3L1ZB

Crystal structure of the u-box domain of human e4b ubiquitin ligase in complex with ubch5c e2 ubiquitin conjugating enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
b'IDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D3
molecule tags Ligase
source organism Homo sapiens
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
total genus 16
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1zB01
2KWKA 4ZDTA 2ECWA 4UP5A 5B78A 4P5OB 2KGGA 2VJEA 4LK9A 2LGKA 4PTBA 3T6RA 4LJNA 4L7XA 4UI9B 1WEOA 4AP4A 5H1TA 2YURA 4GNFA 3PURA 1WFKA 1G25A 3M99A 3HCUA 5C13A 1T1HA 4AVXA 1WE9A 2KU3A 4GNDA 4A49A 5LKXA 1Z2QA 2KREA 1WGMA 4WZ0A 3ZTGA 3KV5A 1LDKC 3N9PA 3V43A 4YATA 1BORA 3L1ZB 4A4CA 3KNVA 3ZVYA 4F52B 1WEEA 2ECTA 3RTRB 2JMJA 2YUCA 1E4UA 3MHSA 1V87A 4A4BA 4YBTA 2VP7A 4LADB 5KH7A 4PPEA 1HYJA 1FP0A 2VJFB 5DKAA 1WEQA 4CCGX 3N9QA 2ECIA 2EA6A 4BHWA 4GNEA 5TDRA 5AITA 2M1RA 4WA6A 4AYCB 4WZ3B 3MHHA 2L0BA 1MM2A 5EYAF 1N87A 3PUQA 1LDJB 4IC3A 5H1VA 2KGIA 2LGGA 1WEWA 2K4DA 2LGVA 2PNXA 3T7LA 1VFYA 1Z60A 1WENA 2L5UA 2RI7A 3L11A 2ECVA 3N9NA 2KIZA 3RPGB 1IYMA 5LCWB 3LQHA 3U5OA 2YU4A 1WESA 4V3LC 2PUYA 2G45A 1ZBDB 3SOWA 4B7YC 3N9LA 2MUMA 3QZVA 2LDRA 5B8DA 2YSJA 4R8PK 3LRQA 3SHBA 2YHOA 4QF2A 1X4JA 2MD7B 2KFTA 4FO9A 2KR4A 3N9OA 4X3GA 5TABA 2LN0A 4C9ZA 2VPGA 4YAXA 2XB1A 2E6RA 3HTKC 2RSDA 4I7CA 4I7BA 4YC9A 5D1LB 3EB6A 5FB0A 2Y1MA 2K1JA 4B86C 5B75A 2KYUA 1XWHA 4BBQA 4QF3A 3O7AA 4ZQLA 4FK5A 4L58A 2M3HA 2AN6A 2KWOA 1WILA 2MIQA 4FJCA 3EB5A 4AYCA 1WEPA 2LRIC 2JMIA 2M6MA 3L1XA 4O64A 3PHDA 1JM7B 3HCTA 1WIMA 2M85A 1JOCA 4YADA 3O37A 2F42A 5DINA 2MA6A 2KWJA 5G0FA 2NAAA 5H9MA 3NG2A 3DPLR 3U5MA 2CKLB 2YYRA 2I50A 2L75A 2LQ6A 4YABA 2FUIA 2LXPC 3LQIA 4R2YA 4I7DA 1JM7A 4N3WA 2H0DA 3O36A 2BAYA 2K16A 3O33A 2VPEA 2MT5A 5C11A 2VNFA 1F62A 5G04B 1DVPA 5G05B 2ZETC 4S3OB 1X4IA 4LKAA 2CSZA 5H1UA 5KH9A 4CA1A 2KWNA 1MM3A 2UZGA 2YT5A 3RPGC 2EODA 2IDAA 3IHPA 2HYED 3N9MA 3U5PA 2HDPA 4Q6FA 4NN2A 3GV4A 2FSAA 3ZPV1 4GNGA 3C6WA 2VPDA 3O70A 3KV6A 4LLBA 1X4UA 5LKUA 5D1MB 5I3LA 4YBSA 5TRBA 2G6QA 3ASLA 2Y43A 5KH3A 2VJFA 2EGPA 2F6JA 1CHCA 5TBNA 2JRJA 2LV9A 2ECGA 1VYXA 4TKPB 5B76A 5B79A 2L80A 1Z6UA 2JMDA 1U6GB 2QIZA 2FUUA 3FL2A 3I2DA 2YQMA 1WEVA 2CKLA 5FERA 3KQIA 4MVTA 5LKZA 2ECNA 5J3XA 4WZ2A 2YSMA 4V3KC 4IC2A 4GB0A 2C2VS 5AIUA 2QICA 3O35A 4ZUXU 2C2LA 3DQVR 2DX8A 2ECJA 2E6SA 2L43A 3ZYQA 1HYIA 4MSXA 5B77A 3VK6A 1RMDA 2Y1NA 5FB1A 2KE1A 2OXQC 3ZNIA 2H0DB 2YREA 3M62A 4AUQB 2VJEB 2YQLA 3U5NA 4UP0A 3C5KA 4FIPA 2MNZA 5D1KB 2G43A 2QJ0A 2MA5A 4W4UA 4YBMA 3SOXA 2MD8C 1VD4A 2D8SA 2LGLA 2YHNA 2K17A 3M63A 5TDWA 4A0CD 2CT2A 3LQJA 1WEMA 4R7EA 2CSYA 5LKTA 3ZPVE 2YW8A 3O34A 3HCSA 1K2FA 4S3OC 3GL6A 1FBVA 2F6NA 1WEUA 3SOUA 2MNYA 4XI1A 3ZVZB 4N4FA 2LXHC 2XEUA 5FEYA 2VPBA 5JG6A
