3L1ZB

Crystal structure of the u-box domain of human e4b ubiquitin ligase in complex with ubch5c e2 ubiquitin conjugating enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
IDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 D3
total genus 16
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1zB01
1WGMA 4NN2A 1WEOA 4N4FA 5AITA 3O35A 1WE9A 2MNZA 3U5NA 1XWHA 4UP5A 3N9MA 1RMDA 3MHHA 4YBTA 2CT2A 1X4JA 1K2FA 2EGPA 2H0DA 1WEUA 2ZETC 2MA6A 4YBMA 5D1MB 4FO9A 2KWKA 2MA5A 3SOXA 2L75A 2VPBA 3I2DA 2VPGA 2MD8C 4A4CA 5B79A 2ECTA 2KWNA 2YUCA 5D1LB 5EYAF 4TKPB 2LXPC 4BHWA 2ECIA 4QF2A 3T7LA 3ZPV1 3ASLA 2OXQC 5AIUA 2KIZA 4QF3A 2YU4A 3U5OA 2M6MA 4X3GA 5B76A 1FP0A 2ECJA 3U5MA 4YBSA 2L43A 2MUMA 2KU3A 1X4IA 2NAAA 3EB6A 2YYRA 1F62A 3HCUA 4AYCA 3HCSA 4LJNA 2LV9A 4IC3A 5JG6A 5TBNA 4WZ3B 2XEUA 3ZNIA 3L11A 2F6NA 3DQVR 5H9MA 4WA6A 2QJ0A 2L0BA 2VPDA 5H1TA 1WIMA 1WEMA 4N3WA 2G6QA 1N87A 1ZBDB 4BBQA 5G0FA 3L1XA 3N9QA 2Y1NA 1WFKA 2Y43A 2Y1MA 3LQIA 4AYCB 2ECWA 3L1ZB 3RPGC 1CHCA 2QIZA 2M1RA 5G04B 2KE1A 4PTBA 2KWJA 3VK6A 2L5UA 1MM3A 5TABA 4YADA 2ECGA 4V3LC 4XI1A 3FL2A 5G05B 2YSJA 4ZQLA 2XB1A 4R8PK 3C6WA 1JM7B 2VJFA 5TDRA 4PPEA 4Q6FA 3O33A 4ZUXU 2ECNA 4GNFA 2IDAA 4F52B 2UZGA 4LLBA 1U6GB 4L7XA 2LXHC 4YAXA 2YHNA 1X4UA 2EA6A 3NG2A 5I3LA 5B8DA 5KH3A 1VFYA 3T6RA 2K17A 4LK9A 3GL6A 2KFTA 3O70A 4I7DA 4B86C 1FBVA 4GNDA 3KV6A 3ZYQA 4V3KC 2RI7A 5TDWA 3SOWA 2LGKA 3LRQA 2KGGA 5J3XA 1Z60A 5C13A 2KR4A 1LDJB 3N9OA 4AUQB 2CKLA 2VP7A 5TRBA 2LGLA 2LQ6A 1VD4A 2VPEA 2FUUA 5LKZA 4WZ2A 1JOCA 1HYJA 3N9LA 2LRIC 2K1JA 2G43A 2PNXA 4W4UA 4CCGX 4C9ZA 3KQIA 2YURA 5H1VA 1WILA 2YHOA 1WEVA 2M85A 5H1UA 2YREA 3SHBA 1T1HA 2KREA 2RSDA 4GB0A 5DKAA 3DPLR 5FB0A 2LGVA 3N9PA 4ZDTA 5DINA 2LDRA 2VJEA 2JMIA 1WEEA 4MVTA 5FB1A 1MM2A 2MD7B 4UP0A 2F6JA 2JRJA 1VYXA 2KYUA 3RTRB 2VNFA 3O36A 3KNVA 2MIQA 2KGIA 3MHSA 4P5OB 4AP4A 2DX8A 3GV4A 4A49A 2CKLB 2QICA 3O37A 3QZVA 3LQHA 1BORA 5LCWB 5FEYA 3PHDA 2MNYA 1LDKC 4A4BA 3V43A 4L58A 3HTKC 2JMDA 1G25A 2PUYA 2EODA 3N9NA 4S3OC 2FSAA 3M62A 3PUQA 2HDPA 4LADB 3LQJA 1WEPA 3PURA 3M63A 3M99A 5LKUA 4FJCA 4I7CA 4WZ0A 4B7YC 2KWOA 2C2LA 5B78A 2M3HA 2LN0A 4AVXA 4YATA 4I7BA 2I50A 5LKTA 5KH9A 2G45A 2CSZA 1V87A 5B77A 2ECVA 2YT5A 5D1KB 1WEQA 1JM7A 2YSMA 1Z2QA 5LKXA 2VJEB 2E6SA 4A0CD 4GNEA 2CSYA 3ZVZB 4YC9A 4CA1A 2K16A 3HCTA 2F42A 2LGGA 2D8SA 4FIPA 3RPGB 3KV5A 1WESA 2JMJA 2FUIA 5B75A 2C2VS 2E6RA 4GNGA 5KH7A 2YQLA 4MSXA 4YABA 4FK5A 3U5PA 1IYMA 4O64A 1E4UA 3O34A 2AN6A 2YW8A 3SOUA 3O7AA 4S3OB 2HYED 4IC2A 3EB5A 2YQMA 2L80A 4UI9B 2H0DB 2VJFB 4LKAA 1DVPA 1WEWA 3ZTGA 4R2YA 2MT5A 1WENA 2BAYA 3ZPVE 3IHPA 4R7EA 2K4DA 5FERA 3ZVYA 3C5KA 1HYIA 5C11A 1Z6UA
