3O35A

Crystal structure of trim24 phd-bromo complexed with h3(23-31)k27ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
178
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 53
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o35A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o35A01
1Z2QA 5L99A 5CY9A 4HXRA 2F6NA 4MR3A 3DAIA 4YADA 5IG6A 4OUFA 4LKAA 5D3RA 4CUPA 1VFYA 5CQTA 5D25A 1HYIA 5FERA 4XUBA 2LGLA 1WEQA 4A9EA 4Z93A 4A9JA 5C13A 4Z1SA 5HRVA 3TLPA 4QUUA 2KGGA 2KYUA 4YYMA 4I7CA 2YQDA 5D1MB 2YQLA 5CRMA 5F1HA 4YAXA 2YREA 2PUYA 4B86C 4XYAA 2KWKA 1JSPB 2KWOA 4LZSA 2ZETC 5CTLA 5B78A 2CSZA 3IHPA 4UITA 2RNYA 3D7CA 3GL6A 4ALHA 4Q0NA 5TABA 4Z6IA 2GRCA 3P1CA 4HXLA 3UV5A 5FFYA 2YURA 2MD7B 2QJ0A 5CUAA 5C89A 2VJEA 3LXJA 5LKZA 3UV4A 4WA6A 2LQ6A 4QSVA 2K1JA 5I29A 2MIQA 3O7AA 5DX4A 5IGKA 3LQIA 3I2DA 4HBWA 4A9LA 4O7CA 4QEVA 2L5UA 4WIVA 4IORA 4ZUXU 4NR5A 5E9VA 2R0VA 5J0DA 2LRIC 3DPLR 4O70A 2CT2A 2F6JA 5E9MA 3IU5A 2KGIA 2KFTA 2JMIA 4A9OA 5CFWA 4NR7A 4O7AA 2LXPC 4QYLA 1U6GB 1G25A 4CUQA 5F62A 4WHWA 5ENEA 5FFVA 5IBNA 5CQ8A 5A85A 4CLBA 1LDKC 2EA6A 5L96A 4AKNA 5ETDA 5H1TA 5HQ6A 5DFBA 3HTKC 3HCUA 2BAYA 2F42A 4A9KA 4ZC9A 2DVSA 1RMDA 2VJEB 4R8PK 5I80A 4UYDA 2G45A 5FE6A 4BJXA 4N4FA 2YQMA 2R10A 2CKLA 4CFKA 1WEVA 2VPGA 4A49A 3JVJA 3ZYQA 5KHMA 4UIUA 2R0YA 5ENIA 4UYHA 5EISA 2D8SA 5E9LA 3QZTA 5ENCA 4PS5A 4N4GA 5A5RA 2MD8C 3PUQA 4A9MA 2RS9B 2VPDA 4GB0A 3U5PA 5EPRA 1Z60A 3MHSA 2RFJA 5CPEA 3PHDA 2HDPA 5FE7A 1K2FA 5EWWA 5EM3A 5B8DA 5ENFA 4BW2A 2NAAA 5B75A 3AADA 5CQ6A 1F68A 2KE1A 4V3KC 3FKMX 5DFDA 4NUDA 2K4DA 3SVFA 4TQNA 4LR6A 5E9IA 3RPGB 3C5KA 5CQ5A 2QICA 3N9NA 5AMFA 3U5MA 4QNSA 1X4UA 4CFLA 4W4UA 3G0JA 4Q0OA 4NYVA 2OSSA 5E3DA 3SOWA 5FB0A 3U5LA 3N9QA 5BT3A 4E96A 2YW8A 4A4BA 1X0JA 4KCXA 2LXHC 4UP5A 3LQHA 4UIYA 1E6IA 5D3JA 5EICA 5HQ5A 3N9OA 2H60A 4GNDA 4LK9A 4Y03A 2ECWA 2KWJA 4UYGA 2LGKA 1N72A 2DATA 4TZ2A 1F62A 2LSPB 5ETBA 5FG4A 3ZYUA 2YT5A 4QR5A 2H0DA 4QC3A 2CKLB 2M6MA 5CRZA 5D1LB 5TRBA 2MA6A 5EK9A 3MB4A 5DLXA 4NN2A 4LRGA 4LYWA 5I7YA 4TTEA 1WEWA 4XY9A 4YYKA 4QEUA 5AITA 5AMEA 4KV1A 4HXNA 2DVVA 3ZPVE 4NRCA 4A9FA 5A5PA 4MEOA 4J0SA 5A5NA 4YY6A 4O76A 4YC9A 3KV5A 3ZTGA 1X4IA 3SOXA 5JWMA 4LDFA 3LJWA 4UIXA 3IU6A 2VPBA 5TDRA 4I7DA 1MM2A 4PCIA 5LUUA 2WP2A 4QC1A 5L97A 5CZGA 4PTBA 5AD3A 2L43A 2L5EA 3JVKA 4QYDA 3KV6A 5FH6A 3M63A 4FO9A 4AYCB 3JVLA 2MJVB 5D7XA 5EI4A 4O64A 4A9HA 2R0SA 5EA1A 5ENGA 2VJFA 3N9PA 3N9LA 4NR9A 4CUSA 4S3OB 1WUMA 5DY7A 5LJ1A 4AUQB 3N9MA 4YYDA 3Q2EA 4J1PA 4BW4A 2KU3A 5H1VA 2FSAA 4YBMA 5BT4A 5ACYA 1LDJB 5E9KA 2FUIA 4YK0A 2K17A 4F52B 2H0DB 5LJ0A 2RI7A 2YELA 4QB3A 5EPBA 1WEEA 2AN6A 5E3GA 5L8UA 2RO1A 3MULA 3Q2FA 2I8NA 5D1KB 5D3NA 3O36A 4UYFA 