chains in the Genus database with same CATH superfamily
2KWKA 4ZDTA 2ECWA 4UP5A 5B78A 4P5OB 2KGGA 2VJEA 4LK9A 2LGKA 4PTBA 3T6RA 4LJNA 5SVIB 4L7XA 4UI9B 1WEOA 4AP4A 5H1TA 2YURA 4GNFA 3PURA 1WFKA 1G25A 3M99A 3HCUA 3E2DA 5C13A 1T1HA 4AVXA 1WE9A 2CSVA 2DSMA 2KU3A 4GNDA 2CRRA 4A49A 3FAOA 5LKXA 1Z2QA 2M13A 2KREA 1WGMA 4WZ0A 3ZTGA 3KV5A 1LDKC 3N9PA 3V43A 4YATA 1BORA 3L1ZB 4A4CA 3KNVA 3ZVYA 4F52B 3FM8C 1WEEA 2ECTA 2XP0A 3RTRB 2JMJA 2YUCA 1E4UA 3MHSA 1V87A 4A4BA 4YBTA 3KDEC 2VP7A 4LADB 5KH7A 4PPEA 2RR4A 1HYJA 1FP0A 2VJFB 5DKAA 1WEQA 4CCGX 3N9QA 2ECIA 2EA6A 4BHWA 4GNEA 5TDRA 5AITA 2M1RA 4WA6A 4AYCB 4WZ3B 3MHHA 2L0BA 1MM2A 5EYAF 1N87A 2JM3A 3PUQA 1LDJB 4IC3A 5H1VA 2XOZA 3FEHA 2KGIA 2LGGA 1WEWA 2FD4A 2K4DA 2LGVA 2PNXA 3T7LA 1VFYA 1Z60A 1WENA 3LDYA 2L5UA 2RI7A 3L11A 2ECVA 3N9NA 2KIZA 3RPGB 1IYMA 5LCWB 3LQHA 3U5OA 2IQJA 2E61A 2YU4A 2B0OE 1WESA 4V3LC 2PUYA 2G45A 1ZBDB 2KKYA 3SOWA 4B7YC 3N9LA 3MDBC 2MUMA 3QZVA 2LDRA 5B8DA 2YSJA 4H9DA 4R8PK 3LRQA 3SHBA 2OWAA 2YHOA 4QF2A 2D8UA 1X4JA 2MD7B 2KFTA 4FO9A 2KR4A 3N9OA 4X3GA 5TABA 2LN0A 4C9ZA 2VPGA 4YAXA 2XB1A 2E6RA 3HTKC 2RSDA 4I7CA 3LVRE 4I7BA 4YC9A 2YVRA 5D1LB 3EB6A 5FB0A 2Y1MA 2K1JA 4OGEA 4B86C 2KYUA 5B75A 1XWHA 4BBQA 4QF3A 3O7AA 4ZQLA 4FK5A 4L58A 2M3HA 2AN6A 2KWOA 1WILA 2LAUA 2MIQA 4FJCA 3EB5A 4AYCA 1WEPA 2LRIC 2JMIA 2M6MA 3L1XA 4O64A 3PHDA 1JM7B 3HCTA 1WIMA 2M85A 1JOCA 4YADA 3O37A 5DINA 2F42A 2MA6A 2KWJA 5G0FA 2NAAA 5H9MA 3NG2A 3DPLR 3U5MA 2CKLB 2EXUA 3LJUX 3LVQE 2YYRA 2I50A 2CONA 2L75A 2LQ6A 4YABA 2FUIA 2LXPC 3LQIA 4R2YA 4I7DA 3T9KA 1JM7A 4N3WA 2H0DA 3O36A 2BAYA 2K16A 3O33A 2VPEA 2MT5A 2EGMA 5C11A 2VNFA 1F62A 5G04B 1DVPA 5G05B 2ZETC 2CRWA 4S3OB 3FJUB 1X4IA 4LKAA 2CSZA 5H1UA 5KH9A 4CA1A 2MKEA 5SVYA 2KWNA 1MM3A 2UZGA 2YT5A 3RPGC 2EODA 2IDAA 3IHPA 2HYED 3N9MA 3U5PA 2HDPA 4Q6FA 2FFWA 4NN2A 3GV4A 2FSAA 3ZPV1 4GNGA 3C6WA 2VPDA 3O70A 3KV6A 4LLBA 1X4UA 5SVXA 5LKUA 3FANA 3Q1DA 5D1MB 5I3LA 4YBSA 5TRBA 2G6QA 4F1PA 4OGCA 3ASLA 2Y43A 5KH3A 2VJFA 2EGPA 2F6JA 1DCQA 1CHCA 5TBNA 2JRJA 2LV9A 2ECGA 1VYXA 4TKPB 2KKXA 