chains in the Genus database with same CATH superfamily
1WGMA 2KKXA 4NN2A 2CRWA 1WEOA 3PLWA 4N4FA 5AITA 3O35A 1WE9A 2MNZA 2RR4A 4Z0RA 3U5NA 1XWHA 4UP5A 3N9MA 1RMDA 3MHHA 4YBTA 2CT2A 1X4JA 3M7KA 1K2FA 2EGPA 3LDYA 2H0DA 1WEUA 2ZETC 2MA6A 4YBMA 5D1MB 4FO9A 2KWKA 2MA5A 3SOXA 2L75A 4H9DA 2VPBA 3LVRE 3I2DA 2VPGA 2MD8C 4A4CA 3FM8C 5B79A 2EGMA 2ECTA 2KWNA 2YUCA 5D1LB 2E61A 5EYAF 4TKPB 2YVRA 2LAUA 2LXPC 4BHWA 2ECIA 2P57A 4QF2A 3T7LA 3ZPV1 3ASLA 2OXQC 5AIUA 2KIZA 2MKEA 4QF3A 2YU4A 3U5OA 2M6MA 2CRRA 4X3GA 5B76A 1FP0A 2ECJA 3U5MA 4YBSA 3FAOA 2L43A 2MUMA 2KU3A 1X4IA 2NAAA 3EB6A 2YYRA 1F62A 3HCUA 4AYCA 3HCSA 4LJNA 2LV9A 2XOYA 4IC3A 5JG6A 5TBNA 4WZ3B 2XEUA 3ZNIA 3L11A 2F6NA 3DQVR 5H9MA 4WA6A 2QJ0A 2L7PA 2L0BA 2VPDA 5H1TA 1WIMA 2EXUA 1WEMA 4N3WA 2G6QA 1N87A 1ZBDB 4BBQA 5G0FA 3L1XA 3N9QA 2Y1NA 1WFKA 2Y43A 2Y1MA 2XOCA 3LQIA 4AYCB 2ECWA 3L1ZB 3SUBA 3RPGC 1CHCA 2QIZA 2M1RA 5G04B 2KE1A 5SVIB 4PTBA 2KWJA 3VK6A 2L5UA 1MM3A 5TABA 4YADA 2ECGA 4V3LC 4XI1A 3FL2A 5G05B 5K3QA 2YSJA 3LVQE 3O47A 4ZQLA 2XB1A 4R8PK 3C6WA 1JM7B 2VJFA 5TDRA 4PPEA 4Q6FA 3O33A 2JUNA 4ZUXU 2ECNA 4GNFA 2IDAA 4F52B 2UZGA 4LLBA 1U6GB 4Z0OA 4L7XA 1DCQA 2LXHC 4YAXA 2YHNA 1X4UA 2EA6A 3NG2A 2KKYA 5I3LA 5B8DA 2XOZA 5KH3A 1VFYA 3FJUB 3T6RA 2K17A 4LK9A 3GL6A 2KFTA 3O70A 4I7DA 4B86C 1FBVA 4GNDA 3KV6A 3ZYQA 4V3KC 2RI7A 5TDWA 2OWAA 3SOWA 3E2DA 2LGKA 3LRQA 2KGGA 5J3XA 2FD4A 1Z60A 5C13A 2KR4A 1LDJB 3N9OA 4AUQB 2CKLA 2VP7A 5TRBA 2LGLA 2LQ6A 1VD4A 2VPEA 2FUUA 2DJAA 5LKZA 4WZ2A 1JOCA 1HYJA 3N9LA 2LRIC 2K1JA 2G43A 2PNXA 4W4UA 2CONA 2XP0A 4CCGX 4C9ZA 3KQIA 2YURA 3T9KA 5H1VA 1WILA 2YHOA 1WEVA 2M85A 5H1UA 2YREA 3SHBA 1T1HA 2KREA 2RSDA 4GB0A 5DKAA 3DPLR 5FB0A 2LGVA 3N9PA 4ZDTA 5DINA 3DWDA 2LDRA 2VJEA 2JMIA 1WEEA 4MVTA 5FB1A 1MM2A 2MD7B 2CSVA 4UP0A 2F6JA 2JRJA 1VYXA 2KYUA 3RTRB 2VNFA 3O36A 3KNVA 5SVIA 2MIQA 2KGIA 4P5OB 3MHSA 2DX8A 4AP4A 3GV4A 4A49A 2CKLB 2QICA 3O37A 4OGEA 3QZVA 3LQHA 1BORA 5LCWB 5FEYA 3PHDA 2MNYA 2JM3A 2IQJA 3FANA 1LDKC 4A4BA 5SVYA 3V43A 4L58A 3HTKC 2JMDA 1G25A 2PUYA 3N9NA 2EODA 4S3OC 2FSAA 3M62A 3PUQA 2HDPA 4LADB 3LQJA 4QQ4A 1WEPA 3PURA 3M63A 3M99A 4OGCA 3LJUX 5LKUA 