2RR4A 2MNYA 4OGCA 2F6JA 3SOUA 1WEEA 3C5KA 3LQJA 2QICA 3O70A 4I7BA 4YADA 3GV4A 1E4UA 2BAYA 3KQIA 3LQHA 2L43A 2JRJA 3O37A 3L11A 1X4UA 5G05B 2VJEA 4R8PK 2L0BA 3DQVR 2EGPA 4V3KC 2G43A 5B8DA 1CHCA 2XB1A 3T9KA 4AYCA 1WEVA 2CRRA 2ECVA 3MDBC 4W4UA 3HTKC 2HYED 4MVTA 1HYJA 3M7KA 2L5UA 2VJFA 1WEMA 4F1PA 2DJAA 2FUIA 1WEUA 3N9OA 5LKZA 5FB0A 4GNFA 5SVIA 2MA6A 2YURA 4N3WA 2B0OE 2MNZA 4XI1A 2JMDA 5AITA 1JM7A 1U6GB 4WZ2A 2YU4A 3PURA 2XP0A 5C13A 3DPLR 1MBMA 2ECIA 4CA1A 2FFWA 3E2DA 4ZUXU 5FERA 1JOCA 2MD7B 4WA6A 1WILA 1DVPA 2D8SA 2KGIA 3H7HA 4X3GA 1Z60A 3SOXA 4IC2A 3SOWA 5C11A 1WEOA 4YBSA 3O35A 5B79A 3KNVA 5TRBA 2MKEA 2JMIA 2CONA 1VFYA 5TDRA 2F42A 3N9MA 3SUBA 5DKAA 5LKTA 2LDRA 2M1RA 1FP0A 1ZBDB 2EGMA 2H0DA 4P5OB 2VP7A 3HCSA 5D1MB 3IHPA 4AUQB 2CT2A 5KH7A 2MA5A 2P57A 3ZYQA 2LGVA 2LGGA 3MHHA 2Y43A 3NG2A 2L80A 2ECGA 2YSJA 2LRIC 3O33A 4LLBA 3ASLA 1WGMA 3Q1DA 1G25A 4YABA 1BORA 2ECNA 4O64A 2LXHC 1XWHA 5B76A 2KWKA 4IC3A 1N87A 3DDTA 2MUMA 4AVXA 4S3OB 2KKYA 4O62A 5B78A 1WEWA 4MSXA 2VPDA 4GB0A 3RTRB 2M85A 5DINA 1VD4A 3ZVZB 1HYIA 5SVXA 3O34A 3LVRE 4FJCA 4WZ3B 2YSMA 2KREA 3HCUA 2CRWA 2HDPA 1IYMA 2XOYA
chains in the Genus database with same CATH topology
2KGGA 2K16A 3MHSA 2F6NA 2CKLB 2I50A 2ECJA 2VPBA 3U5OA 1Z2QA 2ZETC 4GNGA 3N9QA 1LDJB 1V87A 3N9NA 4L7XA 4YAXA 1RMDA 4I7DA 4ZQLA 2YUCA 3U5NA 2LQ6A 4QF3A 2K17A 5FB1A 5H1VA 1WENA 3LQIA 3RPGB 2G45A 5D1KB 2L75A 4A0CD 2M6MA 1WE9A 4GNDA 2C2VS 4QF2A 3U5PA 2RSDA 4C9ZA 2JMJA 5B75A 2K4DA 2YHNA 2YQLA 4LADB 4BBQA 2KE1A 4UP5A 2VPGA 5H1UA 4PTBA 3O36A 2KR4A 2VJEB 2YT5A 3U5MA 2YHOA 4A4BA 5TDWA 2EODA 4AYCB 3T7LA 4L58A 5EYAF 2G6QA 5AIUA 5I3LA 4Q6FA 3HCTA 4PPEA 3N9LA 2ECWA 3GL6A 1X4IA 2QIZA 3FL2A 4YATA 2VJFB 5TABA 3O7AA 4BHWA 2DX8A 2FUUA 1WESA 2LXPC 5KH9A 5JG6A 4B7YC 5LCWB 1JM7B 2LGLA 2MT5A 2YQMA 2NAAA 3M99A 2ECTA 3PUQA 4R2YA 5G0FA 3C6WA 3PHDA 5LKUA 3M62A 3LRQA 3ZNIA 4UP0A 4B86C 4S3OC 2CSYA 3SHBA 1MM2A 5D1LB 2Y1MA 3L1ZB 1MM3A 2KIZA 3KV6A 4V3LC 4F52B 2LGKA 5G04B 2EA6A 5B77A 2OXQC 5LKXA 1Z6UA 4N4FA 2UZGA 2YREA 4ZDTA 2CSZA 4I7CA 3ZPV1 2LN0A 5H9MA 3T6RA 2KYUA 2Y1NA 2H0DB 1T1HA 2AN6A 4LKAA 2QJ0A 2VPEA 