5B76A 5B79A 4Z0RA 2L80A 1Z6UA 2JMDA 1U6GB 2QIZA 2FUUA 3FL2A 3I2DA 2YQMA 1WEVA 2CKLA 5FERA 3KQIA 2DJAA 4MVTA 5LKZA 2ECNA 5J3XA 4WZ2A 2YSMA 3DWDA 4V3KC 3M7KA 4IC2A 4GB0A 2C2VS 5AIUA 2QICA 3O35A 4O62A 4ZUXU 2C2LA 3DQVR 2DX8A 3SUBA 2JUNA 4Z0OA 2ECJA 2E6SA 2L43A 3ZYQA 2XOCA 1HYIA 4MSXA 5B77A 3VK6A 1RMDA 2XOYA 2Y1NA 5FB1A 2KE1A 2OXQC 3ZNIA 4QQ4A 2H0DB 2YREA 3M62A 3DDTA 4AUQB 2VJEB 2YQLA 5SVIA 3U5NA 3H7HA 4UP0A 3C5KA 4FIPA 2MNZA 5D1KB 2G43A 2QJ0A 2MA5A 4W4UA 4YBMA 3SOXA 5K3QA 3O47A 2MD8C 1VD4A 2P57A 2D8SA 2LGLA 2YHNA 2K17A 3M63A 5TDWA 4A0CD 2CT2A 3LQJA 1WEMA 4R7EA 2CSYA 3JUEA 5LKTA 3ZPVE 3PLWA 2YW8A 3O34A 3HCSA 1K2FA 4S3OC 1MBMA 3GL6A 1FBVA 2F6NA 1WEUA 3SOUA 2MNYA 4XI1A 3ZVZB 4N4FA 2L7PA 2LXHC 2XEUA 5FEYA 2VPBA 5JG6A
chains in the Genus database with same CATH topology
2KWKA 4ZDTA 2ECWA 4UP5A 5B78A 4P5OB 2KGGA 2VJEA 4LK9A 2LGKA 4PTBA 3T6RA 4LJNA 4L7XA 4UI9B 1WEOA 4AP4A 5H1TA 2YURA 4GNFA 3PURA 1WFKA 1G25A 3M99A 3HCUA 5C13A 1T1HA 4AVXA 1WE9A 2KU3A 4GNDA 4A49A 5LKXA 1Z2QA 2KREA 1WGMA 4WZ0A 3ZTGA 3KV5A 1LDKC 3N9PA 3V43A 4YATA 1BORA 3L1ZB 4A4CA 3KNVA 3ZVYA 4F52B 1WEEA 2ECTA 3RTRB 2JMJA 2YUCA 1E4UA 3MHSA 1V87A 4A4BA 4YBTA 2VP7A 4LADB 5KH7A 4PPEA 1HYJA 1FP0A 2VJFB 5DKAA 1WEQA 4CCGX 3N9QA 2ECIA 2EA6A 4BHWA 4GNEA 5TDRA 5AITA 2M1RA 4WA6A 4AYCB 4WZ3B 3MHHA 2L0BA 1MM2A 5EYAF 1N87A 3PUQA 1LDJB 4IC3A 5H1VA 2KGIA 2LGGA 1WEWA 2K4DA 2LGVA 2PNXA 3T7LA 1VFYA 1Z60A 1WENA 2L5UA 2RI7A 3L11A 2ECVA 3N9NA 2KIZA 3RPGB 1IYMA 5LCWB 3LQHA 3U5OA 2YU4A 1WESA 4V3LC 2PUYA 2G45A 1ZBDB 3SOWA 4B7YC 3N9LA 2MUMA 3QZVA 2LDRA 5B8DA 2YSJA 4R8PK 3LRQA 3SHBA 2YHOA 4QF2A 1X4JA 2MD7B 2KFTA 4FO9A 2KR4A 3N9OA 4X3GA 5TABA 2LN0A 4C9ZA 2VPGA 4YAXA 2XB1A 2E6RA 3HTKC 2RSDA 4I7CA 4I7BA 4YC9A 5D1LB 3EB6A 5FB0A 2Y1MA 2K1JA 4B86C 5B75A 2KYUA 1XWHA 4BBQA 4QF3A 3O7AA 4ZQLA 4FK5A 4L58A 2M3HA 2AN6A 2KWOA 1WILA 2MIQA 4FJCA 3EB5A 4AYCA 1WEPA 2LRIC 2JMIA 2M6MA 3L1XA 4O64A 3PHDA 1JM7B 3HCTA 1WIMA 2M85A 1JOCA 4YADA 3O37A 2F42A 5DINA 2MA6A 2KWJA 5G0FA 2NAAA 5H9MA 3NG2A 3DPLR 3U5MA 2CKLB 2YYRA 2I50A 2L75A 2LQ6A 4YABA 2FUIA 2LXPC 3LQIA 4R2YA 4I7DA 1JM7A 4N3WA 2H0DA 3O36A 2BAYA 2K16A 3O33A 2VPEA 2MT5A 5C11A 2VNFA 1F62A 5G04B 1DVPA 5G05B 2ZETC 4S3OB 1X4IA 4LKAA 2CSZA 5H1UA 5KH9A 4CA1A 2KWNA 1MM3A 2UZGA 2YT5A 3RPGC 2EODA 2IDAA 3IHPA 2HYED 3N9MA 3U5PA 2HDPA 4Q6FA 4NN2A 3GV4A 2FSAA 3ZPV1 4GNGA 3C6WA 2VPDA 3O70A 3KV6A 4LLBA 1X4UA 5LKUA 5D1MB 