3O35A

Crystal structure of trim24 phd-bromo complexed with h3(23-31)k27ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
178
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
total genus 53
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o35A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o35A01
3ZNIA 4UYFA 4L58A 2E7NA 3O35A 5COIA 4LR6A 5HCLA 4YADA 2RNWA 5LKZA 2DWWA 4N4HA 5E9YA 5KTUA 3DQVR 3UV4A 4TQNA 2MIQA 5D3HA 2D8SA 3N9NA 4QC3A 5I7YA 2LDRA 5DKCA 4WIVA 5FH7A 4DONA 5D3RA 4YK0A 5H1TA 1EQFA 2OO1A 5LJ0A 1DVPA 1WESA 5TRBA 5DKHA 4CLBA 5IGLA 5EISA 4A9OA 4NRAA 4QSWA 5FE7A 4GNFA 5I89A 5DX4A 5ENFA 2F6NA 5E9KA 4A9HA 2ECIA 2IDAA 4S3OC 5F1LA 3SVHA 5BT5A 3FKMX 4MEPA 2CSYA 2D9EA 4N3WA 4Q0OA 5II2A 3DAIA 4OGJA 4QSPA 5CP5A 4AKNA 3GV4A 4R7EA 4UP5A 1MM3A 5LJ2A 5D3JA 5G05B 5KHMA 5DY7A 2GRCA 4IORA 5E9MA 2QIZA 4YYHA 5HLSA 2JMIA 5DKAA 4NR8A 2AN6A 4UIWA 4F52B 4MR5A 2F42A 4QC1A 3SOXA 2LGVA 4XY9A 2G6QA 2K16A 5I88A 5D0CA 1BORA 5EA1A 5CTLA 2CSZA 4TU6A 4TYLA 2I8NA 5I3LA 3UVWA 1WENA 5HRWA 5HFRA 4LK9A 4PCIA 4UIVA 4UYFB 4O64A 3IU6A 5K29A 5C7NA 5FFVA 5G04B 5FE4A 5TB6A 1X4UA 1HYJA 5II1A 1WUGA 2LQ6A 2K1JA 5FBXA 4BHWA 3U5NA 2JMJA 3QZTA 1RMDA 4A9EA 1WE9A 2ECWA 2PUYA 3QZVA 4HXKA 5FG5A 4X2IA 4NRCA 2YELA 5ENIA 4BW1A 4IR6A 1FP0A 3P1EA 5LUUA 3ZVYA 2YW5A 3K2JA 5A83A 4GNEA 5CRMA 2JRJA 4CFKA 4HXMA 5CU8A 5L96A 3GG3A 5IG6A 1WILA 4IR3A 2QJ0A 2DVQA 3JVJA 5ACYA 2PNXA 5HQ5A 5H1VA 5FFWA 5EI4A 2YQDA 5TABA 5HENA 4J3IA 5I80A 1VFYA 4B86C 4ALGA 2MT5A 5EM3A 5E73A 4PY6A 4Q0NA 5AD3A 5KH9A 5FE0A 4IR4A 2WP2A 2R0SA 4BJXA 3LXJA 3RPGB 5ETBA 4A0CD 4GNGA 5D1LB 4NR4A 2K4DA 3ASLA 5A5PA 5F36A 1WGMA 5ENCA 4NR6A 5CZGA 1T1HA 3KQIA 1JM7B 5AD2A 3L1XA 2YT5A 4TZ8A 1JM7A 4TT4A 3T6RA 5DLXA 5F62A 2MNZA 5FFYA 1N72A 4QF2A 4ZW1A 3C5KA 4QY4A 4Y03A 2YYNA 4HBWA 5DW1A 5ENEA 3NG2A 4R8PK 4XUAA 3M99A 5HEMA 4YYGA 2YQMA 4UIYA 4C9ZA 3L1ZB 2VJFB 5IBNA 1LDJB 4HXOA 4TKPB 1LDKC 4BW3A 2VJFA 3PURA 4FJCA 3FL2A 2DATA 5L8TA 2R0VA 4QUUA 4F3IA 5L97A 1Z6UA 2YEMA 5CQ5A 4QR4A 4UIZA 2DVSA 5CQ8A 5D3NA 2OUOA 5ETDA 2C2LA 2K17A 2M3HA 3UV2A 3I2DA 3ZYUA 3S92A 2KWKA 5HM0A 2KTBB 5A85A 5EPSA 2YHNA 3EB6A 2YQLA 4LRGA 3HCSA 5E3DA 4E96A 1Z60A 4QUTA 5CUAA 4UYDA 5DBMA 5A5QA 4O78A 2LSPB 4LZRA 4V3LC 2MD8C 2KGIA 3G0JA 1VYXA 4J0SA 4ALHA 2H60A 2L5EA 2LN0A 5H85A 4NYVA 5ENBA 5DYXA 2N9GA 4HXNA 4GB0A 4L7XA 2I50A 4LZSA 4FO9A 5D3SA 4XI1A 5G0FA 3Q2EA 3T7LA 2H0DB 3M63A 5EU1A 3HMFA 5E7DA 5A82A 2KGGA 3M62A 2RI7A 4YYDA 5CUDA 4WA6A 2YSJA 5CQTA 2JMDA 3KNVA 4O7AA 5FE8A 5A7CA 5BT3A 4Q6FA 4O7BA 5EK9A 5CQAA 3UVDA 2LXHC 5TDRA 5A5OA 5HRXA 4YBSA 3LQHA 2C2VS 4PCEA 5LKXA 4IC3A 5D24A 5EP7A 1Z2QA 4LADB 5CFWA 4MEOA 4A9IA 5LKTA 1F62A 4QEWA 5I7XA 2M1RA 1WEWA 4UIXA 3AQAA 5KH7A 3RTRB 4A9KA 4O70A 4MR6A 5CUGA 4QYLA 5J3XA 1XWHA 2R0YA 4NYWA 3V43A 5A5RA 5EYAF 4Z1QA 5F1HA 3N9MA 4AVXA 2VNFA 2NAAA 2XEUA 5DLZA 3LQJA 4QSUA 3EB5A 3VK6A 2MA5A 3HCUA 3ONIA 5AIUA 3UW9A 3GL6A 5LJ1A 4UP0A 4QB3A 5E3GA 5KTWA 5AMFA 4NR7A 2KWNA 5D3PA 1WEPA 5HQ6A 1E6IA 3ZPV1 1JM4B 4NUDA 5CQ4A 3U5OA 4WZ0A 3SOUA 1X0JA 2DVRA 4NXJA 5DYUA 5DFBA 2L5UA 3MXFA 4N4IA 4YABA 3O36A 5JI8A 5D7XA 2LV9A 4BBQA 5B79A 4O72A 4A4BA 4W4UA 3LQIA 4A9FA 4NQNA 2VJEB 4A9LA 3LRQA 2RS9B 4YYJA 5I83A 4QZSA 3MB4A 4YH3A 1JOCA 1FBVA 5FE6A 3S91A 4UIUA 5FB1A 3Q2FA 1WEMA 4MEQA 3MHHA 5CGPA 5C85A 5D26A 5DKDA 1X4IA 5D3TA 5EGUA 3P1FA 3G0LA 3SHBA 5FEYA 2E6SA 2MNYA 2VPBA 3SOWA 4C66A 4QSTA 5TBNA 4TT6A 2EA6A 4ZQLA 4A9MA 2KIZA 4HXRA 3D7CA 5DINA 5KU3A 2YDWA 5HQ7A 4QSSA 5FDZA 2G43A 4XUBA 5EWWA 5AMEA 4QEVA 3U5LA 4LDFA 4HBVA 4CUQA 4UYHA 4YYMA 5IGMA 4I7DA 4YY6A 5A5SA 2VP7A 3HCTA 4RVRA 2BAYA 4HXSA 4N4GA 5DYCA 2EODA 3KV5A 4CL9A 3RCWA 3UV5A 5FE2A 5JWMA 2KR4A 2L80A 3HTKC 5DFDA 4MR3A 1F68A 4YBTA 4QSVA 4CCGX 5F60A 2XB1A 4NYXA 2MUMA 5HRVA 3MUKA 5C87A 4V3KC 5TDWA 1MM2A 3N9PA 3UVXA 4WZ2A 4QR3A 3ZTGA 5G4RA 2R10A 5L8UA 5E9IA 2YSMA 4KCXA 4XYAA 4FK5A 4CUSA 5J0DA 4ZUXU 5F25A 4LYWA 5CUBA 1WEOA 2RO1A 1X4JA 2FSAA 2E7OA 2WP1A 4IOOA 4BW4A 5H9MA 5JG6A 2NXBA 3O34A 4MR4A 3ZYQA 4AUQB 4XY8A 5F2PA 4UITA 2ZETC 2FUUA 3KV6A 4PKLA 1WFKA 1ZBDB 4WHUA 2ECNA 2HYED 3O33A 4CFLA 1G25A 4GPJA 3C6WA 5D1MB 4YC9A 5CRZA 4S3OB 2YYRA 5B76A 2UZGA 4QSXA 3P5OA 4HBXA 3O7AA 4X3GA 4LKAA 4UYEA 3NXBA 4NS5A 3N9LA 2KWOA 2DVVA 4LLBA 5LCWB 4OUFA 4O75A 5FE5A 1WEEA 4LC2A 2Y1NA 4YYNA 4QF3A 4AP4A 4LZ2A 3O70A 1N87A 1WEQA 5DW2A 5I40A 2G4AA 1K2FA 4YAXA 5E9LA 5EV9A 2L43A 2RFJA 2VJEA 1CHCA 4LJNA 4ZC9A 4NUCA 1IYMA 5EWCA 3MQMA 4P5OB 4C67A 3MULA 5IIDA 3DWYA 4TT2A 3SVFA 4YY4A 5H1UA 2I7KA 5I86A 4TTEA 5F61A 2YUCA 2KE1A 2ECVA 5EWDA 5D1KB 4QYDA 2Y43A 2DKWA 5FB0A 5HFQA 4HXLA 5I29A 4Z1SA 2KREA 4TZ2A 2ECTA 4LYSA 5AITA 2OXQC 2L85A 4A9JA 2RNXA 4QEUA 5CUEA 4MVTA 2QICA 4O7CA 5I1QA 5CQ6A 3MB3A 4UI9B 4O77A 5C4QA 1VD4A 4KV4A 4BW2A 3PHDA 5FE3A 5CQ7A 5E9VA 2CKLA 3LJWA 2VPDA 4Z6HA 4QBMA 2KWJA 4GNDA 5ENHA 4OGIA 4PS5A 2VPEA 5F63A 4YYIA 5EWVA 2YURA 4MSXA 5LVRA 4A49A 5CS8A 4J0RA 4FLPA 5B8DA 2D82A 2MA6A 5DYAA 4O71A 3JVKA 4WZ3B 4NN2A 2EGPA 5G4SA 1WUMA 4Z6IA 5C89A 2YEKA 5FH6A 4O74A 3UVYA 5E0RA 4ZDTA 4NQMA 4PPEA 4QSQA 5D3LA 2FUIA 5KH3A 2YHOA 2L0BA 5B78A 4I7CA 2H0DA 4YH4A 5BT4A 5LKUA 2RSDA 4AYCB 4MENA 2ECGA 2VPGA 2LRIC 3L11A 2KYUA 4IC2A 4QSRA 3QZSA 2M85A 4O7FA 5CY9A 5CQ3A 5ENGA 3P1CA 5FE1A 5HJCA 3PUQA 1HYIA 5E74A 5ENJA 5LVQA 2L84A 4O76A 2DX8A 1ZS5A 4WHWA 4Z93A 5HELA 5FE9A 4UYGA 5L98A 1JSPB 4YATA 2RNYA 3U5KA 5B75A 1E4UA 3MHSA 2G45A 4KV1A 3U5PA 3N9QA 5KO4A 5IGKA 5L99A 3RPGC 4O7EA 4TU4A 5CUCA 4I7BA 3JVMA 2KU3A 2YREA 4PTBA 4QNSA 3IHPA 2LXPC 5A5NA 4CUPA 4YYKA 2LGKA 1WEUA 4HBYA 2OSSA 3TLPA 5EPBA 5F3AA 4A9NA 2KFTA 2ECJA 4CUTA 4QR5A 3DPLR 4J1PA 2LGGA 5B77A 5IGNA 3IU5A 3N9OA 2MJVB 2E3KA 5FERA 2L75A 5FH8A 5D25A 4LYIA 1WIMA 4NRBA 3ZVZB 4CA1A 3P1DA 2YU4A 3JVLA 4NUEA 2Y1MA 1V87A 5DFCA 4YBMA 3ZPVE 3O37A 1WEVA 3U5MA 5C8GA 5EQ1A 2CT2A 3U5JA 5EPRA 5EWHA 5C13A 4AYCA 4NR5A 4NR9A 4CURA 5EICA 2M6MA 5FG6A 4A4CA 1U6GB 5TCMA 3SVGA 4R2YA 4B7YC 5F5ZA 2YW8A 4N4FA 4FIPA 3HMHA 3I3JA 5A81A 2F6JA 4CUUA 3HMEA 4TS8A 5KTXA 2LGLA 5C11A 2E6RA 3AADA 4HXPA 4IOQA 2HDPA 2MD7B 5CPEA 5FG4A 2CKLB 4IR5A 5EVAA