1MBMA 3MDBC 4FJCA 4I7CA 4WZ0A 4B7YC 2DSMA 2C2LA 2KWOA 5B78A 2M3HA 2LN0A 4AVXA 4YATA 4I7BA 2I50A 5LKTA 3DDTA 5KH9A 2D8UA 2G45A 3FEHA 2CSZA 1V87A 5B77A 2ECVA 2YT5A 5D1KB 1WEQA 1JM7A 2YSMA 1Z2QA 5LKXA 2VJEB 2E6SA 4A0CD 4GNEA 4O62A 2CSYA 3KDEC 3ZVZB 4YC9A 4CA1A 2K16A 5SVXA 3HCTA 2F42A 2LGGA 2D8SA 4FIPA 3RPGB 3KV5A 1WESA 2JMJA 2FUIA 5B75A 3Q1DA 2B0OE 2C2VS 2E6RA 3JUEA 4GNGA 5KH7A 2YQLA 4MSXA 4YABA 4FK5A 3U5PA 1IYMA 4O64A 1E4UA 3O34A 2AN6A 2YW8A 3O7AA 4S3OB 3SOUA 2HYED 4IC2A 3EB5A 2YQMA 4F1PA 2L80A 4UI9B 2H0DB 2VJFB 4LKAA 1DVPA 1WEWA 3ZTGA 4R2YA 2FFWA 3H7HA 2MT5A 1WENA 2BAYA 3ZPVE 3IHPA 4R7EA 2K4DA 5FERA 3ZVYA 3C5KA 1HYIA 5C11A 1Z6UA 2M13A
chains in the Genus database with same CATH topology
1WGMA 4NN2A 1WEOA 4N4FA 5AITA 3O35A 1WE9A 2MNZA 3U5NA 1XWHA 4UP5A 3N9MA 1RMDA 3MHHA 4YBTA 2CT2A 1X4JA 1K2FA 2EGPA 2H0DA 1WEUA 2ZETC 2MA6A 4YBMA 5D1MB 4FO9A 2KWKA 2MA5A 3SOXA 2L75A 2VPBA 3I2DA 2VPGA 2MD8C 4A4CA 5B79A 2ECTA 2KWNA 2YUCA 5D1LB 5EYAF 4TKPB 2LXPC 4BHWA 2ECIA 4QF2A 3T7LA 3ZPV1 3ASLA 2OXQC 5AIUA 2KIZA 4QF3A 2YU4A 3U5OA 2M6MA 4X3GA 5B76A 1FP0A 2ECJA 3U5MA 4YBSA 2L43A 2MUMA 2KU3A 1X4IA 2NAAA 3EB6A 2YYRA 1F62A 3HCUA 4AYCA 3HCSA 4LJNA 2LV9A 4IC3A 5JG6A 5TBNA 4WZ3B 2XEUA 3ZNIA 3L11A 2F6NA 3DQVR 5H9MA 4WA6A 2QJ0A 2L0BA 2VPDA 5H1TA 1WIMA 1WEMA 4N3WA 2G6QA 1N87A 1ZBDB 4BBQA 5G0FA 3L1XA 3N9QA 2Y1NA 1WFKA 2Y43A 2Y1MA 3LQIA 4AYCB 2ECWA 3L1ZB 3RPGC 1CHCA 2QIZA 2M1RA 5G04B 2KE1A 4PTBA 2KWJA 3VK6A 2L5UA 1MM3A 5TABA 4YADA 2ECGA 4V3LC 4XI1A 3FL2A 5G05B 2YSJA 4ZQLA 2XB1A 4R8PK 3C6WA 1JM7B 2VJFA 5TDRA 4PPEA 4Q6FA 3O33A 4ZUXU 2ECNA 4GNFA 2IDAA 4F52B 2UZGA 4LLBA 1U6GB 4L7XA 2LXHC 4YAXA 2YHNA 1X4UA 2EA6A 3NG2A 5I3LA 5B8DA 5KH3A 1VFYA 3T6RA 2K17A 4LK9A 3GL6A 2KFTA 3O70A 4I7DA 4B86C 1FBVA 4GNDA 3KV6A 3ZYQA 4V3KC 2RI7A 5TDWA 3SOWA 2LGKA 3LRQA 2KGGA 5J3XA 1Z60A 5C13A 2KR4A 1LDJB 3N9OA 4AUQB 2CKLA 2VP7A 5TRBA 2LGLA 2LQ6A 1VD4A 2VPEA 2FUUA 5LKZA 4WZ2A 1JOCA 1HYJA 3N9LA 2LRIC 2K1JA 2G43A 2PNXA 4W4UA 4CCGX 4C9ZA 3KQIA 2YURA 5H1VA 1WILA 2YHOA 1WEVA 2M85A 5H1UA 2YREA 3SHBA 1T1HA 2KREA 2RSDA 4GB0A 5DKAA 3DPLR 5FB0A 2LGVA 3N9PA 4ZDTA 5DINA 2LDRA 2VJEA 2JMIA 1WEEA 4MVTA 5FB1A 1MM2A 2MD7B 4UP0A 2F6JA 2JRJA 1VYXA 2KYUA 3RTRB 2VNFA 3O36A 3KNVA 2MIQA 2KGIA 3MHSA 4P5OB 4AP4A 2DX8A 3GV4A 4A49A 2CKLB 2QICA 3O37A 3QZVA 3LQHA 1BORA 5LCWB 5FEYA 3PHDA 2MNYA 1LDKC 4A4BA 3V43A 4L58A 3HTKC 2JMDA 1G25A 2PUYA 