5I3LA 4YBSA 5TRBA 2G6QA 3ASLA 2Y43A 5KH3A 2VJFA 2EGPA 2F6JA 1CHCA 5TBNA 2JRJA 2LV9A 2ECGA 1VYXA 4TKPB 5B76A 5B79A 2L80A 1Z6UA 2JMDA 1U6GB 2QIZA 2FUUA 3FL2A 3I2DA 2YQMA 1WEVA 2CKLA 5FERA 3KQIA 4MVTA 5LKZA 2ECNA 5J3XA 4WZ2A 2YSMA 4V3KC 4IC2A 4GB0A 2C2VS 5AIUA 2QICA 3O35A 4ZUXU 2C2LA 3DQVR 2DX8A 2ECJA 2E6SA 2L43A 3ZYQA 1HYIA 4MSXA 5B77A 3VK6A 1RMDA 2Y1NA 5FB1A 2KE1A 2OXQC 3ZNIA 2H0DB 2YREA 3M62A 4AUQB 2VJEB 2YQLA 3U5NA 4UP0A 3C5KA 4FIPA 2MNZA 5D1KB 2G43A 2QJ0A 2MA5A 4W4UA 4YBMA 3SOXA 2MD8C 1VD4A 2D8SA 2LGLA 2YHNA 2K17A 3M63A 5TDWA 4A0CD 2CT2A 3LQJA 1WEMA 4R7EA 2CSYA 5LKTA 3ZPVE 2YW8A 3O34A 3HCSA 1K2FA 4S3OC 3GL6A 1FBVA 2F6NA 1WEUA 3SOUA 2MNYA 4XI1A 3ZVZB 4N4FA 2LXHC 2XEUA 5FEYA 2VPBA 5JG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWK A;  4ZDT A;  2ECW A;  4UP5 A;  5B78 A;  4P5O B;  2KGG A;  2VJE A;  4LK9 A;  2LGK A;  4PTB A;  3T6R A;  4LJN A;  4L7X A;  4UI9 B;  1WEO A;  4AP4 A;  5H1T A;  2YUR A;  4GNF A;  3PUR A;  1WFK A;  1G25 A;  3M99 A;  3HCU A;  5C13 A;  1T1H A;  4AVX A;  1WE9 A;  2KU3 A;  4GND A;  4A49 A;  5LKX A;  1Z2Q A;  2KRE A;  1WGM A;  4WZ0 A;  3ZTG A;  3KV5 A;  1LDK C;  3N9P A;  3V43 A;  4YAT A;  1BOR A;  3L1Z B;  4A4C A;  3KNV A;  3ZVY A;  4F52 B;  1WEE A;  2ECT A;  3RTR B;  2JMJ A;  2YUC A;  1E4U A;  3MHS A;  1V87 A;  4A4B A;  4YBT A;  2VP7 A;  4LAD B;  5KH7 A;  4PPE A;  1HYJ A;  1FP0 A;  2VJF B;  5DKA A;  1WEQ A;  4CCG X;  3N9Q A;  2ECI A;  2EA6 A;  4BHW A;  4GNE A;  5TDR A;  5AIT A;  2M1R A;  4WA6 A;  4AYC B;  4WZ3 B;  3MHH A;  2L0B A;  1MM2 A;  5EYA F;  1N87 A;  3PUQ A;  1LDJ B;  4IC3 A;  5H1V A;  2KGI A;  2LGG A;  1WEW A;  2K4D A;  2LGV A;  2PNX A;  3T7L A;  1VFY A;  1Z60 A;  1WEN A;  2L5U A;  2RI7 A;  3L11 A;  2ECV A;  3N9N A;  2KIZ A;  3RPG B;  1IYM A;  5LCW B;  3LQH A;  3U5O A;  2YU4 A;  1WES A;  4V3L C;  2PUY A;  2G45 A;  1ZBD B;  3SOW A;  4B7Y C;  3N9L A;  2MUM A;  3QZV A;  2LDR A;  5B8D A;  2YSJ A;  4R8P K;  3LRQ A;  3SHB A;  2YHO A;  4QF2 A;  1X4J A;  2MD7 B;  2KFT A;  4FO9 A;  2KR4 A;  3N9O A;  4X3G A;  5TAB A;  2LN0 A;  4C9Z A;  2VPG A;  4YAX A;  2XB1 A;  2E6R A;  3HTK C;  2RSD A;  4I7C A;  4I7B A;  4YC9 A;  5D1L B;  3EB6 A;  5FB0 A;  2Y1M A;  2K1J A;  4B86 C;  5B75 A;  2KYU A;  1XWH A;  4BBQ A;  4QF3 A;  3O7A A;  4ZQL A;  4FK5 A;  4L58 A;  2M3H A;  2AN6 A;  2KWO A;  1WIL A;  2MIQ A;  4FJC A;  3EB5 A;  4AYC A;  1WEP A;  2LRI C;  2JMI