1WEPA 5FEYA 4A4CA 3ZPVE 3L1XA 5KH3A 4WZ0A 1WFKA 2IDAA 3N9PA 2VNFA 1LDKC 2MIQA 4R7EA 4FO9A 4UI9B 1X4JA 4AP4A 3M63A 1FBVA 2KFTA 2YW8A 4YBMA 4FIPA 2RI7A 4CCGX 1WEQA 5J3XA 2YYRA 4TKPB 3EB5A 2E6RA 1F62A 3RPGC 3I2DA 4GNEA 2M3HA 2C2LA 3KV5A 4NN2A 2CKLA 2KWOA 2LV9A 4A49A 3V43A 3ZVYA 4LK9A 5H1TA 3ZTGA 1VYXA 2K1JA 2XEUA 1K2FA 3QZVA 2KWNA 1WIMA 5TBNA 2KWJA 3VK6A 2PUYA 2FSAA 2KU3A 2MD8C 3EB6A 2E6SA 4FK5A 4YC9A 4LJNA 4YBTA 2PNXA 2MNYA 2F6JA 3SOUA 1WEEA 3C5KA 3LQJA 2QICA 3O70A 4I7BA 4YADA 3GV4A 1E4UA 2BAYA 3KQIA 3LQHA 2L43A 2JRJA 3O37A 3L11A 1X4UA 5G05B 2VJEA 4R8PK 2L0BA 3DQVR 2EGPA 4V3KC 2G43A 5B8DA 1CHCA 2XB1A 4AYCA 1WEVA 2ECVA 4W4UA 3HTKC 2HYED 4MVTA 1HYJA 2L5UA 2VJFA 1WEMA 2FUIA 1WEUA 3N9OA 5LKZA 5FB0A 4GNFA 2MA6A 2YURA 4N3WA 2MNZA 4XI1A 2JMDA 5AITA 1JM7A 1U6GB 4WZ2A 2YU4A 3PURA 5C13A 3DPLR 2ECIA 4CA1A 4ZUXU 5FERA 1JOCA 2MD7B 4WA6A 1WILA 1DVPA 2D8SA 2KGIA 4X3GA 1Z60A 3SOXA 4IC2A 3SOWA 5C11A 1WEOA 4YBSA 3O35A 5B79A 3KNVA 5TRBA 2JMIA 1VFYA 5TDRA 2F42A 3N9MA 5DKAA 5LKTA 2LDRA 2M1RA 1FP0A 1ZBDB 2H0DA 4P5OB 2VP7A 3HCSA 5D1MB 3IHPA 4AUQB 2CT2A 5KH7A 2MA5A 3ZYQA 2LGVA 2LGGA 3MHHA 2Y43A 3NG2A 2L80A 2ECGA 2YSJA 2LRIC 3O33A 4LLBA 3ASLA 1WGMA 1G25A 4YABA 1BORA 2ECNA 4O64A 2LXHC 1XWHA 5B76A 2KWKA 4IC3A 1N87A 2MUMA 4AVXA 4S3OB 5B78A 1WEWA 4MSXA 2VPDA 4GB0A 3RTRB 2M85A 5DINA 1VD4A 3ZVZB 1HYIA 3O34A 4FJCA 4WZ3B 2YSMA 2KREA 3HCUA 2HDPA 1IYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGG A;  2K16 A;  3MHS A;  2F6N A;  2CKL B;  2I50 A;  2ECJ A;  2VPB A;  3U5O A;  1Z2Q A;  2ZET C;  4GNG A;  3N9Q A;  1LDJ B;  1V87 A;  3N9N A;  4L7X A;  4YAX A;  1RMD A;  4I7D A;  4ZQL A;  2YUC A;  3U5N A;  2LQ6 A;  4QF3 A;  2K17 A;  5FB1 A;  5H1V A;  1WEN A;  3LQI A;  3RPG B;  2G45 A;  5D1K B;  2L75 A;  4A0C D;  2M6M A;  1WE9 A;  4GND A;  2C2V S;  4QF2 A;  3U5P A;  2RSD A;  4C9Z A;  2JMJ A;  5B75 A;  2K4D A;  2YHN A;  2YQL A;  4LAD B;  4BBQ A;  2KE1 A;  4UP5 A;  2VPG A;  5H1U A;  4PTB A;  3O36 A;  2KR4 A;  2VJE B;  2YT5 A;  3U5M A;  2YHO A;  4A4B A;  5TDW A;  2EOD A;  4AYC B;  3T7L A;  4L58 A;  5EYA F;  2G6Q A;  5AIU A;  5I3L A;  4Q6F