2EODA 3N9NA 4S3OC 2FSAA 3M62A 3PUQA 2HDPA 4LADB 3LQJA 1WEPA 3PURA 3M63A 3M99A 5LKUA 4FJCA 4I7CA 4WZ0A 4B7YC 2KWOA 2C2LA 5B78A 2M3HA 2LN0A 4AVXA 4YATA 4I7BA 2I50A 5LKTA 5KH9A 2G45A 2CSZA 1V87A 5B77A 2ECVA 2YT5A 5D1KB 1WEQA 1JM7A 2YSMA 1Z2QA 5LKXA 2VJEB 2E6SA 4A0CD 4GNEA 2CSYA 3ZVZB 4YC9A 4CA1A 2K16A 3HCTA 2F42A 2LGGA 2D8SA 4FIPA 3RPGB 3KV5A 1WESA 2JMJA 2FUIA 5B75A 2C2VS 2E6RA 4GNGA 5KH7A 2YQLA 4MSXA 4YABA 4FK5A 3U5PA 1IYMA 4O64A 1E4UA 3O34A 2AN6A 2YW8A 3SOUA 3O7AA 4S3OB 2HYED 4IC2A 3EB5A 2YQMA 2L80A 4UI9B 2H0DB 2VJFB 4LKAA 1DVPA 1WEWA 3ZTGA 4R2YA 2MT5A 1WENA 2BAYA 3ZPVE 3IHPA 4R7EA 2K4DA 5FERA 3ZVYA 3C5KA 1HYIA 5C11A 1Z6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGM A;  4NN2 A;  1WEO A;  4N4F A;  5AIT A;  3O35 A;  1WE9 A;  2MNZ A;  3U5N A;  1XWH A;  4UP5 A;  3N9M A;  1RMD A;  3MHH A;  4YBT A;  2CT2 A;  1X4J A;  1K2F A;  2EGP A;  2H0D A;  1WEU A;  2ZET C;  2MA6 A;  4YBM A;  5D1M B;  4FO9 A;  2KWK A;  2MA5 A;  3SOX A;  2L75 A;  2VPB A;  3I2D A;  2VPG A;  2MD8 C;  4A4C A;  5B79 A;  2ECT A;  2KWN A;  2YUC A;  5D1L B;  5EYA F;  4TKP B;  2LXP C;  4BHW A;  2ECI A;  4QF2 A;  3T7L A;  3ZPV 1;  3ASL A;  2OXQ C;  5AIU A;  2KIZ A;  4QF3 A;  2YU4 A;  3U5O A;  2M6M A;  4X3G A;  5B76 A;  1FP0 A;  2ECJ A;  3U5M A;  4YBS A;  2L43 A;  2MUM A;  2KU3 A;  1X4I A;  2NAA A;  3EB6 A;  2YYR A;  1F62 A;  3HCU A;  4AYC A;  3HCS A;  4LJN A;  2LV9 A;  4IC3 A;  5JG6 A;  5TBN A;  4WZ3 B;  2XEU A;  3ZNI A;  3L11 A;  2F6N A;  3DQV R;  5H9M A;  4WA6 A;  2QJ0 A;  2L0B A;  2VPD A;  5H1T A;  1WIM A;  1WEM A;  4N3W A;  2G6Q A;  1N87 A;  1ZBD B;  4BBQ A;  5G0F A;  3L1X A;  3N9Q A;  2Y1N A;  1WFK A;  2Y43 A;  2Y1M A;  3LQI A;  4AYC B;  2ECW A;  3L1Z B;  3RPG C;  1CHC A;  2QIZ A;  2M1R A;  5G04 B;  2KE1 A;  4PTB A;  2KWJ A;  3VK6 A;  2L5U A;  1MM3 A;  5TAB A;  4YAD A;  2ECG A;  4V3L C;  4XI1 A;  3FL2 A;  5G05 B;  2YSJ A;  4ZQL A;  2XB1 A;  4R8P K;  3C6W A;  1JM7 B;  2VJF A;  5TDR A;  4PPE A;  4Q6F A;  3O33 A;  4ZUX U;  2ECN A;  4GNF A;  2IDA A;  4F52 B;  2UZG A;  4LLB A;  1U6G B;  4L7X A;  2LXH C;  4YAX A;  2YHN A;  1X4U A;  2EA6 A;  3NG2 A;  5I3L A;  5B8D A;  5KH3 A;  1VFY A;  3T6R A;  2K17 A;  4LK9 A;  3GL6 A;  2KFT A;  3O70 A;  4I7D A;  4B86 C;  1FBV A;  4GND A;  3KV6 A;  3ZYQ A;  4V3K C;  2RI7 A;  5TDW A;  3SOW A;  2LGK A;  3LRQ A;  2KGG A;  5J3X A;  1Z60 A;  5C13 A;  2KR4 A;  1LDJ B;  3N9O A;  4AUQ B;  2CKL A;  2VP7 A;  5TRB A;  2LGL A;  2LQ6 A;  1VD4 A;  2VPE A;  2FUU A;  5LKZ A;  4WZ2 A;  1JOC A;  1HYJ A;  3N9L A;  2LRI C;  2K1J A;  2G43 A;  2PNX A;  4W4U A;  4CCG X;  4C9Z A;  3KQI A;  2YUR A;  5H1V A;  1WIL A;  2YHO A;  1WEV A;  2M85 A;  5H1U A;  2YRE A;  3SHB A;  1T1H A;  2KRE A;  2RSD A;  4GB0 A;  5DKA A;  3DPL R;  5FB0 A;  2LGV A;  3N9P A;  4ZDT A;  5DIN A;  2LDR A;  2VJE A;  2JMI A;  1WEE A;  4MVT A;  5FB1 A;  1MM2 A;  2MD7 B;  4UP0 A;  2F6J A;  2JRJ A;  1VYX A;  2KYU A;  3RTR B;  2VNF A;  3O36 A;  3KNV A;  2MIQ A;  2KGI A;  3MHS A;  4P5O B;  4AP4 A;  2DX8 A;  3GV4 A;  4A49 A;  2CKL B;  2QIC A;  3O37 A;  3QZV A;  3LQH A;  1BOR A;  5LCW B;  5FEY A;  3PHD A;  2MNY A;  1LDK C;  4A4B A;  3V43 A;  4L58 A;  3HTK C;  2JMD A;  1G25 A;  2PUY A;  2EOD A;  3N9N A;  4S3O C;  2FSA A;  3M62 A;  3PUQ A;  2HDP A;  4LAD B;  3LQJ A;  1WEP A;  3PUR A;  3M63 A;  3M99 A;  5LKU A;  4FJC A;  4I7C A;  4WZ0 A;  4B7Y C;  2KWO A;  2C2L A;  5B78 A;  2M3H A;  2LN0 A;  4AVX A;  4YAT A;  4I7B A;  2I50 A;  5LKT A;  5KH9 A;  2G45 A;  2CSZ A;  1V87 A;  5B77 A;  2ECV A;  2YT5 A;  5D1K B;  1WEQ A;  1JM7 A;  2YSM A;  1Z2Q A;  5LKX A;  2VJE B;  2E6S A;  4A0C D;  4GNE A;  2CSY A;  3ZVZ B;  4YC9 A;  4CA1 A;  2K16 A;  3HCT A;  2F42 A;  2LGG A;  2D8S A;  4FIP A;  3RPG B;  3KV5 A;  1WES A;  2JMJ A;  2FUI A;  5B75 A;  2C2V S;  2E6R A;  4GNG A;  5KH7 A;  2YQL A;  4MSX A;  4YAB A;  4FK5 A;  3U5P A;  1IYM A;  4O64 A;  1E4U A;  3O34 A;  2AN6 A;  2YW8 A;  3SOU A;  3O7A A;  4S3O B;  2HYE D;  4IC2 A;  3EB5 A;  2YQM A;  2L80 A;  4UI9 B;  2H0D B;  2VJF B;  4LKA A;  1DVP A;  1WEW A;  3ZTG A;  4R2Y A;  2MT5 A;  1WEN A;  2BAY A;  3ZPV E;  3IHP A;  4R7E A;  2K4D A;  5FER A;  3ZVY A;  3C5K A;  1HYI A;  5C11 A;  1Z6U A; 
#chains in the Genus database with same CATH topology
 1WGM A;  2KKX A;  4NN2 A;  2CRW A;  1WEO A;  3PLW A;  4N4F A;  5AIT A;  3O35 A;  1WE9 A;  2MNZ A;  2RR4 A;  4Z0R A;  3U5N A;  1XWH A;  4UP5 A;  3N9M A;  1RMD A;  3MHH A;  4YBT A;  2CT2 A;  1X4J A;  3M7K A;  1K2F A;  2EGP A;  3LDY A;  2H0D A;  1WEU A;  2ZET C;  2MA6 A;  4YBM A;  5D1M B;  4FO9 A;  2KWK A;  2MA5 A;  3SOX A;  2L75 A;  4H9D A;  2VPB A;  3LVR E;  3I2D A;  2VPG A;  2MD8 C;  4A4C A;  3FM8 C;  5B79 A;  2EGM A;  2ECT A;  2KWN A;  2YUC A;  5D1L B;  2E61 A;  5EYA F;  4TKP B;  2YVR A;  2LAU A;  2LXP C;  