4O75A 5G04B 4YABA 2JMDA 3MHHA 5DKCA 5BT5A 4YY4A 4NXJA 4YYNA 1WGMA 5C4QA 4QSUA 5HQ7A 5A83A 2KR4A 2YYRA 5H9MA 5DYAA 5FG6A 4ZQLA 4FJCA 4NQMA 4HXMA 5I88A 4PCEA 5CQ4A 4HXPA 4O7BA 3P5OA 5IGLA 3SVGA 5KTUA 4GNFA 5F25A 4P5OB 3O35A 5FE0A 2YUCA 5L8TA 2NXBA 5EVAA 2YEKA 2MUMA 3O34A 4WZ0A 5EV9A 4YYGA 5G0FA 5C87A 4QSRA 4YH3A 1WENA 1WEOA 2KIZA 2ECJA 4HBVA 5FG5A 4UIWA 1JOCA 3T6RA 4UP0A 4QEWA 4A0CD 4QSSA 3UVDA 3NG2A 5LCWB 3SVHA 3SHBA 4R7EA 3UVWA 3KNVA 1N87A 5HRXA 1JM7A 1E4UA 4WZ3B 3S91A 4NYWA 4IR3A 5DINA 4LYIA 4RVRA 2ECIA 3RPGC 3S92A 5FDZA 4HXOA 2L85A 2D82A 5E0RA 2MNYA 2E3KA 5CQ3A 5C11A 4KV4A 3GG3A 4MEPA 2G43A 5LJ2A 2G6QA 3EB5A 5G05B 5I40A 5CUEA 4NS5A 2ECTA 2KWNA 5TBNA 4O71A 4AP4A 4QZSA 4PPEA 3ZVZB 2YSMA 1CHCA 2I50A 4PKLA 5A5SA 2YU4A 4NQNA 5HFRA 2E7NA 2IDAA 5I3LA 4L7XA 4UIZA 5F61A 2N9GA 5HENA 3M99A 4O74A 4X2IA 5JG6A 2YDWA 4MR4A 5DLZA 5II2A 3MQMA 5KU3A 2VPEA 3O33A 3LRQA 4N4IA 2KREA 3KQIA 3U5KA 1JM4B 5D3HA 5E9YA 5L98A 3U5OA 1V87A 5E7DA 4IC2A 5DKAA 4TT6A 3JVMA 3AQAA 5F3AA 5CUCA 5HFQA 4CURA 2M3HA 3L1ZB 5KO4A 4TS8A 5DYUA 1JM7B 2L0BA 5I86A 5DBMA 5TCMA 5F5ZA 4FIPA 3QZVA 5A82A 2PNXA 4V3LC 5D3PA 4QSTA 3UV2A 4QF3A 2I7KA 3MXFA 5EWDA 5EU1A 2XB1A 3UW9A 3HCTA 3O70A 4S3OC 5B79A 3FL2A 4HXSA 5A5QA 4NRAA 4O78A 2ECVA 4TKPB 4QR3A 5HEMA 2QIZA 5CUGA 4WHUA 2DVRA 3ASLA 2XEUA 3T7LA 5JI8A 5D3LA 5CUDA 5I83A 4HBXA 4QBMA 5EP7A 2UZGA 2JMJA 3ZNIA 5DKHA 5A81A 4IOQA 5EWCA 2L84A 1VYXA 4N3WA 2JRJA 2RSDA 4QY4A 4MR6A 4NR8A 5DW1A 5EQ1A 2MT5A 4YBTA 4IR6A 4N4HA 4TT2A 3QZSA 4IR4A 3RCWA 1WEPA 3HMEA 3NXBA 2Y1NA 4WZ2A 5B76A 4C67A 4Z1QA 5G4RA 4L58A 4BW1A 4FLPA 3HCSA 2OXQC 5E73A 4O77A 5AD2A 5LKXA 1WUGA 3DQVR 5HRWA 3L1XA 2YEMA 3P1FA 4PY6A 4DONA 4F3IA 5COIA 2MA5A 1X4JA 1WEUA 2OO1A 1WESA 3HMFA 5FE9A 5LVRA 2OUOA 4O72A 2YSJA 4FK5A 2LN0A 4OGIA 4MENA 5FH7A 2DKWA 5EGUA 2C2LA 4UI9B 4LZ2A 1IYMA 4YYIA 4MVTA 4XY8A 2YHNA 4CL9A 3U5JA 4QUTA 4XI1A 4ALGA 4XUAA 5K29A 3UVXA 2K16A 5FE3A 1HYJA 5EWHA 1FBVA 4HXKA 4LADB 4HBYA 5LKTA 3V43A 2WP1A 4LZRA 5CS8A 4LC2A 4IOOA 3SOUA 4A4CA 2LGGA 5DYXA 4ZW1A 4NR6A 5KH3A 5FE5A 4LJNA 5EPSA 4YYHA 5FE2A 4I7BA 4MSXA 4BBQA 3P1EA 2VNFA 4A9IA 2E7OA 2ECGA 4TZ8A 2MNZA 3MB3A 5LKUA 4IC3A 3ZPV1 2VJFB 5F60A 5H85A 5ENJA 2LDRA 5F63A 4QR4A 2G4AA 2E6RA 2EODA 4CUTA 2L75A 1EQFA 5CP5A 4TU4A 5CQAA 4BW3A 2CSYA 4MR5A 3EB6A 5CQ7A 5DFCA 5F36A 5KTWA 3GV4A 5FE8A 4NUCA 1T1HA 4MEQA 3VK6A 4NR4A 5CU8A 4IR5A 5D3SA 4CA1A 5DW2A 1FP0A 5II1A 4UYEA 4R2YA 1DVPA 2D9EA 4AVXA 2VP7A 5IIDA 1WFKA 5D3TA 4UYFB 1WEMA 3O37A 5TDWA 3P1DA 4O7EA 2YHOA 5F2PA 4NRBA 1WIMA 4QSPA 5IGMA 4X3GA 4O7FA 5ENHA 3UVYA 5CUBA 5KTXA 3G0LA 2M85A 5HJCA 4GNEA 5FH8A 5F1LA 5FE4A 2FUUA 5HLSA 4OGJA 4NYXA 4C66A 2RNXA 5A7CA 3MUKA 5C85A 1WE9A 5KH7A 4J0RA 