chains in the Genus database with same CATH superfamily
3ZNIA 4UYFA 4L58A 2E7NA 3O35A 5COIA 3DWDA 4LR6A 5HCLA 4YADA 2RNWA 5LKZA 2DWWA 4N4HA 5E9YA 5KTUA 3DQVR 3UV4A 4TQNA 2MIQA 5D3HA 2D8SA 3N9NA 4QC3A 5I7YA 2EJNA 5DKCA 2LDRA 4WIVA 5FH7A 4DONA 5D3RA 4YK0A 5H1TA 1EQFA 2OO1A 5LJ0A 1DVPA 1WESA 4Z0RA 5TRBA 5DKHA 4CLBA 5IGLA 5EISA 4A9OA 4NRAA 4QSWA 5FE7A 4OGEA 4GNFA 5I89A 5DX4A 5ENFA 2F6NA 5E9KA 4A9HA 2ECIA 2IDAA 4S3OC 3FANA 5F1LA 3SVHA 5BT5A 3FKMX 4MEPA 2CSYA 2D9EA 4N3WA 4Q0OA 5II2A 3DAIA 4OGJA 4QSPA 5CP5A 4AKNA 2DSMA 2KKXA 2OWAA 3GV4A 4R7EA 1MM3A 4UP5A 5LJ2A 5D3JA 5G05B 5KHMA 5DY7A 2GRCA 4IORA 5E9MA 2QIZA 4OGCA 4YYHA 2FD4A 5HLSA 2JMIA 5DKAA 4NR8A 2AN6A 4UIWA 4F52B 4MR5A 2F42A 4QC1A 3SOXA 2LGVA 4XY9A 2G6QA 2K16A 5I88A 5D0CA 1BORA 5EA1A 5CTLA 2CSZA 4TU6A 4TYLA 2I8NA 5I3LA 3UVWA 1WENA 5HRWA 5HFRA 4LK9A 4PCIA 4UIVA 5SVYA 4UYFB 4O64A 3IU6A 5K29A 5C7NA 5FFVA 5G04B 5FE4A 5TB6A 2KKYA 1X4UA 1HYJA 5II1A 1WUGA 2LQ6A 4QQ4A 2K1JA 3FJUB 5FBXA 4BHWA 3U5NA 2JMJA 3QZTA 1RMDA 4A9EA 1WE9A 2ECWA 2PUYA 3QZVA 4HXKA 5FG5A 4X2IA 4NRCA 2YELA 5ENIA 4BW1A 4IR6A 1FP0A 3P1EA 5LUUA 3ZVYA 2YW5A 3K2JA 2MKEA 2CRWA 5A83A 4GNEA 5CRMA 2JRJA 4CFKA 4HXMA 5CU8A 5L96A 3GG3A 5IG6A 1WILA 4IR3A 2QJ0A 2XP0A 2DVQA 3JVJA 5ACYA 2L7PA 2PNXA 5HQ5A 5H1VA 5FFWA 5EI4A 2YQDA 5TABA 5HENA 4J3IA 5I80A 2EGMA 1VFYA 2JM3A 4B86C 4ALGA 2MT5A 5EM3A 5E73A 4PY6A 4Q0NA 5AD3A 5KH9A 5FE0A 4IR4A 2B0OE 2WP2A 2R0SA 4BJXA 3LXJA 3RPGB 5ETBA 3FM8C 4A0CD 4GNGA 5D1LB 4NR4A 2E61A 2K4DA 3ASLA 5A5PA 5F36A 1WGMA 4F1PA 5ENCA 4NR6A 5CZGA 1T1HA 3KQIA 1JM7B 5AD2A 3L1XA 2YT5A 4TZ8A 1JM7A 4TT4A 3T6RA 5DLXA 5F62A 2MNZA 5FFYA 1N72A 4QF2A 4ZW1A 3C5KA 4QY4A 4Y03A 2YYNA 4HBWA 5DW1A 5ENEA 3NG2A 4R8PK 4XUAA 3M99A 2IQJA 5HEMA 4YYGA 2JUNA 2YQMA 4UIYA 4C9ZA 3L1ZB 2VJFB 5IBNA 1LDJB 4HXOA 4TKPB 1LDKC 4BW3A 2VJFA 3PURA 4FJCA 3FL2A 2DATA 5L8TA 2R0VA 4QUUA 4F3IA 5L97A 1Z6UA 3KDEC 2YEMA 5CQ5A 4QR4A 4UIZA 2DVSA 5CQ8A 5D3NA 2OUOA 5ETDA 2C2LA 2K17A 2M3HA 3UV2A 4AKIA 3ZYUA 3S92A 2KWKA 5HM0A 2KTBB 5A85A 5EPSA 1DCQA 2YHNA 3EB6A 2YQLA 4LRGA 3HCSA 5E3DA 4E96A 1Z60A 4QUTA 5CUAA 4UYDA 5DBMA 5A5QA 4O78A 2LSPB 4LZRA 4V3LC 2MD8C 2KGIA 3G0JA 1VYXA 4J0SA 4ALHA 2H60A 2L5EA 2LN0A 5H85A 4NYVA 5ENBA 5DYXA 2N9GA 4HXNA 4GB0A 4L7XA 2I50A 4LZSA 4FO9A 5D3SA 4XI1A 5G0FA 5SVIA 3Q2EA 3T7LA 2H0DB 3M63A 3D1DA 5EU1A 3HMFA 5E7DA 5A82A 2KGGA 2M13A 3M62A 2RI7A 4YYDA 5CUDA 4WA6A 2YSJA 5CQTA 2JMDA 3KNVA 4O7AA 5FE8A 5A7CA 5BT3A 3DDTA 4Q6FA 4O7BA 5EK9A 5CQAA 3UVDA 2LXHC 5TDRA 5A5OA 5HRXA 4YBSA 4AI6A 3D1BA 3LQHA 2C2VS 4PCEA 5LKXA 4IC3A 5D24A 5EP7A 1Z2QA 4LADB 5CFWA 4MEOA 4A9IA 5LKTA 1F62A 4QEWA 5I7XA 2M1RA 1WEWA 4UIXA 3AQAA 5KH7A 3RTRB 4A9KA 2D8UA 4O70A 4MR6A 5CUGA 4QYLA 5J3XA 1XWHA 2R0YA 4NYWA 3V43A 5A5RA 5EYAF 4Z1QA 5F1HA 3N9MA 4AVXA 2VNFA 2NAAA 2XEUA 5DLZA 3LQJA 4QSUA 3EB5A 3VK6A 2MA5A 3HCUA 3ONIA 5AIUA 3UW9A 3GL6A 5LJ1A 4UP0A 4QB3A 5E3GA 5KTWA 5AMFA 4NR7A 2KWNA 5D3PA 1WEPA 5HQ6A 1E6IA 3ZPV1 3PLWA 1JM4B 3E2DA 4NUDA 5CQ4A 3U5OA 3O47A 4WZ0A 3SOUA 1X0JA 2DVRA 4NXJA 5DYUA 5DFBA 3VKGA 2L5UA 3MXFA 4N4IA 4YABA 3O36A 5JI8A 1MBMA 5D7XA 2LV9A 4BBQA 5B79A 4O72A 4A4BA 4W4UA 3LQIA 4A9FA 4NQNA 2VJEB 4A9LA 3LRQA 3LVQE 2RS9B 2FFWA 4YYJA 5I83A 4QZSA 3MB4A 4YH3A 1JOCA 1FBVA 5FE6A 3S91A 4UIUA 1PUOA 5FB1A 3Q2FA 1WEMA 4MEQA 3MHHA 5CGPA 5C85A 5D26A 5DKDA 1X4IA 5D3TA 5EGUA 3P1FA 3G0LA 3SHBA 5FEYA 2E6SA 2MNYA 2VPBA 3SOWA 4C66A 5K3QA 4QSTA 5TBNA 4TT6A 3VKHA 2EA6A 5SVXA 4ZQLA 4A9MA 2KIZA 4HXRA 3D7CA 3MDBC 5DINA 5KU3A 2YDWA 5HQ7A 4QSSA 5FDZA 2G43A 4XUBA 5EWWA 5AMEA 4QEVA 3U5LA 2YVRA 4LDFA 4HBVA 4CUQA 4UYHA 4YYMA 5IGMA 3LVRE 4I7DA 4YY6A 5A5SA 2VP7A 3HCTA 4RVRA 2BAYA 4HXSA 4N4GA 5DYCA 2EODA 3KV5A 3Q1DA 4CL9A 3RCWA 3UV5A 5FE2A 5JWMA 2KR4A 2L80A 3HTKC 5DFDA 4MR3A 1F68A 4YBTA 4QSVA 4CCGX 5F60A 2XB1A 4NYXA 2MUMA 5HRVA 3MUKA 5C87A 4V3KC 3M7KA 5TDWA 1MM2A 3N9PA 3UVXA 4WZ2A 4QR3A 3ZTGA 5G4RA 2R10A 5L8UA 5E9IA 2CRRA 2YSMA 4KCXA 4XYAA 4FK5A 4CUSA 5J0DA 4ZUXU 5F25A 4LYWA 5CUBA 1WEOA 2RO1A 1X4JA 2FSAA 2E7OA 2WP1A 4IOOA 4BW4A 5H9MA 5JG6A 2NXBA 3O34A 4MR4A 3ZYQA 4AUQB 4XY8A 5F2PA 4UITA 2ZETC 2FUUA 3KV6A 4PKLA 4O62A 1WFKA 1ZBDB 4WHUA 2ECNA 3SUBA 2HYED 3O33A 4CFLA 1G25A 4GPJA 3C6WA 5D1MB 4YC9A 5CRZA 4S3OB 2YYRA 5B76A 2UZGA 4QSXA 3P5OA 4HBXA 3O7AA 4X3GA 4LKAA 4UYEA 3NXBA 4NS5A 3LJUX 2KWOA 2DVVA 3N9LA 4LLBA 5LCWB 3JUEA 4OUFA 4O75A 5FE5A 1WEEA 4LC2A 2Y1NA 4YYNA 4QF3A 4AP4A 4LZ2A 3O70A 1N87A 1WEQA 5DW2A 5I40A 2G4AA 1K2FA 4YAXA 5E9LA 5EV9A 4AKGA 2L43A 2RFJA 2VJEA 1CHCA 4LJNA 4ZC9A 4NUCA 1IYMA 5EWCA 3MQMA 4P5OB 4C67A 2XOCA 3MULA 5IIDA 3DWYA 4TT2A 3SVFA 4YY4A 5H1UA 2I7KA 5I86A 4TTEA 5F61A 2YUCA 2KE1A 2ECVA 5EWDA 5D1KB 4QYDA 2Y43A 2DKWA 5FB0A 5HFQA 4H9DA 4HXLA 5I29A 4Z1SA 2KREA 4TZ2A 2ECTA 4LYSA 5AITA 2OXQC 2L85A 4A9JA 2RNXA 4QEUA 5CUEA 4MVTA 2QICA 4O7CA 5I1QA 5CQ6A 3MB3A 4UI9B 4O77A 5C4QA 1VD4A 4KV4A 4BW2A 3PHDA 5FE3A 4Z0OA 5CQ7A 5E9VA 2CKLA 3LJWA 2VPDA 4Z6HA 4QBMA 2KWJA 4GNDA 5ENHA 4OGIA 2P57A 4PS5A 2EXUA 5F63A 2DJAA 2VPEA 4YYIA 5EWVA 2YURA 3FAOA 4MSXA 5LVRA 4A49A 5CS8A 4J0RA 4FLPA 5B8DA 2D82A 2MA6A 5DYAA 4O71A 3JVKA 4WZ3B 4NN2A 2EGPA 5G4SA 1WUMA 4Z6IA 5C89A 2YEKA 5FH6A 4AKHA 4O74A 3UVYA 5E0RA 