A;  3HCT A;  4PPE A;  3N9L A;  2ECW A;  3GL6 A;  1X4I A;  2QIZ A;  3FL2 A;  4YAT A;  2VJF B;  5TAB A;  3O7A A;  4BHW A;  2DX8 A;  2FUU A;  1WES A;  2LXP C;  5KH9 A;  5JG6 A;  4B7Y C;  5LCW B;  1JM7 B;  2LGL A;  2MT5 A;  2YQM A;  2NAA A;  3M99 A;  2ECT A;  3PUQ A;  4R2Y A;  5G0F A;  3C6W A;  3PHD A;  5LKU A;  3M62 A;  3LRQ A;  3ZNI A;  4UP0 A;  4B86 C;  4S3O C;  2CSY A;  3SHB A;  1MM2 A;  5D1L B;  2Y1M A;  3L1Z B;  1MM3 A;  2KIZ A;  3KV6 A;  4V3L C;  4F52 B;  2LGK A;  5G04 B;  2EA6 A;  5B77 A;  2OXQ C;  5LKX A;  1Z6U A;  4N4F A;  2UZG A;  2YRE A;  4ZDT A;  2CSZ A;  4I7C A;  3ZPV 1;  2LN0 A;  5H9M A;  3T6R A;  2KYU A;  2Y1N A;  2H0D B;  1T1H A;  2AN6 A;  4LKA A;  2QJ0 A;  2VPE A;  1WEP A;  5FEY A;  4A4C A;  3ZPV E;  3L1X A;  5KH3 A;  4WZ0 A;  1WFK A;  2IDA A;  3N9P A;  2VNF A;  1LDK C;  2MIQ A;  4R7E A;  4FO9 A;  4UI9 B;  1X4J A;  4AP4 A;  3M63 A;  1FBV A;  2KFT A;  2YW8 A;  4YBM A;  4FIP A;  2RI7 A;  4CCG X;  1WEQ A;  5J3X A;  2YYR A;  4TKP B;  3EB5 A;  2E6R A;  1F62 A;  3RPG C;  3I2D A;  4GNE A;  2M3H A;  2C2L A;  3KV5 A;  4NN2 A;  2CKL A;  2KWO A;  2LV9 A;  4A49 A;  3V43 A;  3ZVY A;  4LK9 A;  5H1T A;  3ZTG A;  1VYX A;  2K1J A;  2XEU A;  1K2F A;  3QZV A;  2KWN A;  1WIM A;  5TBN A;  2KWJ A;  3VK6 A;  2PUY A;  2FSA A;  2KU3 A;  2MD8 C;  3EB6 A;  2E6S A;  4FK5 A;  4YC9 A;  4LJN A;  4YBT A;  2PNX A;  2MNY A;  2F6J A;  3SOU A;  1WEE A;  3C5K A;  3LQJ A;  2QIC A;  3O70 A;  4I7B A;  4YAD A;  3GV4 A;  1E4U A;  2BAY A;  3KQI A;  3LQH A;  2L43 A;  2JRJ A;  3O37 A;  3L11 A;  1X4U A;  5G05 B;  2VJE A;  4R8P K;  2L0B A;  3DQV R;  2EGP A;  4V3K C;  2G43 A;  5B8D A;  1CHC A;  2XB1 A;  4AYC A;  1WEV A;  2ECV A;  4W4U A;  3HTK C;  2HYE D;  4MVT A;  1HYJ A;  2L5U A;  2VJF A;  1WEM A;  2FUI A;  1WEU A;  3N9O A;  5LKZ A;  5FB0 A;  4GNF A;  2MA6 A;  2YUR A;  4N3W A;  2MNZ A;  4XI1 A;  2JMD A;  5AIT A;  1JM7 A;  1U6G B;  4WZ2 A;  2YU4 A;  3PUR A;  5C13 A;  3DPL R;  2ECI A;  4CA1 A;  4ZUX U;  5FER A;  1JOC A;  2MD7 B;  4WA6 A;  1WIL A;  1DVP A;  2D8S A;  2KGI A;  4X3G A;  1Z60 A;  3SOX A;  4IC2 A;  3SOW A;  5C11 