1VD4A 1Z6UA 3U5NA 2Y43A 5I7XA 4GPJA 2M1RA 2Y1MA 3ZVYA 3ONIA 1ZBDB 5HCLA 4B7YC 1ZS5A 4Z6HA 4Q6FA 4CCGX 4LLBA 4BHWA 4C9ZA 5G4SA 1XWHA 5CGPA 5ENBA 5C8GA 2YW5A 5FFWA 4TT4A 2LGVA 5E74A 5D0CA 4YH4A 5FEYA 4TYLA 4UIVA 2ECNA 5I89A 3DWYA 5FBXA 2HYED 4YBSA 2DX8A 2KTBB 5IGNA 3C6WA 3I3JA 5D26A 1WILA 4YATA 4AYCA 4CUUA 5HELA 5EYAF 2DWWA 4YYJA 2EGPA 3LQJA 5KH9A 3HMHA 4GNGA 1BORA 5B77A 2L80A 1MM3A 2E6SA 5A5OA 4QSQA 4QSWA 3RTRB 5C7NA 2RNWA 4QSXA 5H1UA 5TB6A 2YYNA 2DVQA 3M62A 4ZDTA 5DKDA 5D24A 5J3XA 5FB1A 2LV9A 4LYSA 5EWVA 5LVQA 3PURA 5AIUA 5HM0A 5I1QA 4NUEA 3L11A 4QF2A 4TU6A 4J3IA 2C2VS 4A9NA 5FE1A 3K2JA 5DYCA
chains in the Genus database with same CATH superfamily
1Z2QA 5L99A 5CY9A 4HXRA 2F6NA 4MR3A 3FEHA 3DAIA 4YADA 5IG6A 4OUFA 4LKAA 5D3RA 2JUNA 4CUPA 1VFYA 5CQTA 5D25A 1HYIA 5FERA 4XUBA 2LGLA 1WEQA 3FJUB 4A9EA 4Z93A 4A9JA 5C13A 4Z1SA 5HRVA 3TLPA 4QUUA 2KGGA 2KYUA 4YYMA 4I7CA 2YQDA 5D1MB 2YQLA 5CRMA 5F1HA 4YAXA 3SUBA 2CRRA 2YREA 2PUYA 4B86C 4XYAA 2KWKA 1JSPB 2KWOA 4LZSA 2ZETC 5CTLA 5B78A 2CSZA 3IHPA 4UITA 2RNYA 3D7CA 3GL6A 4ALHA 4Q0NA 5TABA 4Z6IA 2GRCA 3P1CA 4HXLA 3UV5A 5FFYA 2YURA 2MD7B 2QJ0A 5CUAA 5C89A 2VJEA 3LXJA 5LKZA 3UV4A 4WA6A 3FAOA 2KKYA 2LQ6A 4QSVA 2K1JA 5I29A 2MIQA 3O7AA 5DX4A 5IGKA 3LQIA 3I2DA 4HBWA 4A9LA 4O7CA 4QEVA 2L5UA 4WIVA 4IORA 4ZUXU 4NR5A 5E9VA 2R0VA 5J0DA 2LRIC 3DPLR 4O70A 2CT2A 2F6JA 5E9MA 3DDTA 3IU5A 2KGIA 2D8UA 2KFTA 2JMIA 4A9OA 5CFWA 4NR7A 4O7AA 2LXPC 4QYLA 1U6GB 1G25A 4CUQA 5F62A 4WHWA 5ENEA 5FFVA 5IBNA 5CQ8A 5A85A 4CLBA 1LDKC 2EA6A 5L96A 4AKNA 5ETDA 5H1TA 5HQ6A 5DFBA 3HTKC 3HCUA 2BAYA 2F42A 4A9KA 4ZC9A 3DWDA 2DVSA 1RMDA 2VJEB 4R8PK 5I80A 4UYDA 2G45A 5FE6A 4BJXA 4N4FA 2YQMA 2R10A 2CKLA 4CFKA 2EJNA 1WEVA 2VPGA 4A49A 5K3QA 3JVJA 3ZYQA 5KHMA 5SVIA 4UIUA 2R0YA 5ENIA 4UYHA 5EISA 2D8SA 5E9LA 3QZTA 5ENCA 4PS5A 4N4GA 5A5RA 2MD8C 3E2DA 3PUQA 4A9MA 2RS9B 2VPDA 4GB0A 3U5PA 5EPRA 1Z60A 3MHSA 2RFJA 5CPEA 3PHDA 2HDPA 5FE7A 1K2FA 5EWWA 5EM3A 3T9KA 5B8DA 5ENFA 4BW2A 2NAAA 5B75A 3AADA 5CQ6A 1F68A 2KE1A 4V3KC 3FKMX 5DFDA 4NUDA 2FFWA 3SVFA 4TQNA 2K4DA 4LR6A 3LDYA 5E9IA 3RPGB 3C5KA 5CQ5A 2QICA 3N9NA 5AMFA 3U5MA 4QNSA 1X4UA 4CFLA 4W4UA 3G0JA 4Q0OA 4NYVA 2OSSA 5E3DA 3SOWA 5FB0A 3U5LA 3N9QA 5BT3A 4E96A 2YW8A 4A4BA 1X0JA 4KCXA 2LXHC 4UP5A 3LQHA 4UIYA 1E6IA 5D3JA 5EICA 5HQ5A 3N9OA 2H60A 4GNDA 4LK9A 4Y03A 2ECWA 2KWJA 4UYGA 2LGKA 1N72A 2DATA 4OGEA 4TZ2A 1F62A 2LSPB 5ETBA 5FG4A 3ZYUA 2YT5A 4QR5A 2H0DA 4QC3A 2CKLB 2M6MA 5CRZA 5D1LB 5TRBA 2MA6A 5EK9A 2P57A 3MB4A 5DLXA 5SVIB 3LJUX 4LRGA 4LYWA 5I7YA 4TTEA 1WEWA 4XY9A 2XOZA 4NN2A 4YYKA 4QEUA 5AITA 5AMEA 4KV1A 3LVRE 4HXNA 2DVVA 3ZPVE 4NRCA 4A9FA 5A5PA 4MEOA 4J0SA 5A5NA 4YY6A 4O76A 4YC9A 3KV5A 3ZTGA 1X4IA 3SOXA 5JWMA 4LDFA 3LJWA 4UIXA 3IU6A 2VPBA 5TDRA 4I7DA 1MM2A 4PCIA 5LUUA 2WP2A 4QC1A 5L97A 5CZGA 4PTBA 5AD3A 2L43A 3VKHA 2L5EA 3JVKA 4QYDA 3KV6A 5FH6A 3M63A 4FO9A 4AYCB 3JVLA 2MJVB 5D7XA 5EI4A 4O64A 4A9HA 2R0SA 5EA1A 5ENGA 2VJFA 3N9PA 3N9LA 4NR9A 4CUSA 5B76A 4S3OB 1WUMA 5DY7A 5LJ1A 4Z0RA 4AUQB 3N9MA 4YYDA 3Q2EA 4J1PA 1PUOA 4BW4A 2KU3A 5H1VA 2FSAA 4YBMA 5BT4A 5ACYA 1LDJB 5E9KA 2FUIA 4YK0A 2K17A 4F52B 2H0DB 5LJ0A 3LVQE 2RI7A 2YELA 4QB3A 5EPBA 1WEEA 2AN6A 5E3GA 5L8UA 2RO1A 3MULA 3Q2FA 2I8NA 5D1KB 5D3NA 3O36A 4UYFA 4O75A 5G04B 4YABA 2JMDA 3MHHA 5DKCA 5BT5A 4YY4A 4NXJA 4YYNA 1WGMA 5C4QA 4QSUA 5HQ7A 4O62A 4H9DA 3ERRA 5A83A 2KR4A 2YYRA 5H9MA 5DYAA 5FG6A 4ZQLA 4FJCA 4NQMA 4HXMA 5I88A 4PCEA 5CQ4A 5SVYA 4HXPA 4O7BA 3P5OA 5IGLA 3SVGA 2KKXA 5KTUA 4GNFA 5F25A 4P5OB 2JM3A 3O35A 5FE0A 2FD4A 2YUCA 5L8TA 2NXBA 5EVAA 2YEKA 2MUMA 3O34A 4WZ0A 5EV9A 4YYGA 5G0FA 5C87A 4QSRA 4YH3A 1WENA 1WEOA 2KIZA 2ECJA 4HBVA 5FG5A 4UIWA 1JOCA 3T6RA 4UP0A 4QEWA 4A0CD 4QSSA 3UVDA 3NG2A 5LCWB 3SVHA 3SHBA 3FANA 4R7EA 3UVWA 3KNVA 2EXUA 1N87A 5HRXA 1JM7A 1E4UA 4WZ3B 3S91A 4NYWA 4IR3A 5DINA 4LYIA 4RVRA 2ECIA 4FK5A 3RPGC 3S92A 2YVRA 5FDZA 4HXOA 2L85A 2D82A 5E0RA 2MNYA 2E3KA 5CQ3A 5C11A 4KV4A 3GG3A 4MEPA 2G43A 5LJ2A 2G6QA 3EB5A 5G05B 5I40A 5CUEA 4NS5A 2ECTA 2KWNA 5TBNA 2XOYA 4O71A 4Z0OA 4AP4A 4QZSA 4PPEA 3ZVZB 1ZKRA 2YSMA 1CHCA 2I50A 4PKLA 5A5SA 2YU4A 4NQNA 5HFRA 2E7NA 2IDAA 5I3LA 4L7XA 4UIZA 5F61A 2N9GA 3FM8C 3MDBC 5HENA 3M99A 4O74A 4X2IA 5JG6A 2YDWA 4MR4A 5DLZA 5II2A 3MQMA 5KU3A 2VPEA 3O33A 3LRQA 4N4IA 2KREA 3KQIA 3U5KA 1JM4B 5D3HA 5E9YA 5L98A 3U5OA 1V87A 5E7DA 2OWAA 4IC2A 5DKAA 4TT6A 2RR4A 3JVMA 3AQAA 5F3AA 5CUCA 5HFQA 4CURA 2M3HA 3L1ZB 5KO4A 1MBMA 4TS8A 5DYUA 1JM7B 2L0BA 5I86A 5DBMA 5TCMA 5F5ZA 4FIPA 3QZVA 5A82A 2MKEA 2PNXA 3H7HA 4V3LC 5D3PA 4QSTA 3UV2A 2M13A 4QF3A 2I7KA 3MXFA 5EWDA 5EU1A 2XB1A 3UW9A 3HCTA 3O70A 4S3OC 5B79A 3FL2A 4HXSA 5A5QA 4NRAA 4O78A 2ECVA 4TKPB 4QR3A 5HEMA 2QIZA 5CUGA 4WHUA 2DVRA 3ASLA 2XEUA 3T7LA 5JI8A 5D3LA 5CUDA 5I83A 4HBXA 4QBMA 5EP7A 2UZGA 2JMJA 3ZNIA 5DKHA 5A81A 4IOQA 5EWCA 2L84A 1VYXA 4N3WA 2JRJA 2RSDA 4QY4A 4MR6A 4QQ4A 4NR8A 5DW1A 5EQ1A 2MT5A 3PLWA 4YBTA 4IR6A 4N4HA 4TT2A 3QZSA 4IR4A 3RCWA 1WEPA 3HMEA 3NXBA 2Y1NA 3O47A 4WZ2A 4C67A 4Z1QA 5G4RA 4L58A 4BW1A 3M7KA 4FLPA 3HCSA 2OXQC 3D1BA 5E73A 4O77A 5AD2A 5LKXA 3D1DA 1WUGA 2DSMA 2IQJA 3DQVR 5HRWA 3L1XA 2YEMA 3P1FA 4PY6A 4DONA 4F3IA 5COIA 2MA5A 1X4JA 2XOCA 1WEUA 2OO1A 1WESA 3HMFA 5FE9A 5LVRA 2OUOA 4O72A 2XP0A 2YSJA 2LN0A 4OGIA 4MENA 5FH7A 2DKWA 5EGUA 2C2LA 4UI9B 4LZ2A 1IYMA 4YYIA 3Q1DA 4MVTA 4XY8A 2YHNA 4CL9A 3U5JA 4QUTA 4XI1A 4ALGA 4XUAA 5K29A 3UVXA 3VKGA 2K16A 5FE3A 1HYJA 5EWHA 4AKIA 1FBVA 4HXKA 