4ZDTA 4NQMA 3LDYA 4PPEA 4QSQA 5D3LA 2FUIA 5KH3A 2YHOA 2L0BA 5B78A 4I7CA 2H0DA 4YH4A 5BT4A 5LKUA 2RSDA 4AYCB 4MENA 2ECGA 2VPGA 2LRIC 3L11A 2KYUA 4IC2A 4QSRA 3QZSA 2M85A 4O7FA 5CY9A 5CQ3A 5ENGA 3P1CA 5FE1A 5HJCA 3PUQA 1HYIA 5E74A 5ENJA 2CSVA 5LVQA 2L84A 4O76A 2DX8A 1ZS5A 4WHWA 4Z93A 5HELA 5FE9A 4UYGA 5L98A 1JSPB 4YATA 2RNYA 3U5KA 5B75A 1E4UA 3MHSA 2G45A 2XOZA 4KV1A 3U5PA 3N9QA 5KO4A 5IGKA 5L99A 3H7HA 3RPGC 4O7EA 1ZKRA 4TU4A 5CUCA 3JVMA 2KU3A 3I2DA 4I7BA 2YREA 4PTBA 4QNSA 3FEHA 3IHPA 2RR4A 2LXPC 5A5NA 4CUPA 4YYKA 2LGKA 1WEUA 4HBYA 2CONA 2OSSA 3TLPA 3ERRA 5EPBA 5F3AA 4A9NA 2KFTA 2ECJA 4CUTA 4QR5A 3DPLR 4J1PA 2LGGA 5B77A 5IGNA 3IU5A 3N9OA 2MJVB 2E3KA 5FERA 2L75A 5FH8A 5D25A 4LYIA 1WIMA 4NRBA 3ZVZB 4CA1A 3T9KA 3P1DA 2YU4A 3JVLA 4NUEA 2Y1MA 1V87A 5DFCA 4YBMA 3ZPVE 3O37A 2XOYA 1WEVA 3U5MA 5C8GA 5EQ1A 2CT2A 3U5JA 5EPRA 5EWHA 5SVIB 5C13A 4AYCA 4NR5A 4NR9A 4CURA 5EICA 2M6MA 5FG6A 4A4CA 1U6GB 5TCMA 3SVGA 4R2YA 4B7YC 5F5ZA 2YW8A 4N4FA 4FIPA 3HMHA 3I3JA 5A81A 2LAUA 2F6JA 4CUUA 3HMEA 4TS8A 5KTXA 2LGLA 5C11A 2E6RA 3AADA 4HXPA 4IOQA 2HDPA 2MD7B 5CPEA 5FG4A 2CKLB 4IR5A 5EVAA
chains in the Genus database with same CATH topology
3ZNIA 4UYFA 4L58A 2E7NA 3O35A 5COIA 4LR6A 5HCLA 4YADA 2RNWA 5LKZA 2DWWA 4N4HA 5E9YA 5KTUA 3DQVR 3UV4A 4TQNA 2MIQA 5D3HA 2D8SA 3N9NA 4QC3A 5I7YA 2LDRA 5DKCA 4WIVA 5FH7A 4DONA 5D3RA 4YK0A 5H1TA 1EQFA 2OO1A 5LJ0A 1DVPA 1WESA 5TRBA 5DKHA 4CLBA 5IGLA 5EISA 4A9OA 4NRAA 4QSWA 5FE7A 4GNFA 5I89A 5DX4A 5ENFA 2F6NA 5E9KA 4A9HA 2ECIA 2IDAA 4S3OC 5F1LA 3SVHA 5BT5A 3FKMX 4MEPA 2CSYA 2D9EA 4N3WA 4Q0OA 5II2A 3DAIA 4OGJA 4QSPA 5CP5A 4AKNA 3GV4A 4R7EA 4UP5A 1MM3A 5LJ2A 5D3JA 5G05B 5KHMA 5DY7A 2GRCA 4IORA 5E9MA 2QIZA 4YYHA 5HLSA 2JMIA 5DKAA 4NR8A 2AN6A 4UIWA 4F52B 4MR5A 2F42A 4QC1A 3SOXA 2LGVA 4XY9A 2G6QA 2K16A 5I88A 5D0CA 1BORA 5EA1A 5CTLA 2CSZA 4TU6A 4TYLA 2I8NA 5I3LA 3UVWA 1WENA 5HRWA 5HFRA 4LK9A 4PCIA 4UIVA 4UYFB 4O64A 3IU6A 5K29A 5C7NA 5FFVA 5G04B 5FE4A 5TB6A 1X4UA 1HYJA 5II1A 1WUGA 2LQ6A 2K1JA 5FBXA 4BHWA 3U5NA 2JMJA 3QZTA 1RMDA 4A9EA 1WE9A 2ECWA 2PUYA 3QZVA 4HXKA 5FG5A 4X2IA 4NRCA 2YELA 5ENIA 4BW1A 4IR6A 1FP0A 3P1EA 5LUUA 3ZVYA 2YW5A 3K2JA 5A83A 4GNEA 5CRMA 2JRJA 4CFKA 4HXMA 5CU8A 5L96A 3GG3A 5IG6A 1WILA 4IR3A 2QJ0A 2DVQA 3JVJA 5ACYA 2PNXA 5HQ5A 5H1VA 5FFWA 5EI4A 2YQDA 5TABA 5HENA 4J3IA 5I80A 1VFYA 4B86C 4ALGA 2MT5A 5EM3A 5E73A 4PY6A 4Q0NA 5AD3A 5KH9A 5FE0A 4IR4A 2WP2A 2R0SA 4BJXA 3LXJA 3RPGB 5ETBA 4A0CD 4GNGA 5D1LB 4NR4A 2K4DA 3ASLA 5A5PA 5F36A 1WGMA 5ENCA 4NR6A 5CZGA 1T1HA 3KQIA 1JM7B 5AD2A 3L1XA 2YT5A 4TZ8A 1JM7A 4TT4A 3T6RA 5DLXA 5F62A 2MNZA 5FFYA 1N72A 4QF2A 4ZW1A 3C5KA 4QY4A 4Y03A 2YYNA 4HBWA 5DW1A 5ENEA 3NG2A 4R8PK 4XUAA 3M99A 5HEMA 4YYGA 2YQMA 4UIYA 4C9ZA 3L1ZB 2VJFB 5IBNA 1LDJB 4HXOA 4TKPB 1LDKC 4BW3A 2VJFA 3PURA 4FJCA 3FL2A 2DATA 5L8TA 2R0VA 4QUUA 4F3IA 5L97A 1Z6UA 2YEMA 5CQ5A 4QR4A 4UIZA 2DVSA 5CQ8A 5D3NA 2OUOA 5ETDA 2C2LA 2K17A 2M3HA 3UV2A 3I2DA 3ZYUA 3S92A 2KWKA 5HM0A 2KTBB 5A85A 5EPSA 2YHNA 3EB6A 2YQLA 4LRGA 3HCSA 5E3DA 4E96A 1Z60A 4QUTA 5CUAA 4UYDA 5DBMA 5A5QA 4O78A 2LSPB 4LZRA 4V3LC 2MD8C 2KGIA 3G0JA 1VYXA 4J0SA 4ALHA 2H60A 2L5EA 2LN0A 5H85A 4NYVA 5ENBA 5DYXA 2N9GA 4HXNA 4GB0A 4L7XA 2I50A 4LZSA 4FO9A 5D3SA 4XI1A 5G0FA 3Q2EA 3T7LA 2H0DB 3M63A 5EU1A 3HMFA 5E7DA 5A82A 2KGGA 3M62A 2RI7A 4YYDA 5CUDA 4WA6A 2YSJA 5CQTA 2JMDA 3KNVA 4O7AA 5FE8A 5A7CA 5BT3A 4Q6FA 4O7BA 5EK9A 5CQAA 3UVDA 2LXHC 5TDRA 5A5OA 5HRXA 4YBSA 3LQHA 2C2VS 4PCEA 5LKXA 4IC3A 5D24A 5EP7A 1Z2QA 4LADB 5CFWA 4MEOA 4A9IA 5LKTA 1F62A 4QEWA 5I7XA 2M1RA 1WEWA 4UIXA 3AQAA 5KH7A 3RTRB 4A9KA 4O70A 4MR6A 5CUGA 4QYLA 5J3XA 1XWHA 2R0YA 4NYWA 3V43A 5A5RA 5EYAF 4Z1QA 5F1HA 3N9MA 4AVXA 2VNFA 2NAAA 2XEUA 5DLZA 3LQJA 4QSUA 3EB5A 3VK6A 2MA5A 3HCUA 3ONIA 5AIUA 3UW9A 3GL6A 5LJ1A 4UP0A 4QB3A 5E3GA 5KTWA 5AMFA 4NR7A 2KWNA 5D3PA 1WEPA 5HQ6A 1E6IA 3ZPV1 1JM4B 4NUDA 5CQ4A 3U5OA 4WZ0A 3SOUA 1X0JA 2DVRA 4NXJA 5DYUA 5DFBA 2L5UA 3MXFA 4N4IA 4YABA 3O36A 5JI8A 5D7XA 2LV9A 4BBQA 5B79A 4O72A 4A4BA 4W4UA 3LQIA 4A9FA 4NQNA 2VJEB 4A9LA 3LRQA 2RS9B 4YYJA 5I83A 4QZSA 3MB4A 4YH3A 1JOCA 1FBVA 5FE6A 3S91A 4UIUA 5FB1A 3Q2FA 1WEMA 4MEQA 3MHHA 5CGPA 5C85A 5D26A 5DKDA 1X4IA 5D3TA 5EGUA 3P1FA 3G0LA 3SHBA 5FEYA 2E6SA 2MNYA 2VPBA 3SOWA 4C66A 4QSTA 5TBNA 4TT6A 2EA6A 4ZQLA 4A9MA 2KIZA 4HXRA 3D7CA 5DINA 5KU3A 2YDWA 5HQ7A 4QSSA 5FDZA 2G43A 4XUBA 5EWWA 5AMEA 4QEVA 3U5LA 4LDFA 4HBVA 4CUQA 4UYHA 4YYMA 5IGMA 4I7DA 4YY6A 5A5SA 2VP7A 3HCTA 4RVRA 2BAYA 4HXSA 4N4GA 5DYCA 2EODA 3KV5A 4CL9A 3RCWA 3UV5A 5FE2A 5JWMA 2KR4A 2L80A 3HTKC 5DFDA 4MR3A 1F68A 4YBTA 4QSVA 4CCGX 5F60A 2XB1A 4NYXA 2MUMA 5HRVA 3MUKA 5C87A 4V3KC 5TDWA 1MM2A 3N9PA 3UVXA 4WZ2A 4QR3A 3ZTGA 5G4RA 2R10A 5L8UA 5E9IA 2YSMA 4KCXA 4XYAA 4FK5A 4CUSA 5J0DA 4ZUXU 5F25A 4LYWA 5CUBA 1WEOA 2RO1A 1X4JA 2FSAA 2E7OA 2WP1A 4IOOA 4BW4A 5H9MA 5JG6A 2NXBA 3O34A 4MR4A 3ZYQA 4AUQB 4XY8A 5F2PA 4UITA 2ZETC 2FUUA 3KV6A 4PKLA 1WFKA 1ZBDB 4WHUA 2ECNA 2HYED 3O33A 4CFLA 1G25A 4GPJA 3C6WA 5D1MB 4YC9A 5CRZA 4S3OB 2YYRA 5B76A 2UZGA 4QSXA 3P5OA 4HBXA 3O7AA 4X3GA 4LKAA 4UYEA 3NXBA 4NS5A 3N9LA 2KWOA 2DVVA 4LLBA 5LCWB 4OUFA 4O75A 5FE5A 1WEEA 4LC2A 2Y1NA 4YYNA 4QF3A 4AP4A 4LZ2A 3O70A 1N87A 1WEQA 5DW2A 5I40A 2G4AA 1K2FA 4YAXA 5E9LA 5EV9A 2L43A 2RFJA 2VJEA 1CHCA 4LJNA 4ZC9A 4NUCA 1IYMA 5EWCA 3MQMA 4P5OB 4C67A 3MULA 5IIDA 3DWYA 4TT2A 3SVFA 4YY4A 5H1UA 2I7KA 5I86A 4TTEA 5F61A 2YUCA 2KE1A 2ECVA 5EWDA 5D1KB 4QYDA 2Y43A 2DKWA 5FB0A 5HFQA 4HXLA 5I29A 4Z1SA 2KREA 4TZ2A 2ECTA 4LYSA 5AITA 2OXQC 2L85A 4A9JA 2RNXA 4QEUA 5CUEA 4MVTA 2QICA 4O7CA 5I1QA 5CQ6A 3MB3A 4UI9B 4O77A 5C4QA 1VD4A 4KV4A 4BW2A 3PHDA 