3L1ZB

Crystal structure of the u-box domain of human e4b ubiquitin ligase in complex with ubch5c e2 ubiquitin conjugating enzyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
IDYSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVPELKEQIQAWMREKQNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 D3
publication title Molecular Basis for the Association of Human E4B U Box Ubiquitin Ligase with E2-Conjugating Enzymes UbcH5c and Ubc4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 16
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04564 U-box U-box domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l1zB01
3HCUA 3O35A 3VK6A 2LV9A 3V43A 5DKAA 5AITA 3C6WA 5H1UA 2YU4A 4UP5A 3KV6A 2AN6A 4WZ2A 2M1RA 2VNFA 5TDWA 2MA6A 5DINA 4PTBA 4IC3A 2E6RA 3C5KA 2YT5A 2KIZA 2OXQC 3LQJA 3ZPVE 5G05B 4ZQLA 5B77A 1JM7A 4L58A 4X3GA 1WEUA 2JRJA 2Y43A 2MUMA 2PUYA 3RPGB 2ECGA 3ZVZB 5B76A 2YQMA 2KFTA 5EYAF 5I3LA 4V3KC 5TRBA 1VFYA 2LGVA 1FBVA 1XWHA 4I7DA 5H9MA 4N3WA 4CCGX 2K16A 4MVTA 4S3OC 2RSDA 2G45A 3N9PA 3SHBA 1Z60A 4WZ0A 2YHNA 3SOUA 2YSJA 4C9ZA 1VYXA 2MIQA 1HYJA 4F52B 3QZVA 5LCWB 2BAYA 2VJFA 2YYRA 4WA6A 3T6RA 3N9QA 4I7BA 4IC2A 2D8SA 3GV4A 2XB1A 3O70A 4WZ3B 5FB0A 2CT2A 1K2FA 4NN2A 2C2LA 2XEUA 2LXPC 3O33A 1WEEA 4ZDTA 5B8DA 3SOXA 1U6GB 3U5PA 2MD7B 1LDJB 5B75A 2LQ6A 3NG2A 3M99A 3LQHA 3N9NA 2L5UA 1JOCA 2EGPA 2VP7A 4O64A 2YHOA 2LGGA 2L75A 1Z2QA 2F42A 5J3XA 3RPGC 2K4DA 1WILA 2MNZA 2G43A 4Q6FA 3U5OA 2FUUA 4QF2A 5KH3A 1WEVA 5B78A 4GNGA 4B7YC 4A49A 5TBNA 2H0DB 5H1VA 2ECIA 1WFKA 1E4UA 2LRIC 1WE9A 3L1XA 2JMDA 4LK9A 5TABA 2IDAA 5JG6A 1BORA 1IYMA 4A4BA 3ZYQA 3MHHA 5C11A 5LKTA 1MM3A 2PNXA 4YABA 4LJNA 3SOWA 2ECVA 4XI1A 4YBSA 4LLBA 3U5MA 4YATA 5G0FA 5FB1A 1V87A 3ZPV1 1FP0A 2CKLB 1JM7B 3EB5A 3ZTGA 4L7XA 1WEMA 2FUIA 4FIPA 3N9MA 2KWNA 4A4CA 2MNYA 1WENA 5G04B 1WEQA 3T7LA 3HCSA 2UZGA 2KE1A 2M3HA 2ECJA 4AUQB 1F62A 4R8PK 1ZBDB 3O34A 2YQLA 1G25A 2LGLA 2HDPA 4YADA 4B86C 2KWOA 2LXHC 2ZETC 5D1LB 2MD8C 3O37A 2QICA 5KH9A 2G6QA 1X4JA 3KNVA 2VJFB 4AYCB 4PPEA 5KH7A 4N4FA 2L80A 4BBQA 3M63A 3O7AA 5TDRA 2QJ0A 2YURA 4YBTA 3L1ZB 4TKPB 4I7CA 2M85A 3L11A 1WESA 3RTRB 5LKZA 5C13A 2KWKA 2YUCA 2ECNA 4GNEA 3HCTA 3ZVYA 2Y1NA 1DVPA 1WGMA 3LRQA 2I50A 1Z6UA 1VD4A 2H0DA 1LDKC 2RI7A 2VJEB 3GL6A 4AP4A 2CSYA 4LKAA 2K17A 4BHWA 3PUQA 2MA5A 2VPEA 4FJCA 4LADB 4CA1A 2QIZA 2YREA 2KGIA 2LN0A 4ZUXU 4GNFA 2K1JA 3O36A 2ECTA 4R2YA 2C2VS 3ASLA 4MSXA 2M6MA 5AIUA 