A;  2M6M A;  3L1X A;  4O64 A;  3PHD A;  1JM7 B;  3HCT A;  1WIM A;  2M85 A;  1JOC A;  4YAD A;  3O37 A;  2F42 A;  5DIN A;  2MA6 A;  2KWJ A;  5G0F A;  2NAA A;  5H9M A;  3NG2 A;  3DPL R;  3U5M A;  2CKL B;  2YYR A;  2I50 A;  2L75 A;  2LQ6 A;  4YAB A;  2FUI A;  2LXP C;  3LQI A;  4R2Y A;  4I7D A;  1JM7 A;  4N3W A;  2H0D A;  3O36 A;  2BAY A;  2K16 A;  3O33 A;  2VPE A;  2MT5 A;  5C11 A;  2VNF A;  1F62 A;  5G04 B;  1DVP A;  5G05 B;  2ZET C;  4S3O B;  1X4I A;  4LKA A;  2CSZ A;  5H1U A;  5KH9 A;  4CA1 A;  2KWN A;  1MM3 A;  2UZG A;  2YT5 A;  3RPG C;  2EOD A;  2IDA A;  3IHP A;  2HYE D;  3N9M A;  3U5P A;  2HDP A;  4Q6F A;  4NN2 A;  3GV4 A;  2FSA A;  3ZPV 1;  4GNG A;  3C6W A;  2VPD A;  3O70 A;  3KV6 A;  4LLB A;  1X4U A;  5LKU A;  5D1M B;  5I3L A;  4YBS A;  5TRB A;  2G6Q A;  3ASL A;  2Y43 A;  5KH3 A;  2VJF A;  2EGP A;  2F6J A;  1CHC A;  5TBN A;  2JRJ A;  2LV9 A;  2ECG A;  1VYX A;  4TKP B;  5B76 A;  5B79 A;  2L80 A;  1Z6U A;  2JMD A;  1U6G B;  2QIZ A;  2FUU A;  3FL2 A;  3I2D A;  2YQM A;  1WEV A;  2CKL A;  5FER A;  3KQI A;  4MVT A;  5LKZ A;  2ECN A;  5J3X A;  4WZ2 A;  2YSM A;  4V3K C;  4IC2 A;  4GB0 A;  2C2V S;  5AIU A;  2QIC A;  3O35 A;  4ZUX U;  2C2L A;  3DQV R;  2DX8 A;  2ECJ A;  2E6S A;  2L43 A;  3ZYQ A;  1HYI A;  4MSX A;  5B77 A;  3VK6 A;  1RMD A;  2Y1N A;  5FB1 A;  2KE1 A;  2OXQ C;  3ZNI A;  2H0D B;  2YRE A;  3M62 A;  4AUQ B;  2VJE B;  2YQL A;  3U5N A;  4UP0 A;  3C5K A;  4FIP A;  2MNZ A;  5D1K B;  2G43 A;  2QJ0 A;  2MA5 A;  4W4U A;  4YBM A;  3SOX A;  2MD8 C;  1VD4 A;  2D8S A;  2LGL A;  2YHN A;  2K17 A;  3M63 A;  5TDW A;  4A0C D;  2CT2 A;  3LQJ A;  1WEM A;  4R7E A;  2CSY A;  5LKT A;  3ZPV E;  2YW8 A;  3O34 A;  3HCS A;  1K2F A;  4S3O C;  3GL6 A;  1FBV A;  2F6N A;  1WEU A;  3SOU A;  2MNY A;  4XI1 A;  3ZVZ B;  4N4F A;  2LXH C;  2XEU A;  5FEY A;  2VPB A;  5JG6 A; 
#chains in the Genus database with same CATH topology
 2KWK A;  4ZDT A;  2ECW A;  4UP5 A;  5B78 A;  4P5O B;  2KGG A;  2VJE A;  4LK9 A;  2LGK A;  4PTB A;  3T6R A;  4LJN A;  5SVI B;  4L7X A;  4UI9 B;  1WEO A;  4AP4 A;  5H1T A;  2YUR A;  4GNF A;  3PUR A;  1WFK A;  1G25 A;  3M99 A;  3HCU A;  3E2D A;  5C13 A;  1T1H A;  4AVX A;  1WE9 A;  2CSV A;  2DSM A;  2KU3 A;  4GND A;  2CRR A;  4A49 A;  3FAO A;  5LKX A;  1Z2Q A;  2M13 A;  2KRE A;  1WGM A;  4WZ0 A;  3ZTG A;  3KV5 A;  1LDK C;  3N9P A;  3V43 A;  4YAT A;  1BOR A;  3L1Z B;  4A4C