5FE3A 5CQ7A 5E9VA 2CKLA 3LJWA 2VPDA 4Z6HA 4QBMA 2KWJA 4GNDA 5ENHA 4OGIA 4PS5A 2VPEA 5F63A 4YYIA 5EWVA 2YURA 4MSXA 5LVRA 4A49A 5CS8A 4J0RA 4FLPA 5B8DA 2D82A 2MA6A 5DYAA 4O71A 3JVKA 4WZ3B 4NN2A 2EGPA 5G4SA 1WUMA 4Z6IA 5C89A 2YEKA 5FH6A 4O74A 3UVYA 5E0RA 4ZDTA 4NQMA 4PPEA 4QSQA 5D3LA 2FUIA 5KH3A 2YHOA 2L0BA 5B78A 4I7CA 2H0DA 4YH4A 5BT4A 5LKUA 2RSDA 4AYCB 4MENA 2ECGA 2VPGA 2LRIC 3L11A 2KYUA 4IC2A 4QSRA 3QZSA 2M85A 4O7FA 5CY9A 5CQ3A 5ENGA 3P1CA 5FE1A 5HJCA 3PUQA 1HYIA 5E74A 5ENJA 5LVQA 2L84A 4O76A 2DX8A 1ZS5A 4WHWA 4Z93A 5HELA 5FE9A 4UYGA 5L98A 1JSPB 4YATA 2RNYA 3U5KA 5B75A 1E4UA 3MHSA 2G45A 4KV1A 3U5PA 3N9QA 5KO4A 5IGKA 5L99A 3RPGC 4O7EA 4TU4A 5CUCA 4I7BA 3JVMA 2KU3A 2YREA 4PTBA 4QNSA 3IHPA 2LXPC 5A5NA 4CUPA 4YYKA 2LGKA 1WEUA 4HBYA 2OSSA 3TLPA 5EPBA 5F3AA 4A9NA 2KFTA 2ECJA 4CUTA 4QR5A 3DPLR 4J1PA 2LGGA 5B77A 5IGNA 3IU5A 3N9OA 2MJVB 2E3KA 5FERA 2L75A 5FH8A 5D25A 4LYIA 1WIMA 4NRBA 3ZVZB 4CA1A 3P1DA 2YU4A 3JVLA 4NUEA 2Y1MA 1V87A 5DFCA 4YBMA 3ZPVE 3O37A 1WEVA 3U5MA 5C8GA 5EQ1A 2CT2A 3U5JA 5EPRA 5EWHA 5C13A 4AYCA 4NR5A 4NR9A 4CURA 5EICA 2M6MA 5FG6A 4A4CA 1U6GB 5TCMA 3SVGA 4R2YA 4B7YC 5F5ZA 2YW8A 4N4FA 4FIPA 3HMHA 3I3JA 5A81A 2F6JA 4CUUA 3HMEA 4TS8A 5KTXA 2LGLA 5C11A 2E6RA 3AADA 4HXPA 4IOQA 2HDPA 2MD7B 5CPEA 5FG4A 2CKLB 4IR5A 5EVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNI A;  4UYF A;  4L58 A;  2E7N A;  3O35 A;  5COI A;  4LR6 A;  5HCL A;  4YAD A;  2RNW A;  5LKZ A;  2DWW A;  4N4H A;  5E9Y A;  5KTU A;  3DQV R;  3UV4 A;  4TQN A;  2MIQ A;  5D3H A;  2D8S A;  3N9N A;  4QC3 A;  5I7Y A;  2LDR A;  5DKC A;  4WIV A;  5FH7 A;  4DON A;  5D3R A;  4YK0 A;  5H1T A;  1EQF A;  2OO1 A;  5LJ0 A;  1DVP A;  1WES A;  5TRB A;  5DKH A;  4CLB A;  5IGL A;  5EIS A;  4A9O A;  4NRA A;  4QSW A;  5FE7 A;  4GNF A;  5I89 A;  5DX4 A;  5ENF A;  2F6N A;  5E9K A;  4A9H A;  2ECI A;  2IDA A;  4S3O C;  5F1L A;  3SVH A;  5BT5 A;  3FKM X;  4MEP A;  2CSY A;  2D9E A;  4N3W A;  4Q0O A;  5II2 A;  3DAI A;  4OGJ A;  4QSP A;  5CP5 A;  4AKN A;  3GV4 A;  4R7E A;  4UP5 A;  1MM3 A;  5LJ2 A;  5D3J A;  5G05 B;  5KHM A;  5DY7 A;  2GRC A;  4IOR A;  5E9M A;  2QIZ A;  4YYH A;  5HLS A;  2JMI A;  5DKA A;  4NR8 A;  2AN6 A;  4UIW A;  4F52 B;  4MR5 A;  2F42 A;  4QC1 A;  3SOX A;  2LGV A;  4XY9 A;  2G6Q A;  2K16 A;  5I88 A;  5D0C A;  1BOR A;  5EA1 A;  5CTL A;  2CSZ A;  4TU6 A;  4TYL A;  2I8N A;  5I3L A;  3UVW A;  1WEN A;  5HRW A;  5HFR A;  4LK9 A;  4PCI A;  4UIV A;  4UYF B;  4O64 A;  3IU6 A;  5K29 A;  5C7N A;  5FFV A;  5G04 B;  5FE4 A;  5TB6 A;  1X4U A;  1HYJ A;  5II1 A;  1WUG A;  2LQ6 A;  2K1J A;  5FBX A;  4BHW A;  3U5N A;  2JMJ A;  3QZT A;  1RMD A;  4A9E A;  1WE9 A;  2ECW A;  2PUY A;  3QZV A;  4HXK A;  5FG5 A;  4X2I A;  4NRC A;  2YEL A;  5ENI A;  4BW1 A;  4IR6 A;  1FP0 A;  3P1E A;  5LUU A;  3ZVY A;  2YW5 A;  3K2J A;  5A83 A;  4GNE A;  5CRM A;  2JRJ A;  4CFK A;  4HXM A;  5CU8 A;  5L96 A;  3GG3 A;  5IG6 A;  1WIL A;  4IR3 A;  2QJ0 A;  2DVQ A;  3JVJ A;  5ACY A;  2PNX A;  5HQ5 A;  5H1V A;  5FFW A;  5EI4 A;  2YQD A;  5TAB A;  5HEN A;  4J3I A;  5I80 A;  1VFY A;  4B86 C;  4ALG A;  2MT5 A;  5EM3 A;  5E73 A;  4PY6 A;  4Q0N A;  5AD3 A;  5KH9 A;  5FE0 A;  4IR4 A;  2WP2 A;  2R0S A;  4BJX A;  3LXJ A;  3RPG B;  5ETB A;  4A0C D;  4GNG A;  5D1L B;  4NR4 A;  2K4D A;  3ASL A;  5A5P A;  5F36 A;  1WGM A;  5ENC A;  4NR6 A;  5CZG A;  1T1H A;  3KQI A;  1JM7 B;  5AD2 A;  3L1X A;  2YT5 A;  4TZ8 A;  1JM7 A;  4TT4 A;  3T6R A;  5DLX A;  5F62 A;  2MNZ A;  5FFY A;  1N72 A;  4QF2 A;  4ZW1 A;  3C5K A;  4QY4 A;  4Y03 A;  2YYN A;  4HBW A;  5DW1 A;  5ENE A;  3NG2 A;  4R8P K;  4XUA A;  3M99 A;  5HEM A;  4YYG A;  2YQM A;  4UIY A;  4C9Z A;  3L1Z B;  2VJF B;  5IBN A;  1LDJ B;  4HXO A;  4TKP B;  1LDK C;  4BW3 A;  2VJF A;  3PUR A;  4FJC A;  3FL2 A;  2DAT A;  5L8T A;  2R0V A;  4QUU A;  4F3I A;  5L97 A;  1Z6U A;  2YEM A;  5CQ5 A;  4QR4 A;  4UIZ A;  2DVS A;  5CQ8 A;  5D3N A;  2OUO A;  5ETD A;  2C2L A;  2K17 A;  2M3H A;  3UV2 A;  3I2D A;  3ZYU A;  3S92 A;  2KWK A;  5HM0 A;  2KTB B;  5A85 A;  5EPS A;  2YHN A;  3EB6 A;  2YQL A;  4LRG A;  3HCS A;  5E3D A;  4E96 A;  1Z60 A;  4QUT A;  5CUA A;  4UYD A;  5DBM A;  5A5Q A;  4O78 A;  2LSP B;  4LZR A;  4V3L C;  2MD8 C;  2KGI A;  3G0J A;  1VYX A;  4J0S A;  4ALH A;  2H60 A;  2L5E A;  2LN0 A;  5H85 A;  4NYV A;  5ENB A;  5DYX A;  2N9G A;  4HXN A;  4GB0 A;  4L7X A;  2I50 A;  4LZS A;  4FO9 A;  5D3S A;  4XI1 A;  5G0F A;  3Q2E A;  3T7L A;  2H0D B;  3M63 A;  5EU1 A;  3HMF A;  5E7D A;  5A82 A;  2KGG A;  3M62 A;  2RI7 A;  4YYD A;  5CUD A;  4WA6 A;  2YSJ A;  5CQT A;  2JMD A;  3KNV A;  4O7A A;  5FE8 A;  5A7C A;  5BT3 A;  4Q6F A;  4O7B A;  5EK9 A;  5CQA A;  3UVD A;  2LXH C;  5TDR A;  5A5O A;  5HRX A;  4YBS A;  3LQH A;  2C2V S;  4PCE A;  5LKX A;  4IC3 A;  5D24 A;  5EP7 A;  1Z2Q A;  4LAD B;  5CFW A;  4MEO A;  4A9I A;  5LKT A;  1F62 A;  4QEW A;  5I7X A;  2M1R A;  1WEW A;  4UIX A;  3AQA A;  5KH7 A;  3RTR B;  4A9K A;  4O70 A;  4MR6 A;  5CUG A;  4QYL A;  5J3X A;  1XWH A;  2R0Y A;  4NYW A;  3V43 A;  5A5R A;  5EYA F;  4Z1Q A;  5F1H A;  3N9M A;  4AVX A;  2VNF A;  2NAA A;  2XEU A;  5DLZ A;  3LQJ A;  4QSU A;  3EB5 A;  3VK6 A;  2MA5 A;  3HCU A;  3ONI A;  5AIU A;  3UW9 A;  3GL6 A;  5LJ1 A;  4UP0 A;  4QB3 A;  5E3G A;  5KTW A;  5AMF A;  4NR7 A;  2KWN A;  5D3P A;  1WEP A;  5HQ6 A;  1E6I A;  3ZPV 1;  1JM4 B;  4NUD A;  5CQ4 A;  3U5O A;  4WZ0 A;  3SOU A;  1X0J A;  2DVR A;  4NXJ A;  5DYU A;  5DFB A;  2L5U A;  3MXF A;  4N4I A;  4YAB A;  3O36 A;  5JI8 A;  5D7X A;  2LV9 A;  4BBQ A;  5B79 A;  4O72 A;  4A4B A;  4W4U A;  3LQI A;  4A9F