4UI9B 4YAXA 3KQIA 1WEWA 3HTKC 1MM2A 1HYIA 2L0BA 4GNDA 2CKLA 3MHSA 4YBMA 3U5NA 2F6JA 3DQVR 1CHCA 2Y1MA 5LKXA 2KYUA 2EODA 2L43A 2E6SA 2F6NA 2EA6A 2LGKA 4YC9A 2VPGA 3ZNIA 1N87A 3N9LA 1WIMA 1RMDA 3N9OA 2CSZA 3LQIA 2ECWA 2HYED 2LDRA 2MT5A 3KV5A 2JMJA 4AVXA 1X4UA 2KWJA 2YW8A 2KGGA 2KREA 2DX8A 1WEPA 2VPBA 4AYCA 1WEOA 4GB0A 2NAAA 3IHPA 4P5OB 4A0CD 1T1HA 2VPDA 4UP0A 2YSMA 5FEYA 3M62A 5D1MB 4FK5A 5H1TA 3EB6A 2KR4A 3FL2A 4S3OB 5FERA 4FO9A 2KU3A 5LKUA 5B79A 3PHDA 2FSAA 3I2DA 4R7EA 3PURA 5D1KB 1X4IA 4QF3A 2JMIA 2VJEA 4W4UA 3DPLR 4V3LC
chains in the Genus database with same CATH superfamily
3HCUA 3O35A 3VK6A 2LV9A 3V43A 5DKAA 5AITA 3C6WA 5H1UA 2YU4A 2LAUA 4UP5A 3KV6A 2AN6A 4WZ2A 2M1RA 2VNFA 5TDWA 2MA6A 5DINA 4PTBA 2FD4A 4IC3A 2E6RA 3C5KA 2YT5A 2KIZA 5SVXA 2OXQC 3LQJA 3ZPVE 5G05B 4ZQLA 3M7KA 5B77A 4O62A 1JM7A 4L58A 4X3GA 1WEUA 2JRJA 2Y43A 2MUMA 2PUYA 3RPGB 2ECGA 3ZVZB 3E2DA 5B76A 2YQMA 2KFTA 5EYAF 5I3LA 2KKYA 4V3KC 5TRBA 1VFYA 2LGVA 1FBVA 1XWHA 4I7DA 5H9MA 4N3WA 4CCGX 2K16A 4MVTA 4S3OC 2RSDA 2G45A 2OWAA 3N9PA 3SHBA 1Z60A 4WZ0A 2YHNA 3SOUA 2YSJA 4C9ZA 1VYXA 2MIQA 1HYJA 4F52B 3QZVA 5LCWB 2BAYA 2VJFA 2YYRA 4WA6A 3T6RA 3N9QA 4I7BA 4IC2A 2D8SA 3GV4A 2XB1A 3O70A 4WZ3B 3LDYA 5FB0A 2CT2A 1K2FA 2XOCA 3JUEA 4NN2A 2C2LA 2XEUA 2LXPC 3O33A 1WEEA 4ZDTA 3FJUB 3SOXA 5B8DA 2CRWA 1U6GB 3U5PA 2MD7B 1LDJB 5B75A 2LQ6A 2XOZA 3NG2A 3M99A 4OGEA 3LQHA 3N9NA 2L5UA 1JOCA 2EGPA 2VP7A 4O64A 2YHOA 2LGGA 2L75A 2CONA 2CRRA 1Z2QA 2CSVA 2F42A 5J3XA 3RPGC 2K4DA 1WILA 2MNZA 2G43A 4Q6FA 3U5OA 2FUUA 4QF2A 3LJUX 5KH3A 1WEVA 5B78A 4GNGA 4B7YC 3DWDA 4A49A 5TBNA 2H0DB 5H1VA 2ECIA 1WFKA 1E4UA 2LRIC 1WE9A 3L1XA 2JMDA 4LK9A 5TABA 2IDAA 5JG6A 1BORA 1IYMA 4A4BA 3T9KA 3ZYQA 3MHHA 5C11A 5LKTA 1DCQA 1MM3A 2PNXA 4YABA 3MDBC 4LJNA 3SOWA 2ECVA 4XI1A 2XP0A 4YBSA 4LLBA 3U5MA 4YATA 3KDEC 3FAOA 2FFWA 3H7HA 5K3QA 4Z0RA 5G0FA 5FB1A 1V87A 3ZPV1 1FP0A 2CKLB 1JM7B 3EB5A 3ZTGA 4L7XA 1WEMA 2MKEA 2L7PA 4H9DA 2FUIA 4FIPA 3N9MA 2KWNA 3O47A 4A4CA 2MNYA 1WENA 5G04B 4Z0OA 1WEQA 3T7LA 3HCSA 2UZGA 2KE1A 2M3HA 3Q1DA 2ECJA 4AUQB 1F62A 4R8PK 1ZBDB 3O34A 2YQLA 2RR4A 1G25A 2LGLA 2HDPA 4YADA 5SVIA 4B86C 2KWOA 2LXHC 2ZETC 5D1LB 2MD8C 3O37A 2QICA 5KH9A 2G6QA 1X4JA 3KNVA 2VJFB 4AYCB 4PPEA 5KH7A 4N4FA 2L80A 4BBQA 3M63A 2B0OE 2E61A 3O7AA 5TDRA 2QJ0A 2YURA 4YBTA 3L1ZB 4TKPB 4I7CA 2M85A 3L11A 1WESA 3FANA 3RTRB 5LKZA 5C13A 2KWKA 2YUCA 2ECNA 4QQ4A 4GNEA 3HCTA 3ZVYA 2Y1NA 1DVPA 1WGMA 3LRQA 