A;  3KNV A;  3ZVY A;  4F52 B;  3FM8 C;  1WEE A;  2ECT A;  2XP0 A;  3RTR B;  2JMJ A;  2YUC A;  1E4U A;  3MHS A;  1V87 A;  4A4B A;  4YBT A;  3KDE C;  2VP7 A;  4LAD B;  5KH7 A;  4PPE A;  2RR4 A;  1HYJ A;  1FP0 A;  2VJF B;  5DKA A;  1WEQ A;  4CCG X;  3N9Q A;  2ECI A;  2EA6 A;  4BHW A;  4GNE A;  5TDR A;  5AIT A;  2M1R A;  4WA6 A;  4AYC B;  4WZ3 B;  3MHH A;  2L0B A;  1MM2 A;  5EYA F;  1N87 A;  2JM3 A;  3PUQ A;  1LDJ B;  4IC3 A;  5H1V A;  2XOZ A;  3FEH A;  2KGI A;  2LGG A;  1WEW A;  2FD4 A;  2K4D A;  2LGV A;  2PNX A;  3T7L A;  1VFY A;  1Z60 A;  1WEN A;  3LDY A;  2L5U A;  2RI7 A;  3L11 A;  2ECV A;  3N9N A;  2KIZ A;  3RPG B;  1IYM A;  5LCW B;  3LQH A;  3U5O A;  2IQJ A;  2E61 A;  2YU4 A;  2B0O E;  1WES A;  4V3L C;  2PUY A;  2G45 A;  1ZBD B;  2KKY A;  3SOW A;  4B7Y C;  3N9L A;  3MDB C;  2MUM A;  3QZV A;  2LDR A;  5B8D A;  2YSJ A;  4H9D A;  4R8P K;  3LRQ A;  3SHB A;  2OWA A;  2YHO A;  4QF2 A;  2D8U A;  1X4J A;  2MD7 B;  2KFT A;  4FO9 A;  2KR4 A;  3N9O A;  4X3G A;  5TAB A;  2LN0 A;  4C9Z A;  2VPG A;  4YAX A;  2XB1 A;  2E6R A;  3HTK C;  2RSD A;  4I7C A;  3LVR E;  4I7B A;  4YC9 A;  2YVR A;  5D1L B;  3EB6 A;  5FB0 A;  2Y1M A;  2K1J A;  4OGE A;  4B86 C;  2KYU A;  5B75 A;  1XWH A;  4BBQ A;  4QF3 A;  3O7A A;  4ZQL A;  4FK5 A;  4L58 A;  2M3H A;  2AN6 A;  2KWO A;  1WIL A;  2LAU A;  2MIQ A;  4FJC A;  3EB5 A;  4AYC A;  1WEP A;  2LRI C;  2JMI A;  2M6M A;  3L1X A;  4O64 A;  3PHD A;  1JM7 B;  3HCT A;  1WIM A;  2M85 A;  1JOC A;  4YAD A;  3O37 A;  5DIN A;  2F42 A;  2MA6 A;  2KWJ A;  5G0F A;  2NAA A;  5H9M A;  3NG2 A;  3DPL R;  3U5M A;  2CKL B;  2EXU A;  3LJU X;  3LVQ E;  2YYR A;  2I50 A;  2CON A;  2L75 A;  2LQ6 A;  4YAB A;  2FUI A;  2LXP C;  3LQI A;  4R2Y A;  4I7D A;  3T9K A;  1JM7 A;  4N3W A;  2H0D A;  3O36 A;  2BAY A;  2K16 A;  3O33 A;  2VPE A;  2MT5 A;  2EGM A;  5C11 A;  2VNF A;  1F62 A;  5G04 B;  1DVP A;  5G05 B;  2ZET C;  2CRW A;  4S3O B;  3FJU B;  1X4I A;  4LKA A;  2CSZ A;  5H1U A;  5KH9 A;  4CA1 A;  2MKE A;  5SVY A;  2KWN A;  1MM3 A;  2UZG A;  2YT5 A;  3RPG C;  2EOD A;  2IDA A;  3IHP A;  2HYE D;  3N9M A;  3U5P A;  2HDP A;  4Q6F A;  2FFW A;  4NN2 A;  3GV4 A;  2FSA A;  3ZPV 1;  4GNG A;  3C6W A;  2VPD A;  3O70 A;  3KV6 A;  4LLB A;  1X4U A;  5SVX A;  5LKU A;  3FAN A;  3Q1D A;  5D1M B;  5I3L A;  4YBS A;  5TRB A;  2G6Q A;  4F1P A;  4OGC A;  3ASL A;  2Y43 A;  5KH3 A;  2VJF A;  2EGP A;  2F6J