A;  4NQN A;  2VJE B;  4A9L A;  3LRQ A;  2RS9 B;  4YYJ A;  5I83 A;  4QZS A;  3MB4 A;  4YH3 A;  1JOC A;  1FBV A;  5FE6 A;  3S91 A;  4UIU A;  5FB1 A;  3Q2F A;  1WEM A;  4MEQ A;  3MHH A;  5CGP A;  5C85 A;  5D26 A;  5DKD A;  1X4I A;  5D3T A;  5EGU A;  3P1F A;  3G0L A;  3SHB A;  5FEY A;  2E6S A;  2MNY A;  2VPB A;  3SOW A;  4C66 A;  4QST A;  5TBN A;  4TT6 A;  2EA6 A;  4ZQL A;  4A9M A;  2KIZ A;  4HXR A;  3D7C A;  5DIN A;  5KU3 A;  2YDW A;  5HQ7 A;  4QSS A;  5FDZ A;  2G43 A;  4XUB A;  5EWW A;  5AME A;  4QEV A;  3U5L A;  4LDF A;  4HBV A;  4CUQ A;  4UYH A;  4YYM A;  5IGM A;  4I7D A;  4YY6 A;  5A5S A;  2VP7 A;  3HCT A;  4RVR A;  2BAY A;  4HXS A;  4N4G A;  5DYC A;  2EOD A;  3KV5 A;  4CL9 A;  3RCW A;  3UV5 A;  5FE2 A;  5JWM A;  2KR4 A;  2L80 A;  3HTK C;  5DFD A;  4MR3 A;  1F68 A;  4YBT A;  4QSV A;  4CCG X;  5F60 A;  2XB1 A;  4NYX A;  2MUM A;  5HRV A;  3MUK A;  5C87 A;  4V3K C;  5TDW A;  1MM2 A;  3N9P A;  3UVX A;  4WZ2 A;  4QR3 A;  3ZTG A;  5G4R A;  2R10 A;  5L8U A;  5E9I A;  2YSM A;  4KCX A;  4XYA A;  4FK5 A;  4CUS A;  5J0D A;  4ZUX U;  5F25 A;  4LYW A;  5CUB A;  1WEO A;  2RO1 A;  1X4J A;  2FSA A;  2E7O A;  2WP1 A;  4IOO A;  4BW4 A;  5H9M A;  5JG6 A;  2NXB A;  3O34 A;  4MR4 A;  3ZYQ A;  4AUQ B;  4XY8 A;  5F2P A;  4UIT A;  2ZET C;  2FUU A;  3KV6 A;  4PKL A;  1WFK A;  1ZBD B;  4WHU A;  2ECN A;  2HYE D;  3O33 A;  4CFL A;  1G25 A;  4GPJ A;  3C6W A;  5D1M B;  4YC9 A;  5CRZ A;  4S3O B;  2YYR A;  5B76 A;  2UZG A;  4QSX A;  3P5O A;  4HBX A;  3O7A A;  4X3G A;  4LKA A;  4UYE A;  3NXB A;  4NS5 A;  3N9L A;  2KWO A;  2DVV A;  4LLB A;  5LCW B;  4OUF A;  4O75 A;  5FE5 A;  1WEE A;  4LC2 A;  2Y1N A;  4YYN A;  4QF3 A;  4AP4 A;  4LZ2 A;  3O70 A;  1N87 A;  1WEQ A;  5DW2 A;  5I40 A;  2G4A A;  1K2F A;  4YAX A;  5E9L A;  5EV9 A;  2L43 A;  2RFJ A;  2VJE A;  1CHC A;  4LJN A;  4ZC9 A;  4NUC A;  1IYM A;  5EWC A;  3MQM A;  4P5O B;  4C67 A;  3MUL A;  5IID A;  3DWY A;  4TT2 A;  3SVF A;  4YY4 A;  5H1U A;  2I7K A;  5I86 A;  4TTE A;  5F61 A;  2YUC A;  2KE1 A;  2ECV A;  5EWD A;  5D1K B;  4QYD A;  2Y43 A;  2DKW A;  5FB0 A;  5HFQ A;  4HXL A;  5I29 A;  4Z1S A;  2KRE A;  4TZ2 A;  2ECT A;  4LYS A;  5AIT A;  2OXQ C;  2L85 A;  4A9J A;  2RNX A;  4QEU A;  5CUE A;  4MVT A;  2QIC A;  4O7C A;  5I1Q A;  5CQ6 A;  3MB3 A;  4UI9 B;  4O77 A;  5C4Q A;  1VD4 A;  4KV4 A;  4BW2 A;  3PHD A;  5FE3 A;  5CQ7 A;  5E9V A;  2CKL A;  3LJW A;  2VPD A;  4Z6H A;  4QBM A;  2KWJ A;  4GND A;  5ENH A;  4OGI A;  4PS5 A;  2VPE A;  5F63 A;  4YYI A;  5EWV A;  2YUR A;  4MSX A;  5LVR A;  4A49 A;  5CS8 A;  4J0R A;  4FLP A;  5B8D A;  2D82 A;  2MA6 A;  5DYA A;  4O71 A;  3JVK A;  4WZ3 B;  4NN2 A;  2EGP A;  5G4S A;  1WUM A;  4Z6I A;  5C89 A;  2YEK A;  5FH6 A;  4O74 A;  3UVY A;  5E0R A;  4ZDT A;  4NQM A;  4PPE A;  4QSQ A;  5D3L A;  2FUI A;  5KH3 A;  2YHO A;  2L0B A;  5B78 A;  4I7C A;  2H0D A;  4YH4 A;  5BT4 A;  5LKU A;  2RSD A;  4AYC B;  4MEN A;  2ECG A;  2VPG A;  2LRI C;  3L11 A;  2KYU A;  4IC2 A;  4QSR A;  3QZS A;  2M85 A;  4O7F A;  5CY9 A;  5CQ3 A;  5ENG A;  3P1C A;  5FE1 A;  5HJC A;  3PUQ A;  1HYI A;  5E74 A;  5ENJ A;  5LVQ A;  2L84 A;  4O76 A;  2DX8 A;  1ZS5 A;  4WHW A;  4Z93 A;  5HEL A;  5FE9 A;  4UYG A;  5L98 A;  1JSP B;  4YAT A;  2RNY A;  3U5K A;  5B75 A;  1E4U A;  3MHS A;  2G45 A;  4KV1 A;  3U5P A;  3N9Q A;  5KO4 A;  5IGK A;  5L99 A;  3RPG C;  4O7E A;  4TU4 A;  5CUC A;  4I7B A;  3JVM A;  2KU3 A;  2YRE A;  4PTB A;  4QNS A;  3IHP A;  2LXP C;  5A5N A;  4CUP A;  4YYK A;  2LGK A;  1WEU A;  4HBY A;  2OSS A;  3TLP A;  5EPB A;  5F3A A;  4A9N A;  2KFT A;  2ECJ A;  4CUT A;  4QR5 A;  3DPL R;  4J1P A;  2LGG A;  5B77 A;  5IGN A;  3IU5 A;  3N9O A;  2MJV B;  2E3K A;  5FER A;  2L75 A;  5FH8 A;  5D25 A;  4LYI A;  1WIM A;  4NRB A;  3ZVZ B;  4CA1 A;  3P1D A;  2YU4 A;  3JVL A;  4NUE A;  2Y1M A;  1V87 A;  5DFC A;  4YBM A;  3ZPV E;  3O37 A;  1WEV A;  3U5M A;  5C8G A;  5EQ1 A;  2CT2 A;  3U5J A;  5EPR A;  5EWH A;  5C13 A;  4AYC A;  4NR5 A;  4NR9 A;  4CUR A;  5EIC A;  2M6M A;  5FG6 A;  4A4C A;  1U6G B;  5TCM A;  3SVG A;  4R2Y A;  4B7Y C;  5F5Z A;  2YW8 A;  4N4F A;  4FIP A;  3HMH A;  3I3J A;  5A81 A;  2F6J A;  4CUU A;  3HME A;  4TS8 A;  5KTX A;  2LGL A;  5C11 A;  2E6R A;  3AAD A;  4HXP A;  4IOQ A;  2HDP A;  2MD7 B;  5CPE A;  5FG4 A;  2CKL B;  4IR5 A;  5EVA A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  4UYF A;  4L58 A;  2E7N A;  3O35 A;  5COI A;  3DWD A;  4LR6 A;  5HCL A;  4YAD A;  2RNW A;  5LKZ A;  2DWW A;  4N4H A;  5E9Y A;  5KTU A;  3DQV R;  3UV4 A;  4TQN A;  2MIQ A;  5D3H A;  2D8S A;  3N9N A;  4QC3 A;  5I7Y A;  2EJN A;  5DKC A;  2LDR A;  4WIV A;  5FH7 A;  4DON A;  5D3R A;  4YK0 A;  5H1T A;  1EQF A;  2OO1 A;  5LJ0 A;  1DVP A;  1WES A;  4Z0R A;  5TRB A;  5DKH A;  4CLB A;  5IGL A;  5EIS A;  4A9O A;  4NRA A;  4QSW A;  5FE7 A;  4OGE A;  4GNF A;  5I89 A;  5DX4 A;  5ENF A;  2F6N A;  5E9K A;  4A9H A;  2ECI A;  2IDA A;  4S3O C;  3FAN A;  5F1L A;  3SVH A;  5BT5 A;  3FKM X;  4MEP A;  2CSY A;  2D9E A;  4N3W A;  4Q0O A;  5II2 A;  3DAI A;  4OGJ A;  4QSP A;  5CP5 A;  4AKN A;  2DSM A;  2KKX A;  2OWA A;  3GV4 A;  4R7E A;  1MM3 A;  4UP5 A;  5LJ2 A;  5D3J A;  5G05 B;  5KHM A;  5DY7 A;  2GRC A;  4IOR A;  5E9M A;  2QIZ A;  4OGC A;  4YYH A;  2FD4 A;  5HLS A;  2JMI A;  5DKA A;  4NR8 A;  2AN6 A;  4UIW A;  4F52 B;  4MR5 A;  2F42 A;  4QC1 A;  3SOX A;  2LGV A;  4XY9 A;  2G6Q A;  2K16 A;  5I88 A;  5D0C A;  1BOR A;  5EA1 A;  5CTL A;  2CSZ A;  4TU6 A;  4TYL A;  2I8N A;  5I3L A;  3UVW A;  1WEN A;  5HRW A;  5HFR A;  4LK9 A;  4PCI A;  4UIV A;  5SVY A;  4UYF B;  