A;  1WEO A;  4YBS A;  3O35 A;  5B79 A;  3KNV A;  5TRB A;  2JMI A;  1VFY A;  5TDR A;  2F42 A;  3N9M A;  5DKA A;  5LKT A;  2LDR A;  2M1R A;  1FP0 A;  1ZBD B;  2H0D A;  4P5O B;  2VP7 A;  3HCS A;  5D1M B;  3IHP A;  4AUQ B;  2CT2 A;  5KH7 A;  2MA5 A;  3ZYQ A;  2LGV A;  2LGG A;  3MHH A;  2Y43 A;  3NG2 A;  2L80 A;  2ECG A;  2YSJ A;  2LRI C;  3O33 A;  4LLB A;  3ASL A;  1WGM A;  1G25 A;  4YAB A;  1BOR A;  2ECN A;  4O64 A;  2LXH C;  1XWH A;  5B76 A;  2KWK A;  4IC3 A;  1N87 A;  2MUM A;  4AVX A;  4S3O B;  5B78 A;  1WEW A;  4MSX A;  2VPD A;  4GB0 A;  3RTR B;  2M85 A;  5DIN A;  1VD4 A;  3ZVZ B;  1HYI A;  3O34 A;  4FJC A;  4WZ3 B;  2YSM A;  2KRE A;  3HCU A;  2HDP A;  1IYM A; 
#chains in the Genus database with same CATH topology
 2IQJ A;  2KGG A;  2K16 A;  3MHS A;  2F6N A;  2CKL B;  2I50 A;  2ECJ A;  2VPB A;  3U5O A;  1Z2Q A;  2ZET C;  4GNG A;  2OWA A;  3N9Q A;  1LDJ B;  1V87 A;  2LAU A;  2YVR A;  3N9N A;  4L7X A;  4YAX A;  3FM8 C;  1RMD A;  4I7D A;  4ZQL A;  2YUC A;  3U5N A;  2LQ6 A;  4QF3 A;  2K17 A;  5FB1 A;  5H1V A;  2JM3 A;  1WEN A;  3LQI A;  3RPG B;  2G45 A;  2D8U A;  5D1K B;  2L75 A;  4A0C D;  2M6M A;  1WE9 A;  2JUN A;  4GND A;  2C2V S;  4QF2 A;  4QQ4 A;  3U5P A;  2RSD A;  4C9Z A;  2JMJ A;  5B75 A;  2K4D A;  2YHN A;  2YQL A;  4LAD B;  4BBQ A;  2KE1 A;  4UP5 A;  2VPG A;  5H1U A;  4PTB A;  3O36 A;  2KR4 A;  2VJE B;  2YT5 A;  3U5M A;  2YHO A;  4A4B A;  3FAO A;  5TDW A;  2EOD A;  4AYC B;  3T7L A;  4L58 A;  5EYA F;  4OGE A;  2G6Q A;  5AIU A;  5I3L A;  2EXU A;  4Q6F A;  3HCT A;  4PPE A;  1DCQ A;  3N9L A;  2ECW A;  3GL6 A;  1X4I A;  2QIZ A;  3FL2 A;  4YAT A;  2VJF B;  4Z0R A;  5TAB A;  3O7A A;  5SVY A;  4BHW A;  2DX8 A;  2FUU A;  1WES A;  2LXP C;  5KH9 A;  5JG6 A;  4B7Y C;  5LCW B;  1JM7 B;  3DWD A;  2LGL A;  2MT5 A;  2YQM A;  2NAA A;  3M99 A;  2ECT A;  3PUQ A;  4R2Y A;  5G0F A;  3JUE A;  3C6W A;  3PHD A;  5LKU A;  3M62 A;  3LRQ A;  3ZNI A;  4UP0 A;  4B86 C;  3PLW A;  4S3O C;  2CSY A;  2L7P A;  3SHB A;  1MM2 A;  5D1L B;  2Y1M A;  3L1Z B;  1MM3 A;  2KIZ A;  3FEH A;  2E61 A;  3KV6 A;  4V3L C;  4F52 B;  2LGK A;  