2I50A 1Z6UA 1VD4A 4OGCA 1LDKC 2H0DA 5SVYA 2RI7A 2VJEB 3GL6A 2IQJA 4AP4A 2CSYA 4LKAA 2K17A 4BHWA 3PUQA 2MA5A 2VPEA 4FJCA 4LADB 3SUBA 4CA1A 2M13A 2QIZA 2YREA 2KGIA 2LN0A 4ZUXU 4GNFA 2K1JA 3O36A 2ECTA 4R2YA 2C2VS 3ASLA 4MSXA 2YVRA 2M6MA 5AIUA 4UI9B 3LVRE 4YAXA 3KQIA 1WEWA 3HTKC 3FM8C 1MM2A 1HYIA 2L0BA 4GNDA 2CKLA 3MHSA 4YBMA 3U5NA 2F6JA 2JUNA 3DQVR 1CHCA 2D8UA 2Y1MA 4F1PA 5LKXA 2KYUA 2EODA 2L43A 2E6SA 2F6NA 2EA6A 2LGKA 4YC9A 2VPGA 2DSMA 3ZNIA 1N87A 3N9LA 1WIMA 1RMDA 3N9OA 2CSZA 3LQIA 2ECWA 2HYED 2LDRA 2MT5A 2JM3A 3KV5A 2JMJA 4AVXA 1X4UA 2KWJA 2YW8A 2XOYA 2KGGA 2KREA 2DX8A 3FEHA 1WEPA 2VPBA 3LVQE 4AYCA 1WEOA 4GB0A 2NAAA 3IHPA 4P5OB 4A0CD 2P57A 1T1HA 2VPDA 4UP0A 3PLWA 2YSMA 5FEYA 3M62A 5D1MB 4FK5A 5H1TA 2EGMA 3EB6A 2KR4A 2DJAA 3FL2A 2KKXA 4S3OB 5FERA 2EXUA 4FO9A 3DDTA 2KU3A 1MBMA 5SVIB 5LKUA 5B79A 3PHDA 2FSAA 3I2DA 4R7EA 3PURA 5D1KB 1X4IA 4QF3A 2JMIA 2VJEA 4W4UA 3DPLR 4V3LC
chains in the Genus database with same CATH topology
3HCUA 3O35A 3VK6A 2LV9A 3V43A 5DKAA 5AITA 3C6WA 5H1UA 2YU4A 4UP5A 3KV6A 2AN6A 4WZ2A 2M1RA 2VNFA 5TDWA 2MA6A 5DINA 4PTBA 4IC3A 2E6RA 3C5KA 2YT5A 2KIZA 2OXQC 3LQJA 3ZPVE 5G05B 4ZQLA 5B77A 1JM7A 4L58A 4X3GA 1WEUA 2JRJA 2Y43A 2MUMA 2PUYA 3RPGB 2ECGA 3ZVZB 5B76A 2YQMA 2KFTA 5EYAF 5I3LA 4V3KC 5TRBA 1VFYA 2LGVA 1FBVA 1XWHA 4I7DA 5H9MA 4N3WA 4CCGX 2K16A 4MVTA 4S3OC 2RSDA 2G45A 3N9PA 3SHBA 1Z60A 4WZ0A 2YHNA 3SOUA 2YSJA 4C9ZA 1VYXA 2MIQA 1HYJA 4F52B 3QZVA 5LCWB 2BAYA 2VJFA 2YYRA 4WA6A 3T6RA 3N9QA 4I7BA 4IC2A 2D8SA 3GV4A 2XB1A 3O70A 4WZ3B 5FB0A 2CT2A 1K2FA 4NN2A 2C2LA 2XEUA 2LXPC 3O33A 1WEEA 4ZDTA 5B8DA 3SOXA 1U6GB 3U5PA 2MD7B 1LDJB 5B75A 2LQ6A 3NG2A 3M99A 3LQHA 3N9NA 2L5UA 1JOCA 2EGPA 2VP7A 4O64A 2YHOA 2LGGA 2L75A 1Z2QA 2F42A 5J3XA 3RPGC 2K4DA 1WILA 2MNZA 2G43A 4Q6FA 3U5OA 2FUUA 4QF2A 5KH3A 1WEVA 5B78A 4GNGA 4B7YC 4A49A 5TBNA 2H0DB 5H1VA 2ECIA 1WFKA 1E4UA 2LRIC 1WE9A 3L1XA 2JMDA 4LK9A 5TABA 2IDAA 5JG6A 1BORA 1IYMA 4A4BA 3ZYQA 3MHHA 5C11A 5LKTA 1MM3A 2PNXA 4YABA 4LJNA 3SOWA 2ECVA 4XI1A 4YBSA 4LLBA 3U5MA 4YATA 5G0FA 5FB1A 1V87A 3ZPV1 1FP0A 2CKLB 1JM7B 3EB5A 3ZTGA 4L7XA 1WEMA 2FUIA 4FIPA 3N9MA 2KWNA 4A4CA 2MNYA 1WENA 5G04B 1WEQA 3T7LA 3HCSA 2UZGA 2KE1A 2M3HA 2ECJA 4AUQB 1F62A 4R8PK 1ZBDB 3O34A 2YQLA 1G25A 2LGLA 2HDPA 4YADA 4B86C 2KWOA 2LXHC 2ZETC 5D1LB 2MD8C 3O37A 2QICA 5KH9A 2G6QA 1X4JA 3KNVA 2VJFB 4AYCB 4PPEA 5KH7A 4N4FA 2L80A 4BBQA 3M63A 3O7AA 5TDRA 2QJ0A 2YURA 4YBTA 3L1ZB 4TKPB 4I7CA 