4BHW A;  2ECI A;  2P57 A;  4QF2 A;  3T7L A;  3ZPV 1;  3ASL A;  2OXQ C;  5AIU A;  2KIZ A;  2MKE A;  4QF3 A;  2YU4 A;  3U5O A;  2M6M A;  2CRR A;  4X3G A;  5B76 A;  1FP0 A;  2ECJ A;  3U5M A;  4YBS A;  3FAO A;  2L43 A;  2MUM A;  2KU3 A;  1X4I A;  2NAA A;  3EB6 A;  2YYR A;  1F62 A;  3HCU A;  4AYC A;  3HCS A;  4LJN A;  2LV9 A;  2XOY A;  4IC3 A;  5JG6 A;  5TBN A;  4WZ3 B;  2XEU A;  3ZNI A;  3L11 A;  2F6N A;  3DQV R;  5H9M A;  4WA6 A;  2QJ0 A;  2L7P A;  2L0B A;  2VPD A;  5H1T A;  1WIM A;  2EXU A;  1WEM A;  4N3W A;  2G6Q A;  1N87 A;  1ZBD B;  4BBQ A;  5G0F A;  3L1X A;  3N9Q A;  2Y1N A;  1WFK A;  2Y43 A;  2Y1M A;  2XOC A;  3LQI A;  4AYC B;  2ECW A;  3L1Z B;  3SUB A;  3RPG C;  1CHC A;  2QIZ A;  2M1R A;  5G04 B;  2KE1 A;  5SVI B;  4PTB A;  2KWJ A;  3VK6 A;  2L5U A;  1MM3 A;  5TAB A;  4YAD A;  2ECG A;  4V3L C;  4XI1 A;  3FL2 A;  5G05 B;  5K3Q A;  2YSJ A;  3LVQ E;  3O47 A;  4ZQL A;  2XB1 A;  4R8P K;  3C6W A;  1JM7 B;  2VJF A;  5TDR A;  4PPE A;  4Q6F A;  3O33 A;  2JUN A;  4ZUX U;  2ECN A;  4GNF A;  2IDA A;  4F52 B;  2UZG A;  4LLB A;  1U6G B;  4Z0O A;  4L7X A;  1DCQ A;  2LXH C;  4YAX A;  2YHN A;  1X4U A;  2EA6 A;  3NG2 A;  2KKY A;  5I3L A;  5B8D A;  2XOZ A;  5KH3 A;  1VFY A;  3FJU B;  3T6R A;  2K17 A;  4LK9 A;  3GL6 A;  2KFT A;  3O70 A;  4I7D A;  4B86 C;  1FBV A;  4GND A;  3KV6 A;  3ZYQ A;  4V3K C;  2RI7 A;  5TDW A;  2OWA A;  3SOW A;  3E2D A;  2LGK A;  3LRQ A;  2KGG A;  5J3X A;  2FD4 A;  1Z60 A;  5C13 A;  2KR4 A;  1LDJ B;  3N9O A;  4AUQ B;  2CKL A;  2VP7 A;  5TRB A;  2LGL A;  2LQ6 A;  1VD4 A;  2VPE A;  2FUU A;  2DJA A;  5LKZ A;  4WZ2 A;  1JOC A;  1HYJ A;  3N9L A;  2LRI C;  2K1J A;  2G43 A;  2PNX A;  4W4U A;  2CON A;  2XP0 A;  4CCG X;  4C9Z A;  3KQI A;  2YUR A;  3T9K A;  5H1V A;  1WIL A;  2YHO A;  1WEV A;  2M85 A;  5H1U A;  2YRE A;  3SHB A;  1T1H A;  2KRE A;  2RSD A;  4GB0 A;  5DKA A;  3DPL R;  5FB0 A;  2LGV A;  3N9P A;  4ZDT A;  5DIN A;  3DWD A;  2LDR A;  2VJE A;  2JMI A;  1WEE A;  4MVT A;  5FB1 A;  1MM2 A;  2MD7 B;  2CSV A;  4UP0 A;  2F6J A;  2JRJ A;  1VYX A;  2KYU A;  3RTR B;  2VNF A;  3O36 A;  3KNV A;  5SVI A;  2MIQ A;  2KGI A;  4P5O B;  3MHS A;  2DX8 A;  4AP4 A;  3GV4 A;  4A49 A;  2CKL B;  2QIC A;  3O37 A;  4OGE A;  3QZV A;  3LQH A;  1BOR A;  5LCW B;  5FEY A;  3PHD A;  2MNY A;  2JM3 A;  2IQJ A;  3FAN A;  1LDK C;  4A4B A;  5SVY A;  3V43 A;  4L58 A;  3HTK C;  2JMD