5G04 B;  2EA6 A;  5B77 A;  2OXQ C;  5LKX A;  3KDE C;  1Z6U A;  4N4F A;  2UZG A;  2FD4 A;  2YRE A;  4ZDT A;  2CSZ A;  2XOZ A;  3O47 A;  4I7C A;  3ZPV 1;  2LN0 A;  5H9M A;  3T6R A;  2KYU A;  5K3Q A;  2Y1N A;  3FJU B;  2H0D B;  1T1H A;  2AN6 A;  4LKA A;  2QJ0 A;  2VPE A;  1WEP A;  5FEY A;  4A4C A;  3ZPV E;  3L1X A;  5KH3 A;  4WZ0 A;  1WFK A;  2IDA A;  3N9P A;  2VNF A;  1LDK C;  2MIQ A;  4R7E A;  4FO9 A;  4UI9 B;  1X4J A;  4AP4 A;  3M63 A;  1FBV A;  2KFT A;  2YW8 A;  4YBM A;  4FIP A;  2M13 A;  2RI7 A;  4CCG X;  1WEQ A;  5J3X A;  2YYR A;  4TKP B;  3EB5 A;  2E6R A;  1F62 A;  3RPG C;  3I2D A;  3LDY A;  4GNE A;  2M3H A;  2C2L A;  3KV5 A;  4NN2 A;  2CKL A;  2KWO A;  2LV9 A;  2XOC A;  2CSV A;  3LJU X;  4A49 A;  3V43 A;  3ZVY A;  4LK9 A;  3FAN A;  5H1T A;  3ZTG A;  1VYX A;  2K1J A;  2XEU A;  1K2F A;  3QZV A;  2KWN A;  1WIM A;  2KKX A;  4Z0O A;  5SVI B;  5TBN A;  2KWJ A;  2DSM A;  3VK6 A;  2PUY A;  2FSA A;  2KU3 A;  2MD8 C;  3EB6 A;  2E6S A;  4FK5 A;  4H9D A;  4YC9 A;  4LJN A;  4YBT A;  3LVQ E;  2PNX A;  2RR4 A;  2MNY A;  4OGC A;  2F6J A;  3SOU A;  1WEE A;  3C5K A;  3LQJ A;  2QIC A;  3O70 A;  4I7B A;  4YAD A;  3GV4 A;  1E4U A;  2BAY A;  3KQI A;  3LQH A;  2L43 A;  2JRJ A;  3O37 A;  3L11 A;  1X4U A;  5G05 B;  2VJE A;  4R8P K;  2L0B A;  3DQV R;  2EGP A;  4V3K C;  2G43 A;  5B8D A;  1CHC A;  2XB1 A;  3T9K A;  4AYC A;  1WEV A;  2CRR A;  2ECV A;  3MDB C;  4W4U A;  3HTK C;  2HYE D;  4MVT A;  1HYJ A;  3M7K A;  2L5U A;  2VJF A;  1WEM A;  4F1P A;  2DJA A;  2FUI A;  1WEU A;  3N9O A;  5LKZ A;  5FB0 A;  4GNF A;  5SVI A;  2MA6 A;  2YUR A;  4N3W A;  2B0O E;  2MNZ A;  4XI1 A;  2JMD A;  5AIT A;  1JM7 A;  1U6G B;  4WZ2 A;  2YU4 A;  3PUR A;  2XP0 A;  5C13 A;  3DPL R;  1MBM A;  2ECI A;  4CA1 A;  2FFW A;  3E2D A;  4ZUX U;  5FER A;  1JOC A;  2MD7 B;  4WA6 A;  1WIL A;  1DVP A;  2D8S A;  2KGI A;  3H7H A;  4X3G A;  1Z60 A;  3SOX A;  4IC2 A;  3SOW A;  5C11 A;  1WEO A;  4YBS A;  3O35 A;  5B79 A;  3KNV A;  5TRB A;  2MKE A;  2JMI A;  2CON A;  1VFY A;  5TDR A;  2F42 A;  3N9M A;  3SUB A;  5DKA A;  5LKT A;  2LDR A;  2M1R A;  1FP0 A;  