2M85A 3L11A 1WESA 3RTRB 5LKZA 5C13A 2KWKA 2YUCA 2ECNA 4GNEA 3HCTA 3ZVYA 2Y1NA 1DVPA 1WGMA 3LRQA 2I50A 1Z6UA 1VD4A 2H0DA 1LDKC 2RI7A 2VJEB 3GL6A 4AP4A 2CSYA 4LKAA 2K17A 4BHWA 3PUQA 2MA5A 2VPEA 4FJCA 4LADB 4CA1A 2QIZA 2YREA 2KGIA 2LN0A 4ZUXU 4GNFA 2K1JA 3O36A 2ECTA 4R2YA 2C2VS 3ASLA 4MSXA 2M6MA 5AIUA 4UI9B 4YAXA 3KQIA 1WEWA 3HTKC 1MM2A 1HYIA 2L0BA 4GNDA 2CKLA 3MHSA 4YBMA 3U5NA 2F6JA 3DQVR 1CHCA 2Y1MA 5LKXA 2KYUA 2EODA 2L43A 2E6SA 2F6NA 2EA6A 2LGKA 4YC9A 2VPGA 3ZNIA 1N87A 3N9LA 1WIMA 1RMDA 3N9OA 2CSZA 3LQIA 2ECWA 2HYED 2LDRA 2MT5A 3KV5A 2JMJA 4AVXA 1X4UA 2KWJA 2YW8A 2KGGA 2KREA 2DX8A 1WEPA 2VPBA 4AYCA 1WEOA 4GB0A 2NAAA 3IHPA 4P5OB 4A0CD 1T1HA 2VPDA 4UP0A 2YSMA 5FEYA 3M62A 5D1MB 4FK5A 5H1TA 3EB6A 2KR4A 3FL2A 4S3OB 5FERA 4FO9A 2KU3A 5LKUA 5B79A 3PHDA 2FSAA 3I2DA 4R7EA 3PURA 5D1KB 1X4IA 4QF3A 2JMIA 2VJEA 4W4UA 3DPLR 4V3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCU A;  3O35 A;  3VK6 A;  2LV9 A;  3V43 A;  5DKA A;  5AIT A;  3C6W A;  5H1U A;  2YU4 A;  4UP5 A;  3KV6 A;  2AN6 A;  4WZ2 A;  2M1R A;  2VNF A;  5TDW A;  2MA6 A;  5DIN A;  4PTB A;  4IC3 A;  2E6R A;  3C5K A;  2YT5 A;  2KIZ A;  2OXQ C;  3LQJ A;  3ZPV E;  5G05 B;  4ZQL A;  5B77 A;  1JM7 A;  4L58 A;  4X3G A;  1WEU A;  2JRJ A;  2Y43 A;  2MUM A;  2PUY A;  3RPG B;  2ECG A;  3ZVZ B;  5B76 A;  2YQM A;  2KFT A;  5EYA F;  5I3L A;  4V3K C;  5TRB A;  1VFY A;  2LGV A;  1FBV A;  1XWH A;  4I7D A;  5H9M A;  4N3W A;  4CCG X;  2K16 A;  4MVT A;  4S3O C;  2RSD A;  2G45 A;  3N9P A;  3SHB A;  1Z60 A;  4WZ0 A;  2YHN A;  3SOU A;  2YSJ A;  4C9Z A;  1VYX A;  2MIQ A;  1HYJ A;  4F52 B;  3QZV A;  5LCW B;  2BAY A;  2VJF A;  2YYR A;  4WA6 A;  3T6R A;  3N9Q A;  4I7B A;  4IC2 A;  2D8S A;  3GV4 A;  2XB1 A;  3O70 A;  4WZ3 B;  5FB0 A;  2CT2 A;  1K2F A;  4NN2 A;  2C2L A;  2XEU A;  2LXP C;  3O33 A;  1WEE A;  4ZDT A;  5B8D A;  3SOX A;  1U6G B;  3U5P A;  2MD7 B;  1LDJ B;  5B75 A;  2LQ6 A;  3NG2 A;  3M99 A;  3LQH A;  3N9N A;  2L5U A;  1JOC A;  2EGP A;  2VP7 A;  4O64 A;  2YHO A;  2LGG A;  2L75 A;  1Z2Q A;  2F42 A;  5J3X A;  3RPG C;  2K4D A;  1WIL A;  2MNZ A;  2G43 A;  4Q6F A;  3U5O A;  2FUU A;  4QF2 A;  5KH3 A;  1WEV A;  5B78 A;  4GNG A;  4B7Y C;  4A49 A;  5TBN A;  2H0D B;  5H1V A;  2ECI A;  1WFK A;  1E4U A;  2LRI C;  1WE9 A;  3L1X A;  2JMD A;  4LK9 A;  5TAB A;  2IDA A;  5JG6 A;  1BOR A;  1IYM A;  4A4B A;  3ZYQ A;  3MHH A;  5C11 A;  5LKT A;  1MM3 A;  2PNX A;  4YAB A;  4LJN