4O64 A;  3IU6 A;  5K29 A;  5C7N A;  5FFV A;  5G04 B;  5FE4 A;  5TB6 A;  2KKY A;  1X4U A;  1HYJ A;  5II1 A;  1WUG A;  2LQ6 A;  4QQ4 A;  2K1J A;  3FJU B;  5FBX A;  4BHW A;  3U5N A;  2JMJ A;  3QZT A;  1RMD A;  4A9E A;  1WE9 A;  2ECW A;  2PUY A;  3QZV A;  4HXK A;  5FG5 A;  4X2I A;  4NRC A;  2YEL A;  5ENI A;  4BW1 A;  4IR6 A;  1FP0 A;  3P1E A;  5LUU A;  3ZVY A;  2YW5 A;  3K2J A;  2MKE A;  2CRW A;  5A83 A;  4GNE A;  5CRM A;  2JRJ A;  4CFK A;  4HXM A;  5CU8 A;  5L96 A;  3GG3 A;  5IG6 A;  1WIL A;  4IR3 A;  2QJ0 A;  2XP0 A;  2DVQ A;  3JVJ A;  5ACY A;  2L7P A;  2PNX A;  5HQ5 A;  5H1V A;  5FFW A;  5EI4 A;  2YQD A;  5TAB A;  5HEN A;  4J3I A;  5I80 A;  2EGM A;  1VFY A;  2JM3 A;  4B86 C;  4ALG A;  2MT5 A;  5EM3 A;  5E73 A;  4PY6 A;  4Q0N A;  5AD3 A;  5KH9 A;  5FE0 A;  4IR4 A;  2B0O E;  2WP2 A;  2R0S A;  4BJX A;  3LXJ A;  3RPG B;  5ETB A;  3FM8 C;  4A0C D;  4GNG A;  5D1L B;  4NR4 A;  2E61 A;  2K4D A;  3ASL A;  5A5P A;  5F36 A;  1WGM A;  4F1P A;  5ENC A;  4NR6 A;  5CZG A;  1T1H A;  3KQI A;  1JM7 B;  5AD2 A;  3L1X A;  2YT5 A;  4TZ8 A;  1JM7 A;  4TT4 A;  3T6R A;  5DLX A;  5F62 A;  2MNZ A;  5FFY A;  1N72 A;  4QF2 A;  4ZW1 A;  3C5K A;  4QY4 A;  4Y03 A;  2YYN A;  4HBW A;  5DW1 A;  5ENE A;  3NG2 A;  4R8P K;  4XUA A;  3M99 A;  2IQJ A;  5HEM A;  4YYG A;  2JUN A;  2YQM A;  4UIY A;  4C9Z A;  3L1Z B;  2VJF B;  5IBN A;  1LDJ B;  4HXO A;  4TKP B;  1LDK C;  4BW3 A;  2VJF A;  3PUR A;  4FJC A;  3FL2 A;  2DAT A;  5L8T A;  2R0V A;  4QUU A;  4F3I A;  5L97 A;  1Z6U A;  3KDE C;  2YEM A;  5CQ5 A;  4QR4 A;  4UIZ A;  2DVS A;  5CQ8 A;  5D3N A;  2OUO A;  5ETD A;  2C2L A;  2K17 A;  2M3H A;  3UV2 A;  4AKI A;  3ZYU A;  3S92 A;  2KWK A;  5HM0 A;  2KTB B;  5A85 A;  5EPS A;  1DCQ A;  2YHN A;  3EB6 A;  2YQL A;  4LRG A;  3HCS A;  5E3D A;  4E96 A;  1Z60 A;  4QUT A;  5CUA A;  4UYD A;  5DBM A;  5A5Q A;  4O78 A;  2LSP B;  4LZR A;  4V3L C;  2MD8 C;  2KGI A;  3G0J A;  1VYX A;  4J0S A;  4ALH A;  2H60 A;  2L5E A;  2LN0 A;  5H85 A;  4NYV A;  5ENB A;  5DYX A;  2N9G A;  4HXN A;  4GB0 A;  4L7X A;  2I50 A;  4LZS A;  4FO9 A;  5D3S A;  4XI1 A;  5G0F A;  5SVI A;  3Q2E A;  3T7L A;  2H0D B;  3M63 A;  3D1D A;  5EU1 A;  3HMF A;  5E7D A;  5A82 A;  2KGG A;  2M13 A;  3M62 A;  2RI7 A;  4YYD A;  5CUD A;  4WA6 A;  2YSJ A;  5CQT A;  2JMD A;  3KNV A;  4O7A A;  5FE8 A;  5A7C A;  5BT3 A;  3DDT A;  4Q6F A;  4O7B A;  5EK9 A;  5CQA A;  3UVD A;  2LXH C;  5TDR A;  5A5O A;  5HRX A;  4YBS A;  4AI6 A;  3D1B A;  3LQH A;  2C2V S;  4PCE A;  5LKX A;  4IC3 A;  5D24 A;  5EP7 A;  1Z2Q A;  4LAD B;  5CFW A;  4MEO A;  4A9I A;  5LKT A;  1F62 A;  4QEW A;  5I7X A;  2M1R A;  1WEW A;  4UIX A;  3AQA A;  5KH7 A;  3RTR B;  4A9K A;  2D8U A;  4O70 A;  4MR6 A;  5CUG A;  4QYL A;  5J3X A;  1XWH A;  2R0Y A;  4NYW A;  3V43 A;  5A5R A;  5EYA F;  4Z1Q A;  5F1H A;  3N9M A;  4AVX A;  2VNF A;  2NAA A;  2XEU A;  5DLZ A;  3LQJ A;  4QSU A;  3EB5 A;  3VK6 A;  2MA5 A;  3HCU A;  3ONI A;  5AIU A;  3UW9 A;  3GL6 A;  5LJ1 A;  4UP0 A;  4QB3 A;  5E3G A;  5KTW A;  5AMF A;  4NR7 A;  2KWN A;  5D3P A;  1WEP A;  5HQ6 A;  1E6I A;  3ZPV 1;  3PLW A;  1JM4 B;  3E2D A;  4NUD A;  5CQ4 A;  3U5O A;  3O47 A;  4WZ0 A;  3SOU A;  1X0J A;  2DVR A;  4NXJ A;  5DYU A;  5DFB A;  3VKG A;  2L5U A;  3MXF A;  4N4I A;  4YAB A;  3O36 A;  5JI8 A;  1MBM A;  5D7X A;  2LV9 A;  4BBQ A;  5B79 A;  4O72 A;  4A4B A;  4W4U A;  3LQI A;  4A9F A;  4NQN A;  2VJE B;  4A9L A;  3LRQ A;  3LVQ E;  2RS9 B;  2FFW A;  4YYJ A;  5I83 A;  4QZS A;  3MB4 A;  4YH3 A;  1JOC A;  1FBV A;  5FE6 A;  3S91 A;  4UIU A;  1PUO A;  5FB1 A;  3Q2F A;  1WEM A;  4MEQ A;  3MHH A;  5CGP A;  5C85 A;  5D26 A;  5DKD A;  1X4I A;  5D3T A;  5EGU A;  3P1F A;  3G0L A;  3SHB A;  5FEY A;  2E6S A;  2MNY A;  2VPB A;  3SOW A;  4C66 A;  5K3Q A;  4QST A;  5TBN A;  4TT6 A;  3VKH A;  2EA6 A;  5SVX A;  4ZQL A;  4A9M A;  2KIZ A;  4HXR A;  3D7C A;  3MDB C;  5DIN A;  5KU3 A;  2YDW A;  5HQ7 A;  4QSS A;  5FDZ A;  2G43 A;  4XUB A;  5EWW A;  5AME A;  4QEV A;  3U5L A;  2YVR A;  4LDF A;  4HBV A;  4CUQ A;  4UYH A;  4YYM A;  5IGM A;  3LVR E;  4I7D A;  4YY6 A;  5A5S A;  2VP7 A;  3HCT A;  4RVR A;  2BAY A;  4HXS A;  4N4G A;  5DYC A;  2EOD A;  3KV5 A;  3Q1D A;  4CL9 A;  3RCW A;  3UV5 A;  5FE2 A;  5JWM A;  2KR4 A;  2L80 A;  3HTK C;  5DFD A;  4MR3 A;  1F68 A;  4YBT A;  4QSV A;  4CCG X;  5F60 A;  2XB1 A;  4NYX A;  2MUM A;  5HRV A;  3MUK A;  5C87 A;  4V3K C;  3M7K A;  5TDW A;  1MM2 A;  3N9P A;  3UVX A;  4WZ2 A;  4QR3 A;  3ZTG A;  5G4R A;  2R10 A;  5L8U A;  5E9I A;  2CRR A;  2YSM A;  4KCX A;  4XYA A;  4FK5 A;  4CUS A;  5J0D A;  4ZUX U;  5F25 A;  4LYW A;  5CUB A;  1WEO A;  2RO1 A;  1X4J A;  2FSA A;  2E7O A;  2WP1 A;  4IOO A;  4BW4 A;  5H9M A;  5JG6 A;  2NXB A;  3O34 A;  4MR4 A;  3ZYQ A;  4AUQ B;  4XY8 A;  5F2P A;  4UIT A;  2ZET C;  2FUU A;  3KV6 A;  4PKL A;  4O62 A;  1WFK A;  1ZBD B;  4WHU A;  2ECN A;  3SUB A;  2HYE D;  3O33 A;  4CFL A;  1G25 A;  4GPJ A;  3C6W A;  5D1M B;  4YC9 A;  5CRZ A;  4S3O B;  2YYR A;  5B76 A;  2UZG A;  4QSX A;  3P5O A;  4HBX A;  3O7A A;  4X3G A;  4LKA A;  4UYE A;  3NXB A;  4NS5 A;  3LJU X;  2KWO A;  2DVV A;  3N9L A;  4LLB A;  5LCW B;  3JUE A;  4OUF A;  4O75 A;  5FE5 A;  1WEE A;  4LC2 A;  2Y1N A;  4YYN A;  4QF3 A;  4AP4 A;  4LZ2 A;  3O70 A;  1N87 A;  1WEQ A;  5DW2 A;  5I40 A;  2G4A A;  1K2F A;  4YAX A;  5E9L A;  5EV9 A;  4AKG A;  2L43 A;  2RFJ A;  2VJE A;  1CHC A;  4LJN A;  4ZC9 A;  4NUC A;  1IYM A;  5EWC A;  3MQM A;  4P5O B;  4C67 A;  2XOC A;  3MUL A;  5IID A;  3DWY A;  4TT2 A;  3SVF A;  4YY4 A;  5H1U A;  2I7K A;  5I86 A;  4TTE A;  5F61 