1ZBD B;  2EGM A;  2H0D A;  4P5O B;  2VP7 A;  3HCS A;  5D1M B;  3IHP A;  4AUQ B;  2CT2 A;  5KH7 A;  2MA5 A;  2P57 A;  3ZYQ A;  2LGV A;  2LGG A;  3MHH A;  2Y43 A;  3NG2 A;  2L80 A;  2ECG A;  2YSJ A;  2LRI C;  3O33 A;  4LLB A;  3ASL A;  1WGM A;  3Q1D A;  1G25 A;  4YAB A;  1BOR A;  2ECN A;  4O64 A;  2LXH C;  1XWH A;  5B76 A;  2KWK A;  4IC3 A;  1N87 A;  3DDT A;  2MUM A;  4AVX A;  4S3O B;  2KKY A;  4O62 A;  5B78 A;  1WEW A;  4MSX A;  2VPD A;  4GB0 A;  3RTR B;  2M85 A;  5DIN A;  1VD4 A;  3ZVZ B;  1HYI A;  5SVX A;  3O34 A;  3LVR E;  4FJC A;  4WZ3 B;  2YSM A;  2KRE A;  3HCU A;  2CRW A;  2HDP A;  1IYM A;  2XOY A; 
#chains in the Genus database with same CATH homology
 2KGG A;  2K16 A;  3MHS A;  2F6N A;  2CKL B;  2I50 A;  2ECJ A;  2VPB A;  3U5O A;  1Z2Q A;  2ZET C;  4GNG A;  3N9Q A;  1LDJ B;  1V87 A;  3N9N A;  4L7X A;  4YAX A;  1RMD A;  4I7D A;  4ZQL A;  2YUC A;  3U5N A;  2LQ6 A;  4QF3 A;  2K17 A;  5FB1 A;  5H1V A;  1WEN A;  3LQI A;  3RPG B;  2G45 A;  5D1K B;  2L75 A;  4A0C D;  2M6M A;  1WE9 A;  4GND A;  2C2V S;  4QF2 A;  3U5P A;  2RSD A;  4C9Z A;  2JMJ A;  5B75 A;  2K4D A;  2YHN A;  2YQL A;  4LAD B;  4BBQ A;  2KE1 A;  4UP5 A;  2VPG A;  5H1U A;  4PTB A;  3O36 A;  2KR4 A;  2VJE B;  2YT5 A;  3U5M A;  2YHO A;  4A4B A;  5TDW A;  2EOD A;  4AYC B;  3T7L A;  4L58 A;  5EYA F;  2G6Q A;  5AIU A;  5I3L A;  4Q6F A;  3HCT A;  4PPE A;  3N9L A;  2ECW A;  3GL6 A;  1X4I A;  2QIZ A;  3FL2 A;  4YAT A;  2VJF B;  5TAB A;  3O7A A;  4BHW A;  2DX8 A;  2FUU A;  1WES A;  2LXP C;  5KH9 A;  5JG6 A;  4B7Y C;  5LCW B;  1JM7 B;  2LGL A;  2MT5 A;  2YQM A;  2NAA A;  3M99 A;  2ECT A;  3PUQ A;  4R2Y A;  5G0F A;  3C6W A;  3PHD A;  5LKU A;  3M62 A;  3LRQ A;  3ZNI A;  4UP0 A;  4B86 C;  4S3O C;  2CSY A;  3SHB A;  1MM2 A;  5D1L B;  2Y1M A;  3L1Z B;  1MM3 A;  2KIZ A;  3KV6 A;  4V3L C;  4F52 B;  2LGK A;  5G04 B;  2EA6 A;  5B77 A;  2OXQ C;  5LKX A;  1Z6U A;  4N4F A;  2UZG A;  2YRE A;  4ZDT A;  2CSZ A;  4I7C A;  3ZPV 1;  2LN0 A;  5H9M A;  3T6R A;  2KYU A;  2Y1N A;  2H0D B;  1T1H A;  2AN6 A;  4LKA A;  2QJ0 A;  2VPE A;  1WEP A;  5FEY A;  4A4C A;  