A;  3SOW A;  2ECV A;  4XI1 A;  4YBS A;  4LLB A;  3U5M A;  4YAT A;  5G0F A;  5FB1 A;  1V87 A;  3ZPV 1;  1FP0 A;  2CKL B;  1JM7 B;  3EB5 A;  3ZTG A;  4L7X A;  1WEM A;  2FUI A;  4FIP A;  3N9M A;  2KWN A;  4A4C A;  2MNY A;  1WEN A;  5G04 B;  1WEQ A;  3T7L A;  3HCS A;  2UZG A;  2KE1 A;  2M3H A;  2ECJ A;  4AUQ B;  1F62 A;  4R8P K;  1ZBD B;  3O34 A;  2YQL A;  1G25 A;  2LGL A;  2HDP A;  4YAD A;  4B86 C;  2KWO A;  2LXH C;  2ZET C;  5D1L B;  2MD8 C;  3O37 A;  2QIC A;  5KH9 A;  2G6Q A;  1X4J A;  3KNV A;  2VJF B;  4AYC B;  4PPE A;  5KH7 A;  4N4F A;  2L80 A;  4BBQ A;  3M63 A;  3O7A A;  5TDR A;  2QJ0 A;  2YUR A;  4YBT A;  3L1Z B;  4TKP B;  4I7C A;  2M85 A;  3L11 A;  1WES A;  3RTR B;  5LKZ A;  5C13 A;  2KWK A;  2YUC A;  2ECN A;  4GNE A;  3HCT A;  3ZVY A;  2Y1N A;  1DVP A;  1WGM A;  3LRQ A;  2I50 A;  1Z6U A;  1VD4 A;  2H0D A;  1LDK C;  2RI7 A;  2VJE B;  3GL6 A;  4AP4 A;  2CSY A;  4LKA A;  2K17 A;  4BHW A;  3PUQ A;  2MA5 A;  2VPE A;  4FJC A;  4LAD B;  4CA1 A;  2QIZ A;  2YRE A;  2KGI A;  2LN0 A;  4ZUX U;  4GNF A;  2K1J A;  3O36 A;  2ECT A;  4R2Y A;  2C2V S;  3ASL A;  4MSX A;  2M6M A;  5AIU A;  4UI9 B;  4YAX A;  3KQI A;  1WEW A;  3HTK C;  1MM2 A;  1HYI A;  2L0B A;  4GND A;  2CKL A;  3MHS A;  4YBM A;  3U5N A;  2F6J A;  3DQV R;  1CHC A;  2Y1M A;  5LKX A;  2KYU A;  2EOD A;  2L43 A;  2E6S A;  2F6N A;  2EA6 A;  2LGK A;  4YC9 A;  2VPG A;  3ZNI A;  1N87 A;  3N9L A;  1WIM A;  1RMD A;  3N9O A;  2CSZ A;  3LQI A;  2ECW A;  2HYE D;  2LDR A;  2MT5 A;  3KV5 A;  2JMJ A;  4AVX A;  1X4U A;  2KWJ A;  2YW8 A;  2KGG A;  2KRE A;  2DX8 A;  1WEP A;  2VPB A;  4AYC A;  1WEO A;  4GB0 A;  2NAA A;  3IHP A;  4P5O B;  4A0C D;  1T1H A;  2VPD A;  4UP0 A;  2YSM A;  5FEY A;  3M62 A;  5D1M B;  4FK5 A;  5H1T A;  3EB6 A;  2KR4 A;  3FL2 A;  4S3O B;  5FER A;  4FO9 A;  2KU3 A;  5LKU A;  5B79 A;  3PHD A;  2FSA A;  3I2D A;  4R7E A;  3PUR A;  5D1K B;  1X4I A;  4QF3 A;  2JMI A;  2VJE A;  4W4U A;  3DPL R;  4V3L C; 
#chains in the Genus database with same CATH topology
 3HCU A;  3O35 A;  3VK6 A;  2LV9 A;  3V43 A;  5DKA A;  5AIT A;  3C6W A;  5H1U A;  2YU4 A;  2LAU A;  4UP5 A;  3KV6 A;  2AN6 A;  4WZ2 A;  2M1R A;  2VNF A;  5TDW A;  2MA6 A;  5DIN A;  4PTB A;  2FD4 A;  4IC3 A;  2E6R A;  3C5K A;  2YT5 A;  2KIZ A;  5SVX A;  2OXQ C;  3LQJ A;  3ZPV E;  5G05 B;  4ZQL A;  3M7K A;  5B77 A;  4O62 A;  1JM7 A;  4L58 A;  4X3G A;  1WEU A;  2JRJ A;  2Y43 A;  2MUM A;  2PUY