4LADB 4HBYA 5LKTA 3V43A 2WP1A 4LZRA 5CS8A 4LC2A 4IOOA 3SOUA 4A4CA 4OGCA 2LGGA 5DYXA 4ZW1A 4NR6A 5KH3A 5FE5A 4LJNA 5EPSA 4YYHA 5FE2A 4I7BA 5SVXA 4MSXA 4BBQA 3P1EA 2VNFA 4A9IA 2E7OA 2ECGA 4TZ8A 2MNZA 3MB3A 5LKUA 4IC3A 3ZPV1 2CRWA 2VJFB 5F60A 5H85A 5ENJA 2LDRA 5F63A 4QR4A 2G4AA 2E6RA 2EODA 4CUTA 2L75A 1EQFA 5CP5A 4TU4A 5CQAA 4BW3A 2CSYA 4MR5A 3EB6A 5CQ7A 5DFCA 4F1PA 5F36A 5KTWA 2LAUA 3GV4A 5FE8A 4NUCA 1T1HA 4MEQA 3VK6A 4NR4A 5CU8A 4IR5A 5D3SA 2DJAA 4CA1A 5DW2A 1FP0A 5II1A 4UYEA 4R2YA 1DVPA 2D9EA 4AVXA 2VP7A 3KDEC 5IIDA 1WFKA 5D3TA 4UYFB 1WEMA 3O37A 5TDWA 3P1DA 4O7EA 2YHOA 5F2PA 4NRBA 1WIMA 4QSPA 5IGMA 4X3GA 4O7FA 5ENHA 3UVYA 5CUBA 5KTXA 3G0LA 2M85A 5HJCA 4GNEA 5FH8A 5F1LA 5FE4A 2FUUA 5HLSA 4OGJA 4NYXA 4C66A 2RNXA 5A7CA 3MUKA 5C85A 1WE9A 5KH7A 4AI6A 4J0RA 1VD4A 1Z6UA 3U5NA 2Y43A 2L7PA 2B0OE 5I7XA 4GPJA 2M1RA 2Y1MA 3ZVYA 3ONIA 1ZBDB 5HCLA 4B7YC 1ZS5A 4Z6HA 4Q6FA 4CCGX 4LLBA 4BHWA 4C9ZA 5G4SA 1XWHA 5CGPA 5ENBA 5C8GA 3JUEA 2YW5A 5FFWA 4TT4A 2EGMA 5E74A 5D0CA 2LGVA 4YH4A 5FEYA 4TYLA 4UIVA 2ECNA 5I89A 3DWYA 5FBXA 2HYED 4YBSA 2DX8A 2KTBB 5IGNA 3C6WA 2E61A 3I3JA 5D26A 1WILA 4YATA 4AYCA 4CUUA 5HELA 5EYAF 2DWWA 4YYJA 2EGPA 4AKGA 3LQJA 5KH9A 3HMHA 4GNGA 1BORA 5B77A 2L80A 1MM3A 2E6SA 5A5OA 4QSQA 2CONA 4QSWA 4AKHA 1DCQA 5C7NA 2RNWA 4QSXA 3RTRB 5H1UA 5TB6A 2YYNA 2DVQA 3M62A 4ZDTA 5DKDA 5D24A 5J3XA 5FB1A 2LV9A 4LYSA 5EWVA 5LVQA 3PURA 2CSVA 5AIUA 5HM0A 5I1QA 4NUEA 3L11A 4QF2A 4TU6A 4J3IA 2C2VS 4A9NA 5FE1A 3K2JA 5DYCA
chains in the Genus database with same CATH topology
1Z2QA 5L99A 5CY9A 4HXRA 2F6NA 4MR3A 3DAIA 4YADA 5IG6A 4OUFA 4LKAA 5D3RA 4CUPA 1VFYA 5CQTA 5D25A 1HYIA 5FERA 4XUBA 2LGLA 1WEQA 4A9EA 4Z93A 4A9JA 5C13A 4Z1SA 5HRVA 3TLPA 4QUUA 2KGGA 2KYUA 4YYMA 4I7CA 2YQDA 5D1MB 2YQLA 5CRMA 5F1HA 4YAXA 2YREA 2PUYA 4B86C 4XYAA 2KWKA 1JSPB 2KWOA 4LZSA 2ZETC 5CTLA 5B78A 2CSZA 3IHPA 4UITA 2RNYA 3D7CA 3GL6A 4ALHA 4Q0NA 5TABA 4Z6IA 2GRCA 3P1CA 4HXLA 3UV5A 5FFYA 2YURA 2MD7B 2QJ0A 5CUAA 5C89A 2VJEA 3LXJA 5LKZA 3UV4A 4WA6A 2LQ6A 4QSVA 2K1JA 5I29A 2MIQA 3O7AA 5DX4A 5IGKA 3LQIA 3I2DA 4HBWA 4A9LA 4O7CA 4QEVA 2L5UA 4WIVA 4IORA 4ZUXU 4NR5A 5E9VA 2R0VA 5J0DA 2LRIC 3DPLR 4O70A 2CT2A 2F6JA 5E9MA 3IU5A 2KGIA 2KFTA 2JMIA 4A9OA 5CFWA 4NR7A 4O7AA 2LXPC 4QYLA 1U6GB 1G25A 4CUQA 5F62A 4WHWA 5ENEA 5FFVA 5IBNA 5CQ8A 5A85A 4CLBA 1LDKC 2EA6A 5L96A 4AKNA 5ETDA 5H1TA 5HQ6A 5DFBA 3HTKC 3HCUA 2BAYA 2F42A 4A9KA 4ZC9A 2DVSA 1RMDA 2VJEB 4R8PK 5I80A 4UYDA 2G45A 5FE6A 4BJXA 4N4FA 2YQMA 2R10A 2CKLA 4CFKA 1WEVA 2VPGA 4A49A 3JVJA 3ZYQA 5KHMA 4UIUA 2R0YA 5ENIA 4UYHA 5EISA 2D8SA 5E9LA 3QZTA 5ENCA 4PS5A 4N4GA 5A5RA 2MD8C 3PUQA 4A9MA 2RS9B 2VPDA 4GB0A 3U5PA 5EPRA 1Z60A 3MHSA 2RFJA 5CPEA 3PHDA 