A;  1G25 A;  2PUY A;  3N9N A;  2EOD A;  4S3O C;  2FSA A;  3M62 A;  3PUQ A;  2HDP A;  4LAD B;  3LQJ A;  4QQ4 A;  1WEP A;  3PUR A;  3M63 A;  3M99 A;  4OGC A;  3LJU X;  5LKU A;  1MBM A;  3MDB C;  4FJC A;  4I7C A;  4WZ0 A;  4B7Y C;  2DSM A;  2C2L A;  2KWO A;  5B78 A;  2M3H A;  2LN0 A;  4AVX A;  4YAT A;  4I7B A;  2I50 A;  5LKT A;  3DDT A;  5KH9 A;  2D8U A;  2G45 A;  3FEH A;  2CSZ A;  1V87 A;  5B77 A;  2ECV A;  2YT5 A;  5D1K B;  1WEQ A;  1JM7 A;  2YSM A;  1Z2Q A;  5LKX A;  2VJE B;  2E6S A;  4A0C D;  4GNE A;  4O62 A;  2CSY A;  3KDE C;  3ZVZ B;  4YC9 A;  4CA1 A;  2K16 A;  5SVX A;  3HCT A;  2F42 A;  2LGG A;  2D8S A;  4FIP A;  3RPG B;  3KV5 A;  1WES A;  2JMJ A;  2FUI A;  5B75 A;  3Q1D A;  2B0O E;  2C2V S;  2E6R A;  3JUE A;  4GNG A;  5KH7 A;  2YQL A;  4MSX A;  4YAB A;  4FK5 A;  3U5P A;  1IYM A;  4O64 A;  1E4U A;  3O34 A;  2AN6 A;  2YW8 A;  3O7A A;  4S3O B;  3SOU A;  2HYE D;  4IC2 A;  3EB5 A;  2YQM A;  4F1P A;  2L80 A;  4UI9 B;  2H0D B;  2VJF B;  4LKA A;  1DVP A;  1WEW A;  3ZTG A;  4R2Y A;  2FFW A;  3H7H A;  2MT5 A;  1WEN A;  2BAY A;  3ZPV E;  3IHP A;  4R7E A;  2K4D A;  5FER A;  3ZVY A;  3C5K A;  1HYI A;  5C11 A;  1Z6U A;  2M13 A; 
#chains in the Genus database with same CATH homology
 1WGM A;  4NN2 A;  1WEO A;  4N4F A;  5AIT A;  3O35 A;  1WE9 A;  2MNZ A;  3U5N A;  1XWH A;  4UP5 A;  3N9M A;  1RMD A;  3MHH A;  4YBT A;  2CT2 A;  1X4J A;  1K2F A;  2EGP A;  2H0D A;  1WEU A;  2ZET C;  2MA6 A;  4YBM A;  5D1M B;  4FO9 A;  2KWK A;  2MA5 A;  3SOX A;  2L75 A;  2VPB A;  3I2D A;  2VPG A;  2MD8 C;  4A4C A;  5B79 A;  2ECT A;  2KWN A;  2YUC A;  5D1L B;  5EYA F;  4TKP B;  2LXP C;  4BHW A;  2ECI A;  4QF2 A;  3T7L A;  3ZPV 1;  3ASL A;  2OXQ C;  5AIU A;  2KIZ A;  4QF3 A;  2YU4 A;  3U5O A;  2M6M A;  4X3G A;  5B76 A;  1FP0 A;  2ECJ A;  3U5M A;  4YBS A;  2L43 A;  2MUM A;  2KU3 A;  1X4I A;  2NAA A;  3EB6 A;  2YYR A;  1F62 A;  3HCU A;  4AYC A;  3HCS A;  4LJN A;  2LV9 A;  4IC3 A;  5JG6 A;  5TBN A;  4WZ3 B;  2XEU A;  3ZNI A;  3L11 A;  2F6N A;  3DQV R;  5H9M A;  4WA6 A;  2QJ0 A;  2L0B A;  2VPD A;  5H1T A;  1WIM A;  1WEM A;  4N3W A;  2G6Q A;  1N87 A;  1ZBD B;  4BBQ A;  5G0F A;  3L1X A;  3N9Q A;  2Y1N A;  1WFK A;  2Y43 A;  2Y1M A;  3LQI A;  4AYC B;  2ECW A;  3L1Z B;  3RPG C;  1CHC A;  2QIZ A;  2M1R A;  5G04 B;  2KE1 A;  4PTB A;  2KWJ A;  3VK6 A;  2L5U A;  1MM3 A;  5TAB A;  4YAD A;  2ECG A;  