A;  1DCQ A;  1CHC A;  5TBN A;  2JRJ A;  2LV9 A;  2ECG A;  1VYX A;  4TKP B;  2KKX A;  5B76 A;  5B79 A;  4Z0R A;  2L80 A;  1Z6U A;  2JMD A;  1U6G B;  2QIZ A;  2FUU A;  3FL2 A;  3I2D A;  2YQM A;  1WEV A;  2CKL A;  5FER A;  3KQI A;  2DJA A;  4MVT A;  5LKZ A;  2ECN A;  5J3X A;  4WZ2 A;  2YSM A;  3DWD A;  4V3K C;  3M7K A;  4IC2 A;  4GB0 A;  2C2V S;  5AIU A;  2QIC A;  3O35 A;  4O62 A;  4ZUX U;  2C2L A;  3DQV R;  2DX8 A;  3SUB A;  2JUN A;  4Z0O A;  2ECJ A;  2E6S A;  2L43 A;  3ZYQ A;  2XOC A;  1HYI A;  4MSX A;  5B77 A;  3VK6 A;  1RMD A;  2XOY A;  2Y1N A;  5FB1 A;  2KE1 A;  2OXQ C;  3ZNI A;  4QQ4 A;  2H0D B;  2YRE A;  3M62 A;  3DDT A;  4AUQ B;  2VJE B;  2YQL A;  5SVI A;  3U5N A;  3H7H A;  4UP0 A;  3C5K A;  4FIP A;  2MNZ A;  5D1K B;  2G43 A;  2QJ0 A;  2MA5 A;  4W4U A;  4YBM A;  3SOX A;  5K3Q A;  3O47 A;  2MD8 C;  1VD4 A;  2P57 A;  2D8S A;  2LGL A;  2YHN A;  2K17 A;  3M63 A;  5TDW A;  4A0C D;  2CT2 A;  3LQJ A;  1WEM A;  4R7E A;  2CSY A;  3JUE A;  5LKT A;  3ZPV E;  3PLW A;  2YW8 A;  3O34 A;  3HCS A;  1K2F A;  4S3O C;  1MBM A;  3GL6 A;  1FBV A;  2F6N A;  1WEU A;  3SOU A;  2MNY A;  4XI1 A;  3ZVZ B;  4N4F A;  2L7P A;  2LXH C;  2XEU A;  5FEY A;  2VPB A;  5JG6 A; 
#chains in the Genus database with same CATH homology
 2KWK A;  4ZDT A;  2ECW A;  4UP5 A;  5B78 A;  4P5O B;  2KGG A;  2VJE A;  4LK9 A;  2LGK A;  4PTB A;  3T6R A;  4LJN A;  4L7X A;  4UI9 B;  1WEO A;  4AP4 A;  5H1T A;  2YUR A;  4GNF A;  3PUR A;  1WFK A;  1G25 A;  3M99 A;  3HCU A;  5C13 A;  1T1H A;  4AVX A;  1WE9 A;  2KU3 A;  4GND A;  4A49 A;  5LKX A;  1Z2Q A;  2KRE A;  1WGM A;  4WZ0 A;  3ZTG A;  3KV5 A;  1LDK C;  3N9P A;  3V43 A;  4YAT A;  1BOR A;  3L1Z B;  4A4C A;  3KNV A;  3ZVY A;  4F52 B;  1WEE A;  2ECT A;  3RTR B;  2JMJ A;  2YUC A;  1E4U A;  3MHS A;  1V87 A;  4A4B A;  4YBT A;  2VP7 A;  4LAD B;  5KH7 A;  4PPE A;  1HYJ A;  1FP0 A;  2VJF B;  5DKA A;  1WEQ A;  4CCG X;  3N9Q A;  2ECI A;  2EA6 A;  4BHW A;  4GNE A;  5TDR A;  5AIT A;  2M1R A;  4WA6 A;  4AYC B;  4WZ3 B;  3MHH A;  2L0B A;  1MM2 A;  5EYA F;  1N87 A;  3PUQ A;  1LDJ B;  4IC3 A;  5H1V A;  2KGI A;  2LGG A;  1WEW A;  2K4D A;  2LGV A;  2PNX A;  3T7L A;  1VFY A;  1Z60 A;  1WEN A;  2L5U A;  2RI7 A;  3L11 A;  2ECV A;  3N9N A;  2KIZ A;  3RPG B;  1IYM A;  5LCW B;  3LQH A;  3U5O A;  2YU4 A;  1WES A;  4V3L C;  2PUY A;  2G45 A;  1ZBD B;  3SOW A;  4B7Y C;  3N9L A;  2MUM A;  3QZV