A;  2YUC A;  2KE1 A;  2ECV A;  5EWD A;  5D1K B;  4QYD A;  2Y43 A;  2DKW A;  5FB0 A;  5HFQ A;  4H9D A;  4HXL A;  5I29 A;  4Z1S A;  2KRE A;  4TZ2 A;  2ECT A;  4LYS A;  5AIT A;  2OXQ C;  2L85 A;  4A9J A;  2RNX A;  4QEU A;  5CUE A;  4MVT A;  2QIC A;  4O7C A;  5I1Q A;  5CQ6 A;  3MB3 A;  4UI9 B;  4O77 A;  5C4Q A;  1VD4 A;  4KV4 A;  4BW2 A;  3PHD A;  5FE3 A;  4Z0O A;  5CQ7 A;  5E9V A;  2CKL A;  3LJW A;  2VPD A;  4Z6H A;  4QBM A;  2KWJ A;  4GND A;  5ENH A;  4OGI A;  2P57 A;  4PS5 A;  2EXU A;  5F63 A;  2DJA A;  2VPE A;  4YYI A;  5EWV A;  2YUR A;  3FAO A;  4MSX A;  5LVR A;  4A49 A;  5CS8 A;  4J0R A;  4FLP A;  5B8D A;  2D82 A;  2MA6 A;  5DYA A;  4O71 A;  3JVK A;  4WZ3 B;  4NN2 A;  2EGP A;  5G4S A;  1WUM A;  4Z6I A;  5C89 A;  2YEK A;  5FH6 A;  4AKH A;  4O74 A;  3UVY A;  5E0R A;  4ZDT A;  4NQM A;  3LDY A;  4PPE A;  4QSQ A;  5D3L A;  2FUI A;  5KH3 A;  2YHO A;  2L0B A;  5B78 A;  4I7C A;  2H0D A;  4YH4 A;  5BT4 A;  5LKU A;  2RSD A;  4AYC B;  4MEN A;  2ECG A;  2VPG A;  2LRI C;  3L11 A;  2KYU A;  4IC2 A;  4QSR A;  3QZS A;  2M85 A;  4O7F A;  5CY9 A;  5CQ3 A;  5ENG A;  3P1C A;  5FE1 A;  5HJC A;  3PUQ A;  1HYI A;  5E74 A;  5ENJ A;  2CSV A;  5LVQ A;  2L84 A;  4O76 A;  2DX8 A;  1ZS5 A;  4WHW A;  4Z93 A;  5HEL A;  5FE9 A;  4UYG A;  5L98 A;  1JSP B;  4YAT A;  2RNY A;  3U5K A;  5B75 A;  1E4U A;  3MHS A;  2G45 A;  2XOZ A;  4KV1 A;  3U5P A;  3N9Q A;  5KO4 A;  5IGK A;  5L99 A;  3H7H A;  3RPG C;  4O7E A;  1ZKR A;  4TU4 A;  5CUC A;  3JVM A;  2KU3 A;  3I2D A;  4I7B A;  2YRE A;  4PTB A;  4QNS A;  3FEH A;  3IHP A;  2RR4 A;  2LXP C;  5A5N A;  4CUP A;  4YYK A;  2LGK A;  1WEU A;  4HBY A;  2CON A;  2OSS A;  3TLP A;  3ERR A;  5EPB A;  5F3A A;  4A9N A;  2KFT A;  2ECJ A;  4CUT A;  4QR5 A;  3DPL R;  4J1P A;  2LGG A;  5B77 A;  5IGN A;  3IU5 A;  3N9O A;  2MJV B;  2E3K A;  5FER A;  2L75 A;  5FH8 A;  5D25 A;  4LYI A;  1WIM A;  4NRB A;  3ZVZ B;  4CA1 A;  3T9K A;  3P1D A;  2YU4 A;  3JVL A;  4NUE A;  2Y1M A;  1V87 A;  5DFC A;  4YBM A;  3ZPV E;  3O37 A;  2XOY A;  1WEV A;  3U5M A;  5C8G A;  5EQ1 A;  2CT2 A;  3U5J A;  5EPR A;  5EWH A;  5SVI B;  5C13 A;  4AYC A;  4NR5 A;  4NR9 A;  4CUR A;  5EIC A;  2M6M A;  5FG6 A;  4A4C A;  1U6G B;  5TCM A;  3SVG A;  4R2Y A;  4B7Y C;  5F5Z A;  2YW8 A;  4N4F A;  4FIP A;  3HMH A;  3I3J A;  5A81 A;  2LAU A;  2F6J A;  4CUU A;  3HME A;  4TS8 A;  5KTX A;  2LGL A;  5C11 A;  2E6R A;  3AAD A;  4HXP A;  4IOQ A;  2HDP A;  2MD7 B;  5CPE A;  5FG4 A;  2CKL B;  4IR5 A;  5EVA A; 
#chains in the Genus database with same CATH homology
 3ZNI A;  4UYF A;  4L58 A;  2E7N A;  3O35 A;  5COI A;  4LR6 A;  5HCL A;  4YAD A;  2RNW A;  5LKZ A;  2DWW A;  4N4H A;  5E9Y A;  5KTU A;  3DQV R;  3UV4 A;  4TQN A;  2MIQ A;  5D3H A;  2D8S A;  3N9N A;  4QC3 A;  5I7Y A;  2LDR A;  5DKC A;  4WIV A;  5FH7 A;  4DON A;  5D3R A;  4YK0 A;  5H1T A;  1EQF A;  2OO1 A;  5LJ0 A;  1DVP A;  1WES A;  5TRB A;  5DKH A;  4CLB A;  5IGL A;  5EIS A;  4A9O A;  4NRA A;  4QSW A;  5FE7 A;  4GNF A;  5I89 A;  5DX4 A;  5ENF A;  2F6N A;  5E9K A;  4A9H A;  2ECI A;  2IDA A;  4S3O C;  5F1L A;  3SVH A;  5BT5 A;  3FKM X;  4MEP A;  2CSY A;  2D9E A;  4N3W A;  4Q0O A;  5II2 A;  3DAI A;  4OGJ A;  4QSP A;  5CP5 A;  4AKN A;  3GV4 A;  4R7E A;  4UP5 A;  1MM3 A;  5LJ2 A;  5D3J A;  5G05 B;  5KHM A;  5DY7 A;  2GRC A;  4IOR A;  5E9M A;  2QIZ A;  4YYH A;  5HLS A;  2JMI A;  5DKA A;  4NR8 A;  2AN6 A;  4UIW A;  4F52 B;  4MR5 A;  2F42 A;  4QC1 A;  3SOX A;  2LGV A;  4XY9 A;  2G6Q A;  2K16 A;  5I88 A;  5D0C A;  1BOR A;  5EA1 A;  5CTL A;  2CSZ A;  4TU6 A;  4TYL A;  2I8N A;  5I3L A;  3UVW A;  1WEN A;  5HRW A;  5HFR A;  4LK9 A;  4PCI A;  4UIV A;  4UYF B;  4O64 A;  3IU6 A;  5K29 A;  5C7N A;  5FFV A;  5G04 B;  5FE4 A;  5TB6 A;  1X4U A;  1HYJ A;  5II1 A;  1WUG A;  2LQ6 A;  2K1J A;  5FBX A;  4BHW A;  3U5N A;  2JMJ A;  3QZT A;  1RMD A;  4A9E A;  1WE9 A;  2ECW A;  2PUY A;  3QZV A;  4HXK A;  5FG5 A;  4X2I A;  4NRC A;  2YEL A;  5ENI A;  4BW1 A;  4IR6 A;  1FP0 A;  3P1E A;  5LUU A;  3ZVY A;  2YW5 A;  3K2J A;  5A83 A;  4GNE A;  5CRM A;  2JRJ A;  4CFK A;  4HXM A;  5CU8 A;  5L96 A;  3GG3 A;  5IG6 A;  1WIL A;  4IR3 A;  2QJ0 A;  2DVQ A;  3JVJ A;  5ACY A;  2PNX A;  5HQ5 A;  5H1V A;  5FFW A;  5EI4 A;  2YQD A;  5TAB A;  5HEN A;  4J3I A;  5I80 A;  1VFY A;  4B86 C;  4ALG A;  2MT5 A;  5EM3 A;  5E73 A;  4PY6 A;  4Q0N A;  5AD3 A;  5KH9 A;  5FE0 A;  4IR4 A;  2WP2 A;  2R0S A;  4BJX A;  3LXJ A;  3RPG B;  5ETB A;  4A0C D;  4GNG A;  5D1L B;  4NR4 A;  2K4D A;  3ASL A;  5A5P A;  5F36 A;  1WGM A;  5ENC A;  4NR6 A;  5CZG A;  1T1H A;  3KQI A;  1JM7 B;  5AD2 A;  3L1X A;  2YT5 A;  4TZ8 A;  1JM7 A;  4TT4 A;  3T6R A;  5DLX A;  5F62 A;  2MNZ A;  5FFY A;  1N72 A;  4QF2 A;  4ZW1 A;  3C5K A;  4QY4 A;  4Y03 A;  2YYN A;  4HBW A;  5DW1 A;  5ENE A;  3NG2 A;  4R8P K;  4XUA A;  3M99 A;  5HEM A;  4YYG A;  2YQM A;  4UIY A;  4C9Z A;  3L1Z B;  2VJF B;  5IBN A;  1LDJ B;  4HXO A;  4TKP B;  1LDK C;  4BW3 A;  2VJF A;  3PUR A;  4FJC A;  3FL2 A;  2DAT A;  5L8T A;  2R0V A;  4QUU A;  4F3I A;  5L97 A;  1Z6U A;  2YEM A;  5CQ5 A;  4QR4 A;  4UIZ A;  2DVS A;  5CQ8 A;  5D3N A;  2OUO A;  5ETD A;  2C2L A;  2K17 A;  2M3H A;  3UV2 A;  3I2D A;  3ZYU A;  3S92 A;  2KWK A;  5HM0 A;  2KTB B;  5A85 A;  5EPS A;  2YHN A;  3EB6 A;  2YQL A;  4LRG A;  3HCS A;  5E3D A;  4E96 A;  1Z60 A;  4QUT A;  5CUA A;  4UYD A;  5DBM A;  5A5Q A;  4O78 A;  2LSP B;  4LZR A;  4V3L C;  2MD8 C;  2KGI A;  3G0J A;  1VYX A;  4J0S A;  4ALH A;  2H60 A;  2L5E A;  2LN0 A;  5H85 A;  4NYV A;  5ENB A;  5DYX A;  2N9G A;  4HXN A;  4GB0 A;  4L7X A;  2I50 