3ZPV E;  3L1X A;  5KH3 A;  4WZ0 A;  1WFK A;  2IDA A;  3N9P A;  2VNF A;  1LDK C;  2MIQ A;  4R7E A;  4FO9 A;  4UI9 B;  1X4J A;  4AP4 A;  3M63 A;  1FBV A;  2KFT A;  2YW8 A;  4YBM A;  4FIP A;  2RI7 A;  4CCG X;  1WEQ A;  5J3X A;  2YYR A;  4TKP B;  3EB5 A;  2E6R A;  1F62 A;  3RPG C;  3I2D A;  4GNE A;  2M3H A;  2C2L A;  3KV5 A;  4NN2 A;  2CKL A;  2KWO A;  2LV9 A;  4A49 A;  3V43 A;  3ZVY A;  4LK9 A;  5H1T A;  3ZTG A;  1VYX A;  2K1J A;  2XEU A;  1K2F A;  3QZV A;  2KWN A;  1WIM A;  5TBN A;  2KWJ A;  3VK6 A;  2PUY A;  2FSA A;  2KU3 A;  2MD8 C;  3EB6 A;  2E6S A;  4FK5 A;  4YC9 A;  4LJN A;  4YBT A;  2PNX A;  2MNY A;  2F6J A;  3SOU A;  1WEE A;  3C5K A;  3LQJ A;  2QIC A;  3O70 A;  4I7B A;  4YAD A;  3GV4 A;  1E4U A;  2BAY A;  3KQI A;  3LQH A;  2L43 A;  2JRJ A;  3O37 A;  3L11 A;  1X4U A;  5G05 B;  2VJE A;  4R8P K;  2L0B A;  3DQV R;  2EGP A;  4V3K C;  2G43 A;  5B8D A;  1CHC A;  2XB1 A;  4AYC A;  1WEV A;  2ECV A;  4W4U A;  3HTK C;  2HYE D;  4MVT A;  1HYJ A;  2L5U A;  2VJF A;  1WEM A;  2FUI A;  1WEU A;  3N9O A;  5LKZ A;  5FB0 A;  4GNF A;  2MA6 A;  2YUR A;  4N3W A;  2MNZ A;  4XI1 A;  2JMD A;  5AIT A;  1JM7 A;  1U6G B;  4WZ2 A;  2YU4 A;  3PUR A;  5C13 A;  3DPL R;  2ECI A;  4CA1 A;  4ZUX U;  5FER A;  1JOC A;  2MD7 B;  4WA6 A;  1WIL A;  1DVP A;  2D8S A;  2KGI A;  4X3G A;  1Z60 A;  3SOX A;  4IC2 A;  3SOW A;  5C11 A;  1WEO A;  4YBS A;  3O35 A;  5B79 A;  3KNV A;  5TRB A;  2JMI A;  1VFY A;  5TDR A;  2F42 A;  3N9M A;  5DKA A;  5LKT A;  2LDR A;  2M1R A;  1FP0 A;  1ZBD B;  2H0D A;  4P5O B;  2VP7 A;  3HCS A;  5D1M B;  3IHP A;  4AUQ B;  2CT2 A;  5KH7 A;  2MA5 A;  3ZYQ A;  2LGV A;  2LGG A;  3MHH A;  2Y43 A;  3NG2 A;  2L80 A;  2ECG A;  2YSJ A;  2LRI C;  3O33 A;  4LLB A;  3ASL A;  1WGM A;  1G25 A;  4YAB A;  1BOR A;  2ECN A;  4O64 A;  2LXH C;  1XWH A;  5B76 A;  2KWK A;  4IC3 A;  1N87 A;  2MUM A;  4AVX A;  4S3O B;  5B78 A;  1WEW A;  4MSX A;  2VPD A;  4GB0 A;  3RTR B;  2M85 A;  5DIN A;  1VD4 A;  3ZVZ B;  1HYI A;  3O34 A;  4FJC A;  4WZ3 B;  2YSM A;  2KRE A;  3HCU A;  2HDP A;  1IYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...