2HDPA 5FE7A 1K2FA 5EWWA 5EM3A 5B8DA 5ENFA 4BW2A 2NAAA 5B75A 3AADA 5CQ6A 1F68A 2KE1A 4V3KC 3FKMX 5DFDA 4NUDA 2K4DA 3SVFA 4TQNA 4LR6A 5E9IA 3RPGB 3C5KA 5CQ5A 2QICA 3N9NA 5AMFA 3U5MA 4QNSA 1X4UA 4CFLA 4W4UA 3G0JA 4Q0OA 4NYVA 2OSSA 5E3DA 3SOWA 5FB0A 3U5LA 3N9QA 5BT3A 4E96A 2YW8A 4A4BA 1X0JA 4KCXA 2LXHC 4UP5A 3LQHA 4UIYA 1E6IA 5D3JA 5EICA 5HQ5A 3N9OA 2H60A 4GNDA 4LK9A 4Y03A 2ECWA 2KWJA 4UYGA 2LGKA 1N72A 2DATA 4TZ2A 1F62A 2LSPB 5ETBA 5FG4A 3ZYUA 2YT5A 4QR5A 2H0DA 4QC3A 2CKLB 2M6MA 5CRZA 5D1LB 5TRBA 2MA6A 5EK9A 3MB4A 5DLXA 4NN2A 4LRGA 4LYWA 5I7YA 4TTEA 1WEWA 4XY9A 4YYKA 4QEUA 5AITA 5AMEA 4KV1A 4HXNA 2DVVA 3ZPVE 4NRCA 4A9FA 5A5PA 4MEOA 4J0SA 5A5NA 4YY6A 4O76A 4YC9A 3KV5A 3ZTGA 1X4IA 3SOXA 5JWMA 4LDFA 3LJWA 4UIXA 3IU6A 2VPBA 5TDRA 4I7DA 1MM2A 4PCIA 5LUUA 2WP2A 4QC1A 5L97A 5CZGA 4PTBA 5AD3A 2L43A 2L5EA 3JVKA 4QYDA 3KV6A 5FH6A 3M63A 4FO9A 4AYCB 3JVLA 2MJVB 5D7XA 5EI4A 4O64A 4A9HA 2R0SA 5EA1A 5ENGA 2VJFA 3N9PA 3N9LA 4NR9A 4CUSA 4S3OB 1WUMA 5DY7A 5LJ1A 4AUQB 3N9MA 4YYDA 3Q2EA 4J1PA 4BW4A 2KU3A 5H1VA 2FSAA 4YBMA 5BT4A 5ACYA 1LDJB 5E9KA 2FUIA 4YK0A 2K17A 4F52B 2H0DB 5LJ0A 2RI7A 2YELA 4QB3A 5EPBA 1WEEA 2AN6A 5E3GA 5L8UA 2RO1A 3MULA 3Q2FA 2I8NA 5D1KB 5D3NA 3O36A 4UYFA 4O75A 5G04B 4YABA 2JMDA 3MHHA 5DKCA 5BT5A 4YY4A 4NXJA 4YYNA 1WGMA 5C4QA 4QSUA 5HQ7A 5A83A 2KR4A 2YYRA 5H9MA 5DYAA 5FG6A 4ZQLA 4FJCA 4NQMA 4HXMA 5I88A 4PCEA 5CQ4A 4HXPA 4O7BA 3P5OA 5IGLA 3SVGA 5KTUA 4GNFA 5F25A 4P5OB 3O35A 5FE0A 2YUCA 5L8TA 2NXBA 5EVAA 2YEKA 2MUMA 3O34A 4WZ0A 5EV9A 4YYGA 5G0FA 5C87A 4QSRA 4YH3A 1WENA 1WEOA 2KIZA 2ECJA 4HBVA 5FG5A 4UIWA 1JOCA 3T6RA 4UP0A 4QEWA 4A0CD 4QSSA 3UVDA 3NG2A 5LCWB 3SVHA 3SHBA 4R7EA 3UVWA 3KNVA 1N87A 5HRXA 1JM7A 1E4UA 4WZ3B 3S91A 4NYWA 4IR3A 5DINA 4LYIA 4RVRA 2ECIA 3RPGC 3S92A 5FDZA 4HXOA 2L85A 2D82A 5E0RA 2MNYA 2E3KA 5CQ3A 5C11A 4KV4A 3GG3A 4MEPA 2G43A 5LJ2A 2G6QA 3EB5A 5G05B 5I40A 5CUEA 4NS5A 2ECTA 2KWNA 5TBNA 4O71A 4AP4A 4QZSA 4PPEA 3ZVZB 2YSMA 1CHCA 2I50A 4PKLA 5A5SA 2YU4A 4NQNA 5HFRA 2E7NA 2IDAA 5I3LA 4L7XA 4UIZA 5F61A 2N9GA 5HENA 3M99A 4O74A 4X2IA 5JG6A 2YDWA 4MR4A 5DLZA 5II2A 3MQMA 5KU3A 2VPEA 3O33A 3LRQA 4N4IA 2KREA 3KQIA 3U5KA 1JM4B 5D3HA 5E9YA 5L98A 3U5OA 1V87A 5E7DA 4IC2A 5DKAA 4TT6A 3JVMA 3AQAA 5F3AA 5CUCA 5HFQA 4CURA 2M3HA 3L1ZB 5KO4A 4TS8A 5DYUA 1JM7B 2L0BA 5I86A 5DBMA 5TCMA 5F5ZA 4FIPA 3QZVA 5A82A 2PNXA 4V3LC 5D3PA 4QSTA 3UV2A 4QF3A 2I7KA 3MXFA 5EWDA 5EU1A 2XB1A 3UW9A 3HCTA 3O70A 4S3OC 5B79A 3FL2A 4HXSA 5A5QA 4NRAA 4O78A 2ECVA 4TKPB 4QR3A 5HEMA 2QIZA 5CUGA 4WHUA 2DVRA 3ASLA 2XEUA 3T7LA 5JI8A 5D3LA 5CUDA 5I83A 4HBXA 4QBMA 5EP7A 2UZGA 2JMJA 3ZNIA 5DKHA 5A81A 4IOQA 5EWCA 2L84A 1VYXA 4N3WA 2JRJA 2RSDA 4QY4A 4MR6A 4NR8A 5DW1A 5EQ1A 