A;  3RPG B;  2ECG A;  3ZVZ B;  3E2D A;  5B76 A;  2YQM A;  2KFT A;  5EYA F;  5I3L A;  2KKY A;  4V3K C;  5TRB A;  1VFY A;  2LGV A;  1FBV A;  1XWH A;  4I7D A;  5H9M A;  4N3W A;  4CCG X;  2K16 A;  4MVT A;  4S3O C;  2RSD A;  2G45 A;  2OWA A;  3N9P A;  3SHB A;  1Z60 A;  4WZ0 A;  2YHN A;  3SOU A;  2YSJ A;  4C9Z A;  1VYX A;  2MIQ A;  1HYJ A;  4F52 B;  3QZV A;  5LCW B;  2BAY A;  2VJF A;  2YYR A;  4WA6 A;  3T6R A;  3N9Q A;  4I7B A;  4IC2 A;  2D8S A;  3GV4 A;  2XB1 A;  3O70 A;  4WZ3 B;  3LDY A;  5FB0 A;  2CT2 A;  1K2F A;  2XOC A;  3JUE A;  4NN2 A;  2C2L A;  2XEU A;  2LXP C;  3O33 A;  1WEE A;  4ZDT A;  3FJU B;  3SOX A;  5B8D A;  2CRW A;  1U6G B;  3U5P A;  2MD7 B;  1LDJ B;  5B75 A;  2LQ6 A;  2XOZ A;  3NG2 A;  3M99 A;  4OGE A;  3LQH A;  3N9N A;  2L5U A;  1JOC A;  2EGP A;  2VP7 A;  4O64 A;  2YHO A;  2LGG A;  2L75 A;  2CON A;  2CRR A;  1Z2Q A;  2CSV A;  2F42 A;  5J3X A;  3RPG C;  2K4D A;  1WIL A;  2MNZ A;  2G43 A;  4Q6F A;  3U5O A;  2FUU A;  4QF2 A;  3LJU X;  5KH3 A;  1WEV A;  5B78 A;  4GNG A;  4B7Y C;  3DWD A;  4A49 A;  5TBN A;  2H0D B;  5H1V A;  2ECI A;  1WFK A;  1E4U A;  2LRI C;  1WE9 A;  3L1X A;  2JMD A;  4LK9 A;  5TAB A;  2IDA A;  5JG6 A;  1BOR A;  1IYM A;  4A4B A;  3T9K A;  3ZYQ A;  3MHH A;  5C11 A;  5LKT A;  1DCQ A;  1MM3 A;  2PNX A;  4YAB A;  3MDB C;  4LJN A;  3SOW A;  2ECV A;  4XI1 A;  2XP0 A;  4YBS A;  4LLB A;  3U5M A;  4YAT A;  3KDE C;  3FAO A;  2FFW A;  3H7H A;  5K3Q A;  4Z0R A;  5G0F A;  5FB1 A;  1V87 A;  3ZPV 1;  1FP0 A;  2CKL B;  1JM7 B;  3EB5 A;  3ZTG A;  4L7X A;  1WEM A;  2MKE A;  2L7P A;  4H9D A;  2FUI A;  4FIP A;  3N9M A;  2KWN A;  3O47 A;  4A4C A;  2MNY A;  1WEN A;  5G04 B;  4Z0O A;  1WEQ A;  3T7L A;  3HCS A;  2UZG A;  2KE1 A;  2M3H A;  3Q1D A;  2ECJ A;  4AUQ B;  1F62 A;  4R8P K;  1ZBD B;  3O34 A;  2YQL A;  2RR4 A;  1G25 A;  2LGL A;  2HDP A;  4YAD A;  5SVI A;  4B86 C;  2KWO A;  2LXH C;  2ZET C;  5D1L B;  2MD8 C;  3O37 A;  2QIC A;  5KH9 A;  2G6Q A;  1X4J A;  3KNV A;  2VJF B;  4AYC B;  4PPE A;  5KH7 A;  4N4F A;  2L80 A;  4BBQ A;  3M63 A;  2B0O E;  2E61 A;  3O7A A;  5TDR A;  2QJ0 A;  2YUR A;  4YBT A;  3L1Z B;  4TKP B;  4I7C A;  2M85 A;  3L11 A;  1WES A;  3FAN A;  3RTR B;  5LKZ A;  5C13 A;  2KWK A;  2YUC A;  2ECN A;  4QQ4 A;  4GNE A;  3HCT A;  3ZVY A;  2Y1N A;  1DVP A;  1WGM A;  3LRQ A;  2I50 A;  1Z6U A;  1VD4 A;  4OGC A;  1LDK C;  2H0D A;  5SVY A;  2RI7 A;  2VJE B;  3GL6 A;  2IQJ A;  4AP4 