A;  2LDR A;  5B8D A;  2YSJ A;  4R8P K;  3LRQ A;  3SHB A;  2YHO A;  4QF2 A;  1X4J A;  2MD7 B;  2KFT A;  4FO9 A;  2KR4 A;  3N9O A;  4X3G A;  5TAB A;  2LN0 A;  4C9Z A;  2VPG A;  4YAX A;  2XB1 A;  2E6R A;  3HTK C;  2RSD A;  4I7C A;  4I7B A;  4YC9 A;  5D1L B;  3EB6 A;  5FB0 A;  2Y1M A;  2K1J A;  4B86 C;  5B75 A;  2KYU A;  1XWH A;  4BBQ A;  4QF3 A;  3O7A A;  4ZQL A;  4FK5 A;  4L58 A;  2M3H A;  2AN6 A;  2KWO A;  1WIL A;  2MIQ A;  4FJC A;  3EB5 A;  4AYC A;  1WEP A;  2LRI C;  2JMI A;  2M6M A;  3L1X A;  4O64 A;  3PHD A;  1JM7 B;  3HCT A;  1WIM A;  2M85 A;  1JOC A;  4YAD A;  3O37 A;  2F42 A;  5DIN A;  2MA6 A;  2KWJ A;  5G0F A;  2NAA A;  5H9M A;  3NG2 A;  3DPL R;  3U5M A;  2CKL B;  2YYR A;  2I50 A;  2L75 A;  2LQ6 A;  4YAB A;  2FUI A;  2LXP C;  3LQI A;  4R2Y A;  4I7D A;  1JM7 A;  4N3W A;  2H0D A;  3O36 A;  2BAY A;  2K16 A;  3O33 A;  2VPE A;  2MT5 A;  5C11 A;  2VNF A;  1F62 A;  5G04 B;  1DVP A;  5G05 B;  2ZET C;  4S3O B;  1X4I A;  4LKA A;  2CSZ A;  5H1U A;  5KH9 A;  4CA1 A;  2KWN A;  1MM3 A;  2UZG A;  2YT5 A;  3RPG C;  2EOD A;  2IDA A;  3IHP A;  2HYE D;  3N9M A;  3U5P A;  2HDP A;  4Q6F A;  4NN2 A;  3GV4 A;  2FSA A;  3ZPV 1;  4GNG A;  3C6W A;  2VPD A;  3O70 A;  3KV6 A;  4LLB A;  1X4U A;  5LKU A;  5D1M B;  5I3L A;  4YBS A;  5TRB A;  2G6Q A;  3ASL A;  2Y43 A;  5KH3 A;  2VJF A;  2EGP A;  2F6J A;  1CHC A;  5TBN A;  2JRJ A;  2LV9 A;  2ECG A;  1VYX A;  4TKP B;  5B76 A;  5B79 A;  2L80 A;  1Z6U A;  2JMD A;  1U6G B;  2QIZ A;  2FUU A;  3FL2 A;  3I2D A;  2YQM A;  1WEV A;  2CKL A;  5FER A;  3KQI A;  4MVT A;  5LKZ A;  2ECN A;  5J3X A;  4WZ2 A;  2YSM A;  4V3K C;  4IC2 A;  4GB0 A;  2C2V S;  5AIU A;  2QIC A;  3O35 A;  4ZUX U;  2C2L A;  3DQV R;  2DX8 A;  2ECJ A;  2E6S A;  2L43 A;  3ZYQ A;  1HYI A;  4MSX A;  5B77 A;  3VK6 A;  1RMD A;  2Y1N A;  5FB1 A;  2KE1 A;  2OXQ C;  3ZNI A;  2H0D B;  2YRE A;  3M62 A;  4AUQ B;  2VJE B;  2YQL A;  3U5N A;  4UP0 A;  3C5K A;  4FIP A;  2MNZ A;  5D1K B;  2G43 A;  2QJ0 A;  2MA5 A;  4W4U A;  4YBM A;  3SOX A;  2MD8 C;  1VD4 A;  2D8S A;  2LGL A;  2YHN A;  2K17 A;  3M63 A;  5TDW A;  4A0C D;  2CT2 A;  3LQJ A;  1WEM A;  4R7E A;  2CSY A;  5LKT A;  3ZPV E;  2YW8 A;  3O34 A;  3HCS A;  1K2F A;  4S3O C;  3GL6 A;  1FBV A;  2F6N A;  1WEU A;  3SOU A;  2MNY A;  4XI1 A;  3ZVZ B;  4N4F A;  2LXH C;  2XEU A;  5FEY A;  2VPB A;  5JG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...