2MT5A 4YBTA 4IR6A 4N4HA 4TT2A 3QZSA 4IR4A 3RCWA 1WEPA 3HMEA 3NXBA 2Y1NA 4WZ2A 5B76A 4C67A 4Z1QA 5G4RA 4L58A 4BW1A 4FLPA 3HCSA 2OXQC 5E73A 4O77A 5AD2A 5LKXA 1WUGA 3DQVR 5HRWA 3L1XA 2YEMA 3P1FA 4PY6A 4DONA 4F3IA 5COIA 2MA5A 1X4JA 1WEUA 2OO1A 1WESA 3HMFA 5FE9A 5LVRA 2OUOA 4O72A 2YSJA 4FK5A 2LN0A 4OGIA 4MENA 5FH7A 2DKWA 5EGUA 2C2LA 4UI9B 4LZ2A 1IYMA 4YYIA 4MVTA 4XY8A 2YHNA 4CL9A 3U5JA 4QUTA 4XI1A 4ALGA 4XUAA 5K29A 3UVXA 2K16A 5FE3A 1HYJA 5EWHA 1FBVA 4HXKA 4LADB 4HBYA 5LKTA 3V43A 2WP1A 4LZRA 5CS8A 4LC2A 4IOOA 3SOUA 4A4CA 2LGGA 5DYXA 4ZW1A 4NR6A 5KH3A 5FE5A 4LJNA 5EPSA 4YYHA 5FE2A 4I7BA 4MSXA 4BBQA 3P1EA 2VNFA 4A9IA 2E7OA 2ECGA 4TZ8A 2MNZA 3MB3A 5LKUA 4IC3A 3ZPV1 2VJFB 5F60A 5H85A 5ENJA 2LDRA 5F63A 4QR4A 2G4AA 2E6RA 2EODA 4CUTA 2L75A 1EQFA 5CP5A 4TU4A 5CQAA 4BW3A 2CSYA 4MR5A 3EB6A 5CQ7A 5DFCA 5F36A 5KTWA 3GV4A 5FE8A 4NUCA 1T1HA 4MEQA 3VK6A 4NR4A 5CU8A 4IR5A 5D3SA 4CA1A 5DW2A 1FP0A 5II1A 4UYEA 4R2YA 1DVPA 2D9EA 4AVXA 2VP7A 5IIDA 1WFKA 5D3TA 4UYFB 1WEMA 3O37A 5TDWA 3P1DA 4O7EA 2YHOA 5F2PA 4NRBA 1WIMA 4QSPA 5IGMA 4X3GA 4O7FA 5ENHA 3UVYA 5CUBA 5KTXA 3G0LA 2M85A 5HJCA 4GNEA 5FH8A 5F1LA 5FE4A 2FUUA 5HLSA 4OGJA 4NYXA 4C66A 2RNXA 5A7CA 3MUKA 5C85A 1WE9A 5KH7A 4J0RA 1VD4A 1Z6UA 3U5NA 2Y43A 5I7XA 4GPJA 2M1RA 2Y1MA 3ZVYA 3ONIA 1ZBDB 5HCLA 4B7YC 1ZS5A 4Z6HA 4Q6FA 4CCGX 4LLBA 4BHWA 4C9ZA 5G4SA 1XWHA 5CGPA 5ENBA 5C8GA 2YW5A 5FFWA 4TT4A 2LGVA 5E74A 5D0CA 4YH4A 5FEYA 4TYLA 4UIVA 2ECNA 5I89A 3DWYA 5FBXA 2HYED 4YBSA 2DX8A 2KTBB 5IGNA 3C6WA 3I3JA 5D26A 1WILA 4YATA 4AYCA 4CUUA 5HELA 5EYAF 2DWWA 4YYJA 2EGPA 3LQJA 5KH9A 3HMHA 4GNGA 1BORA 5B77A 2L80A 1MM3A 2E6SA 5A5OA 4QSQA 4QSWA 3RTRB 5C7NA 2RNWA 4QSXA 5H1UA 5TB6A 2YYNA 2DVQA 3M62A 4ZDTA 5DKDA 5D24A 5J3XA 5FB1A 2LV9A 4LYSA 5EWVA 5LVQA 3PURA 5AIUA 5HM0A 5I1QA 4NUEA 3L11A 4QF2A 4TU6A 4J3IA 2C2VS 4A9NA 5FE1A 3K2JA 5DYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2Q A;  5L99 A;  5CY9 A;  4HXR A;  2F6N A;  4MR3 A;  3DAI A;  4YAD A;  5IG6 A;  4OUF A;  4LKA A;  5D3R A;  4CUP A;  1VFY A;  5CQT A;  5D25 A;  1HYI A;  5FER A;  4XUB A;  2LGL A;  1WEQ A;  4A9E A;  4Z93 A;  4A9J A;  5C13 A;  4Z1S A;  5HRV A;  3TLP A;  4QUU A;  2KGG A;  2KYU A;  4YYM A;  4I7C A;  2YQD A;  5D1M B;  2YQL A;  5CRM A;  5F1H A;  4YAX A;  2YRE A;  2PUY A;  4B86 C;  4XYA A;  2KWK A;  1JSP B;  2KWO A;  4LZS A;  2ZET C;  5CTL A;  5B78 A;  2CSZ A;  3IHP A;  4UIT A;  2RNY A;  3D7C A;  3GL6 A;  4ALH A;  4Q0N A;  5TAB A;  4Z6I A;  2GRC A;  3P1C A;  4HXL A;  3UV5 A;  5FFY A;  2YUR A;  2MD7 B;  2QJ0 A;  5CUA A;  5C89 A;  2VJE A;  3LXJ A;  5LKZ A;  3UV4 A;  4WA6 A;  2LQ6 A;  4QSV A;  2K1J A;  5I29 A;  2MIQ A;  3O7A A;  5DX4 A;  5IGK A;  3LQI A;  