A;  2CSY A;  4LKA A;  2K17 A;  4BHW A;  3PUQ A;  2MA5 A;  2VPE A;  4FJC A;  4LAD B;  3SUB A;  4CA1 A;  2M13 A;  2QIZ A;  2YRE A;  2KGI A;  2LN0 A;  4ZUX U;  4GNF A;  2K1J A;  3O36 A;  2ECT A;  4R2Y A;  2C2V S;  3ASL A;  4MSX A;  2YVR A;  2M6M A;  5AIU A;  4UI9 B;  3LVR E;  4YAX A;  3KQI A;  1WEW A;  3HTK C;  3FM8 C;  1MM2 A;  1HYI A;  2L0B A;  4GND A;  2CKL A;  3MHS A;  4YBM A;  3U5N A;  2F6J A;  2JUN A;  3DQV R;  1CHC A;  2D8U A;  2Y1M A;  4F1P A;  5LKX A;  2KYU A;  2EOD A;  2L43 A;  2E6S A;  2F6N A;  2EA6 A;  2LGK A;  4YC9 A;  2VPG A;  2DSM A;  3ZNI A;  1N87 A;  3N9L A;  1WIM A;  1RMD A;  3N9O A;  2CSZ A;  3LQI A;  2ECW A;  2HYE D;  2LDR A;  2MT5 A;  2JM3 A;  3KV5 A;  2JMJ A;  4AVX A;  1X4U A;  2KWJ A;  2YW8 A;  2XOY A;  2KGG A;  2KRE A;  2DX8 A;  3FEH A;  1WEP A;  2VPB A;  3LVQ E;  4AYC A;  1WEO A;  4GB0 A;  2NAA A;  3IHP A;  4P5O B;  4A0C D;  2P57 A;  1T1H A;  2VPD A;  4UP0 A;  3PLW A;  2YSM A;  5FEY A;  3M62 A;  5D1M B;  4FK5 A;  5H1T A;  2EGM A;  3EB6 A;  2KR4 A;  2DJA A;  3FL2 A;  2KKX A;  4S3O B;  5FER A;  2EXU A;  4FO9 A;  3DDT A;  2KU3 A;  1MBM A;  5SVI B;  5LKU A;  5B79 A;  3PHD A;  2FSA A;  3I2D A;  4R7E A;  3PUR A;  5D1K B;  1X4I A;  4QF3 A;  2JMI A;  2VJE A;  4W4U A;  3DPL R;  4V3L C; 
#chains in the Genus database with same CATH homology
 3HCU A;  3O35 A;  3VK6 A;  2LV9 A;  3V43 A;  5DKA A;  5AIT A;  3C6W A;  5H1U A;  2YU4 A;  4UP5 A;  3KV6 A;  2AN6 A;  4WZ2 A;  2M1R A;  2VNF A;  5TDW A;  2MA6 A;  5DIN A;  4PTB A;  4IC3 A;  2E6R A;  3C5K A;  2YT5 A;  2KIZ A;  2OXQ C;  3LQJ A;  3ZPV E;  5G05 B;  4ZQL A;  5B77 A;  1JM7 A;  4L58 A;  4X3G A;  1WEU A;  2JRJ A;  2Y43 A;  2MUM A;  2PUY A;  3RPG B;  2ECG A;  3ZVZ B;  5B76 A;  2YQM A;  2KFT A;  5EYA F;  5I3L A;  4V3K C;  5TRB A;  1VFY A;  2LGV A;  1FBV A;  1XWH A;  4I7D A;  5H9M A;  4N3W A;  4CCG X;  2K16 A;  4MVT A;  4S3O C;  2RSD A;  2G45 A;  3N9P A;  3SHB A;  1Z60 A;  4WZ0 A;  2YHN A;  3SOU A;  2YSJ A;  4C9Z A;  1VYX A;  2MIQ A;  1HYJ A;  4F52 B;  3QZV A;  5LCW B;  2BAY A;  2VJF A;  2YYR A;  4WA6 A;  3T6R A;  3N9Q A;  4I7B A;  4IC2 A;  2D8S A;  3GV4 A;  2XB1 A;  3O70 A;  4WZ3 B;  5FB0 A;  2CT2 A;  1K2F A;  4NN2 A;  2C2L A;  2XEU A;  2LXP C;  3O33 A;  1WEE A;  4ZDT A;  5B8D A;  3SOX A;  1U6G B;  3U5P A;  2MD7 B;  1LDJ B;  5B75 A;  2LQ6 A;  3NG2 A;  3M99 A;  3LQH A;  3N9N A;  2L5U A;  1JOC A;  2EGP A;  2VP7 A;  4O64 A;  2YHO A;  2LGG