A;  4LZS A;  4FO9 A;  5D3S A;  4XI1 A;  5G0F A;  3Q2E A;  3T7L A;  2H0D B;  3M63 A;  5EU1 A;  3HMF A;  5E7D A;  5A82 A;  2KGG A;  3M62 A;  2RI7 A;  4YYD A;  5CUD A;  4WA6 A;  2YSJ A;  5CQT A;  2JMD A;  3KNV A;  4O7A A;  5FE8 A;  5A7C A;  5BT3 A;  4Q6F A;  4O7B A;  5EK9 A;  5CQA A;  3UVD A;  2LXH C;  5TDR A;  5A5O A;  5HRX A;  4YBS A;  3LQH A;  2C2V S;  4PCE A;  5LKX A;  4IC3 A;  5D24 A;  5EP7 A;  1Z2Q A;  4LAD B;  5CFW A;  4MEO A;  4A9I A;  5LKT A;  1F62 A;  4QEW A;  5I7X A;  2M1R A;  1WEW A;  4UIX A;  3AQA A;  5KH7 A;  3RTR B;  4A9K A;  4O70 A;  4MR6 A;  5CUG A;  4QYL A;  5J3X A;  1XWH A;  2R0Y A;  4NYW A;  3V43 A;  5A5R A;  5EYA F;  4Z1Q A;  5F1H A;  3N9M A;  4AVX A;  2VNF A;  2NAA A;  2XEU A;  5DLZ A;  3LQJ A;  4QSU A;  3EB5 A;  3VK6 A;  2MA5 A;  3HCU A;  3ONI A;  5AIU A;  3UW9 A;  3GL6 A;  5LJ1 A;  4UP0 A;  4QB3 A;  5E3G A;  5KTW A;  5AMF A;  4NR7 A;  2KWN A;  5D3P A;  1WEP A;  5HQ6 A;  1E6I A;  3ZPV 1;  1JM4 B;  4NUD A;  5CQ4 A;  3U5O A;  4WZ0 A;  3SOU A;  1X0J A;  2DVR A;  4NXJ A;  5DYU A;  5DFB A;  2L5U A;  3MXF A;  4N4I A;  4YAB A;  3O36 A;  5JI8 A;  5D7X A;  2LV9 A;  4BBQ A;  5B79 A;  4O72 A;  4A4B A;  4W4U A;  3LQI A;  4A9F A;  4NQN A;  2VJE B;  4A9L A;  3LRQ A;  2RS9 B;  4YYJ A;  5I83 A;  4QZS A;  3MB4 A;  4YH3 A;  1JOC A;  1FBV A;  5FE6 A;  3S91 A;  4UIU A;  5FB1 A;  3Q2F A;  1WEM A;  4MEQ A;  3MHH A;  5CGP A;  5C85 A;  5D26 A;  5DKD A;  1X4I A;  5D3T A;  5EGU A;  3P1F A;  3G0L A;  3SHB A;  5FEY A;  2E6S A;  2MNY A;  2VPB A;  3SOW A;  4C66 A;  4QST A;  5TBN A;  4TT6 A;  2EA6 A;  4ZQL A;  4A9M A;  2KIZ A;  4HXR A;  3D7C A;  5DIN A;  5KU3 A;  2YDW A;  5HQ7 A;  4QSS A;  5FDZ A;  2G43 A;  4XUB A;  5EWW A;  5AME A;  4QEV A;  3U5L A;  4LDF A;  4HBV A;  4CUQ A;  4UYH A;  4YYM A;  5IGM A;  4I7D A;  4YY6 A;  5A5S A;  2VP7 A;  3HCT A;  4RVR A;  2BAY A;  4HXS A;  4N4G A;  5DYC A;  2EOD A;  3KV5 A;  4CL9 A;  3RCW A;  3UV5 A;  5FE2 A;  5JWM A;  2KR4 A;  2L80 A;  3HTK C;  5DFD A;  4MR3 A;  1F68 A;  4YBT A;  4QSV A;  4CCG X;  5F60 A;  2XB1 A;  4NYX A;  2MUM A;  5HRV A;  3MUK A;  5C87 A;  4V3K C;  5TDW A;  1MM2 A;  3N9P A;  3UVX A;  4WZ2 A;  4QR3 A;  3ZTG A;  5G4R A;  2R10 A;  5L8U A;  5E9I A;  2YSM A;  4KCX A;  4XYA A;  4FK5 A;  4CUS A;  5J0D A;  4ZUX U;  5F25 A;  4LYW A;  5CUB A;  1WEO A;  2RO1 A;  1X4J A;  2FSA A;  2E7O A;  2WP1 A;  4IOO A;  4BW4 A;  5H9M A;  5JG6 A;  2NXB A;  3O34 A;  4MR4 A;  3ZYQ A;  4AUQ B;  4XY8 A;  5F2P A;  4UIT A;  2ZET C;  2FUU A;  3KV6 A;  4PKL A;  1WFK A;  1ZBD B;  4WHU A;  2ECN A;  2HYE D;  3O33 A;  4CFL A;  1G25 A;  4GPJ A;  3C6W A;  5D1M B;  4YC9 A;  5CRZ A;  4S3O B;  2YYR A;  5B76 A;  2UZG A;  4QSX A;  3P5O A;  4HBX A;  3O7A A;  4X3G A;  4LKA A;  4UYE A;  3NXB A;  4NS5 A;  3N9L A;  2KWO A;  2DVV A;  4LLB A;  5LCW B;  4OUF A;  4O75 A;  5FE5 A;  1WEE A;  4LC2 A;  2Y1N A;  4YYN A;  4QF3 A;  4AP4 A;  4LZ2 A;  3O70 A;  1N87 A;  1WEQ A;  5DW2 A;  5I40 A;  2G4A A;  1K2F A;  4YAX A;  5E9L A;  5EV9 A;  2L43 A;  2RFJ A;  2VJE A;  1CHC A;  4LJN A;  4ZC9 A;  4NUC A;  1IYM A;  5EWC A;  3MQM A;  4P5O B;  4C67 A;  3MUL A;  5IID A;  3DWY A;  4TT2 A;  3SVF A;  4YY4 A;  5H1U A;  2I7K A;  5I86 A;  4TTE A;  5F61 A;  2YUC A;  2KE1 A;  2ECV A;  5EWD A;  5D1K B;  4QYD A;  2Y43 A;  2DKW A;  5FB0 A;  5HFQ A;  4HXL A;  5I29 A;  4Z1S A;  2KRE A;  4TZ2 A;  2ECT A;  4LYS A;  5AIT A;  2OXQ C;  2L85 A;  4A9J A;  2RNX A;  4QEU A;  5CUE A;  4MVT A;  2QIC A;  4O7C A;  5I1Q A;  5CQ6 A;  3MB3 A;  4UI9 B;  4O77 A;  5C4Q A;  1VD4 A;  4KV4 A;  4BW2 A;  3PHD A;  5FE3 A;  5CQ7 A;  5E9V A;  2CKL A;  3LJW A;  2VPD A;  4Z6H A;  4QBM A;  2KWJ A;  4GND A;  5ENH A;  4OGI A;  4PS5 A;  2VPE A;  5F63 A;  4YYI A;  5EWV A;  2YUR A;  4MSX A;  5LVR A;  4A49 A;  5CS8 A;  4J0R A;  4FLP A;  5B8D A;  2D82 A;  2MA6 A;  5DYA A;  4O71 A;  3JVK A;  4WZ3 B;  4NN2 A;  2EGP A;  5G4S A;  1WUM A;  4Z6I A;  5C89 A;  2YEK A;  5FH6 A;  4O74 A;  3UVY A;  5E0R A;  4ZDT A;  4NQM A;  4PPE A;  4QSQ A;  5D3L A;  2FUI A;  5KH3 A;  2YHO A;  2L0B A;  5B78 A;  4I7C A;  2H0D A;  4YH4 A;  5BT4 A;  5LKU A;  2RSD A;  4AYC B;  4MEN A;  2ECG A;  2VPG A;  2LRI C;  3L11 A;  2KYU A;  4IC2 A;  4QSR A;  3QZS A;  2M85 A;  4O7F A;  5CY9 A;  5CQ3 A;  5ENG A;  3P1C A;  5FE1 A;  5HJC A;  3PUQ A;  1HYI A;  5E74 A;  5ENJ A;  5LVQ A;  2L84 A;  4O76 A;  2DX8 A;  1ZS5 A;  4WHW A;  4Z93 A;  5HEL A;  5FE9 A;  4UYG A;  5L98 A;  1JSP B;  4YAT A;  2RNY A;  3U5K A;  5B75 A;  1E4U A;  3MHS A;  2G45 A;  4KV1 A;  3U5P A;  3N9Q A;  5KO4 A;  5IGK A;  5L99 A;  3RPG C;  4O7E A;  4TU4 A;  5CUC A;  4I7B A;  3JVM A;  2KU3 A;  2YRE A;  4PTB A;  4QNS A;  3IHP A;  2LXP C;  5A5N A;  4CUP A;  4YYK A;  2LGK A;  1WEU A;  4HBY A;  2OSS A;  3TLP A;  5EPB A;  5F3A A;  4A9N A;  2KFT A;  2ECJ A;  4CUT A;  4QR5 A;  3DPL R;  4J1P A;  2LGG A;  5B77 A;  5IGN A;  3IU5 A;  3N9O A;  2MJV B;  2E3K A;  5FER A;  2L75 A;  5FH8 A;  5D25 A;  4LYI A;  1WIM A;  4NRB A;  3ZVZ B;  4CA1 A;  3P1D A;  2YU4 A;  3JVL A;  4NUE A;  2Y1M A;  1V87 A;  5DFC A;  4YBM A;  3ZPV E;  3O37 A;  1WEV A;  3U5M A;  5C8G A;  5EQ1 A;  2CT2 A;  3U5J A;  5EPR A;  5EWH A;  5C13 A;  4AYC A;  4NR5 A;  4NR9 A;  4CUR A;  5EIC A;  2M6M A;  5FG6 A;  4A4C A;  1U6G B;  5TCM A;  3SVG A;  4R2Y A;  4B7Y C;  5F5Z A;  2YW8 A;  4N4F A;  4FIP A;  3HMH A;  3I3J A;  5A81 A;  2F6J A;  4CUU A;  3HME A;  4TS8 A;  5KTX A;  2LGL A;  5C11 A;  2E6R A;  3AAD A;  4HXP A;  4IOQ A;  2HDP A;  2MD7 B;  5CPE A;  5FG4 A;  2CKL B;  4IR5 A;  5EVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...