4V3L C;  4XI1 A;  3FL2 A;  5G05 B;  2YSJ A;  4ZQL A;  2XB1 A;  4R8P K;  3C6W A;  1JM7 B;  2VJF A;  5TDR A;  4PPE A;  4Q6F A;  3O33 A;  4ZUX U;  2ECN A;  4GNF A;  2IDA A;  4F52 B;  2UZG A;  4LLB A;  1U6G B;  4L7X A;  2LXH C;  4YAX A;  2YHN A;  1X4U A;  2EA6 A;  3NG2 A;  5I3L A;  5B8D A;  5KH3 A;  1VFY A;  3T6R A;  2K17 A;  4LK9 A;  3GL6 A;  2KFT A;  3O70 A;  4I7D A;  4B86 C;  1FBV A;  4GND A;  3KV6 A;  3ZYQ A;  4V3K C;  2RI7 A;  5TDW A;  3SOW A;  2LGK A;  3LRQ A;  2KGG A;  5J3X A;  1Z60 A;  5C13 A;  2KR4 A;  1LDJ B;  3N9O A;  4AUQ B;  2CKL A;  2VP7 A;  5TRB A;  2LGL A;  2LQ6 A;  1VD4 A;  2VPE A;  2FUU A;  5LKZ A;  4WZ2 A;  1JOC A;  1HYJ A;  3N9L A;  2LRI C;  2K1J A;  2G43 A;  2PNX A;  4W4U A;  4CCG X;  4C9Z A;  3KQI A;  2YUR A;  5H1V A;  1WIL A;  2YHO A;  1WEV A;  2M85 A;  5H1U A;  2YRE A;  3SHB A;  1T1H A;  2KRE A;  2RSD A;  4GB0 A;  5DKA A;  3DPL R;  5FB0 A;  2LGV A;  3N9P A;  4ZDT A;  5DIN A;  2LDR A;  2VJE A;  2JMI A;  1WEE A;  4MVT A;  5FB1 A;  1MM2 A;  2MD7 B;  4UP0 A;  2F6J A;  2JRJ A;  1VYX A;  2KYU A;  3RTR B;  2VNF A;  3O36 A;  3KNV A;  2MIQ A;  2KGI A;  3MHS A;  4P5O B;  4AP4 A;  2DX8 A;  3GV4 A;  4A49 A;  2CKL B;  2QIC A;  3O37 A;  3QZV A;  3LQH A;  1BOR A;  5LCW B;  5FEY A;  3PHD A;  2MNY A;  1LDK C;  4A4B A;  3V43 A;  4L58 A;  3HTK C;  2JMD A;  1G25 A;  2PUY A;  2EOD A;  3N9N A;  4S3O C;  2FSA A;  3M62 A;  3PUQ A;  2HDP A;  4LAD B;  3LQJ A;  1WEP A;  3PUR A;  3M63 A;  3M99 A;  5LKU A;  4FJC A;  4I7C A;  4WZ0 A;  4B7Y C;  2KWO A;  2C2L A;  5B78 A;  2M3H A;  2LN0 A;  4AVX A;  4YAT A;  4I7B A;  2I50 A;  5LKT A;  5KH9 A;  2G45 A;  2CSZ A;  1V87 A;  5B77 A;  2ECV A;  2YT5 A;  5D1K B;  1WEQ A;  1JM7 A;  2YSM A;  1Z2Q A;  5LKX A;  2VJE B;  2E6S A;  4A0C D;  4GNE A;  2CSY A;  3ZVZ B;  4YC9 A;  4CA1 A;  2K16 A;  3HCT A;  2F42 A;  2LGG A;  2D8S A;  4FIP A;  3RPG B;  3KV5 A;  1WES A;  2JMJ A;  2FUI A;  5B75 A;  2C2V S;  2E6R A;  4GNG A;  5KH7 A;  2YQL A;  4MSX A;  4YAB A;  4FK5 A;  3U5P A;  1IYM A;  4O64 A;  1E4U A;  3O34 A;  2AN6 A;  2YW8 A;  3SOU A;  3O7A A;  4S3O B;  2HYE D;  4IC2 A;  3EB5 A;  2YQM A;  2L80 A;  4UI9 B;  2H0D B;  2VJF B;  4LKA A;  1DVP A;  1WEW A;  3ZTG A;  4R2Y A;  2MT5 A;  1WEN A;  2BAY A;  3ZPV E;  3IHP A;  4R7E A;  2K4D A;  5FER A;  3ZVY A;  3C5K A;  1HYI A;  5C11 A;  1Z6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...