A;  2L75 A;  1Z2Q A;  2F42 A;  5J3X A;  3RPG C;  2K4D A;  1WIL A;  2MNZ A;  2G43 A;  4Q6F A;  3U5O A;  2FUU A;  4QF2 A;  5KH3 A;  1WEV A;  5B78 A;  4GNG A;  4B7Y C;  4A49 A;  5TBN A;  2H0D B;  5H1V A;  2ECI A;  1WFK A;  1E4U A;  2LRI C;  1WE9 A;  3L1X A;  2JMD A;  4LK9 A;  5TAB A;  2IDA A;  5JG6 A;  1BOR A;  1IYM A;  4A4B A;  3ZYQ A;  3MHH A;  5C11 A;  5LKT A;  1MM3 A;  2PNX A;  4YAB A;  4LJN A;  3SOW A;  2ECV A;  4XI1 A;  4YBS A;  4LLB A;  3U5M A;  4YAT A;  5G0F A;  5FB1 A;  1V87 A;  3ZPV 1;  1FP0 A;  2CKL B;  1JM7 B;  3EB5 A;  3ZTG A;  4L7X A;  1WEM A;  2FUI A;  4FIP A;  3N9M A;  2KWN A;  4A4C A;  2MNY A;  1WEN A;  5G04 B;  1WEQ A;  3T7L A;  3HCS A;  2UZG A;  2KE1 A;  2M3H A;  2ECJ A;  4AUQ B;  1F62 A;  4R8P K;  1ZBD B;  3O34 A;  2YQL A;  1G25 A;  2LGL A;  2HDP A;  4YAD A;  4B86 C;  2KWO A;  2LXH C;  2ZET C;  5D1L B;  2MD8 C;  3O37 A;  2QIC A;  5KH9 A;  2G6Q A;  1X4J A;  3KNV A;  2VJF B;  4AYC B;  4PPE A;  5KH7 A;  4N4F A;  2L80 A;  4BBQ A;  3M63 A;  3O7A A;  5TDR A;  2QJ0 A;  2YUR A;  4YBT A;  3L1Z B;  4TKP B;  4I7C A;  2M85 A;  3L11 A;  1WES A;  3RTR B;  5LKZ A;  5C13 A;  2KWK A;  2YUC A;  2ECN A;  4GNE A;  3HCT A;  3ZVY A;  2Y1N A;  1DVP A;  1WGM A;  3LRQ A;  2I50 A;  1Z6U A;  1VD4 A;  2H0D A;  1LDK C;  2RI7 A;  2VJE B;  3GL6 A;  4AP4 A;  2CSY A;  4LKA A;  2K17 A;  4BHW A;  3PUQ A;  2MA5 A;  2VPE A;  4FJC A;  4LAD B;  4CA1 A;  2QIZ A;  2YRE A;  2KGI A;  2LN0 A;  4ZUX U;  4GNF A;  2K1J A;  3O36 A;  2ECT A;  4R2Y A;  2C2V S;  3ASL A;  4MSX A;  2M6M A;  5AIU A;  4UI9 B;  4YAX A;  3KQI A;  1WEW A;  3HTK C;  1MM2 A;  1HYI A;  2L0B A;  4GND A;  2CKL A;  3MHS A;  4YBM A;  3U5N A;  2F6J A;  3DQV R;  1CHC A;  2Y1M A;  5LKX A;  2KYU A;  2EOD A;  2L43 A;  2E6S A;  2F6N A;  2EA6 A;  2LGK A;  4YC9 A;  2VPG A;  3ZNI A;  1N87 A;  3N9L A;  1WIM A;  1RMD A;  3N9O A;  2CSZ A;  3LQI A;  2ECW A;  2HYE D;  2LDR A;  2MT5 A;  3KV5 A;  2JMJ A;  4AVX A;  1X4U A;  2KWJ A;  2YW8 A;  2KGG A;  2KRE A;  2DX8 A;  1WEP A;  2VPB A;  4AYC A;  1WEO A;  4GB0 A;  2NAA A;  3IHP A;  4P5O B;  4A0C D;  1T1H A;  2VPD A;  4UP0 A;  2YSM A;  5FEY A;  3M62 A;  5D1M B;  4FK5 A;  5H1T A;  3EB6 A;  2KR4 A;  3FL2 A;  4S3O B;  5FER A;  4FO9 A;  2KU3 A;  5LKU A;  5B79 A;  3PHD A;  2FSA A;  3I2D A;  4R7E A;  3PUR A;  5D1K B;  1X4I A;  4QF3 A;  2JMI A;  2VJE A;  4W4U A;  3DPL R;  4V3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...