3I2D A;  4HBW A;  4A9L A;  4O7C A;  4QEV A;  2L5U A;  4WIV A;  4IOR A;  4ZUX U;  4NR5 A;  5E9V A;  2R0V A;  5J0D A;  2LRI C;  3DPL R;  4O70 A;  2CT2 A;  2F6J A;  5E9M A;  3IU5 A;  2KGI A;  2KFT A;  2JMI A;  4A9O A;  5CFW A;  4NR7 A;  4O7A A;  2LXP C;  4QYL A;  1U6G B;  1G25 A;  4CUQ A;  5F62 A;  4WHW A;  5ENE A;  5FFV A;  5IBN A;  5CQ8 A;  5A85 A;  4CLB A;  1LDK C;  2EA6 A;  5L96 A;  4AKN A;  5ETD A;  5H1T A;  5HQ6 A;  5DFB A;  3HTK C;  3HCU A;  2BAY A;  2F42 A;  4A9K A;  4ZC9 A;  2DVS A;  1RMD A;  2VJE B;  4R8P K;  5I80 A;  4UYD A;  2G45 A;  5FE6 A;  4BJX A;  4N4F A;  2YQM A;  2R10 A;  2CKL A;  4CFK A;  1WEV A;  2VPG A;  4A49 A;  3JVJ A;  3ZYQ A;  5KHM A;  4UIU A;  2R0Y A;  5ENI A;  4UYH A;  5EIS A;  2D8S A;  5E9L A;  3QZT A;  5ENC A;  4PS5 A;  4N4G A;  5A5R A;  2MD8 C;  3PUQ A;  4A9M A;  2RS9 B;  2VPD A;  4GB0 A;  3U5P A;  5EPR A;  1Z60 A;  3MHS A;  2RFJ A;  5CPE A;  3PHD A;  2HDP A;  5FE7 A;  1K2F A;  5EWW A;  5EM3 A;  5B8D A;  5ENF A;  4BW2 A;  2NAA A;  5B75 A;  3AAD A;  5CQ6 A;  1F68 A;  2KE1 A;  4V3K C;  3FKM X;  5DFD A;  4NUD A;  2K4D A;  3SVF A;  4TQN A;  4LR6 A;  5E9I A;  3RPG B;  3C5K A;  5CQ5 A;  2QIC A;  3N9N A;  5AMF A;  3U5M A;  4QNS A;  1X4U A;  4CFL A;  4W4U A;  3G0J A;  4Q0O A;  4NYV A;  2OSS A;  5E3D A;  3SOW A;  5FB0 A;  3U5L A;  3N9Q A;  5BT3 A;  4E96 A;  2YW8 A;  4A4B A;  1X0J A;  4KCX A;  2LXH C;  4UP5 A;  3LQH A;  4UIY A;  1E6I A;  5D3J A;  5EIC A;  5HQ5 A;  3N9O A;  2H60 A;  4GND A;  4LK9 A;  4Y03 A;  2ECW A;  2KWJ A;  4UYG A;  2LGK A;  1N72 A;  2DAT A;  4TZ2 A;  1F62 A;  2LSP B;  5ETB A;  5FG4 A;  3ZYU A;  2YT5 A;  4QR5 A;  2H0D A;  4QC3 A;  2CKL B;  2M6M A;  5CRZ A;  5D1L B;  5TRB A;  2MA6 A;  5EK9 A;  3MB4 A;  5DLX A;  4NN2 A;  4LRG A;  4LYW A;  5I7Y A;  4TTE A;  1WEW A;  4XY9 A;  4YYK A;  4QEU A;  5AIT A;  5AME A;  4KV1 A;  4HXN A;  2DVV A;  3ZPV E;  4NRC A;  4A9F A;  5A5P A;  4MEO A;  4J0S A;  5A5N A;  4YY6 A;  4O76 A;  4YC9 A;  3KV5 A;  3ZTG A;  1X4I A;  3SOX A;  5JWM A;  4LDF A;  3LJW A;  4UIX A;  3IU6 A;  2VPB A;  5TDR A;  4I7D A;  1MM2 A;  4PCI A;  5LUU A;  2WP2 A;  4QC1 A;  5L97 A;  5CZG A;  4PTB A;  5AD3 A;  2L43 A;  2L5E A;  3JVK A;  4QYD A;  3KV6 A;  5FH6 A;  3M63 A;  4FO9 A;  4AYC B;  3JVL A;  2MJV B;  5D7X A;  5EI4 A;  4O64 A;  4A9H A;  2R0S A;  5EA1 A;  5ENG A;  2VJF A;  3N9P A;  3N9L A;  4NR9 A;  4CUS A;  4S3O B;  1WUM A;  5DY7 A;  5LJ1 A;  4AUQ B;  3N9M A;  4YYD A;  3Q2E A;  4J1P A;  4BW4 A;  2KU3 A;  5H1V A;  2FSA A;  4YBM A;  5BT4 A;  5ACY A;  1LDJ B;  5E9K A;  2FUI A;  4YK0 A;  2K17 A;  4F52 B;  2H0D B;  5LJ0 A;  2RI7 A;  2YEL A;  4QB3 A;  5EPB A;  1WEE A;  2AN6 A;  5E3G A;  5L8U A;  2RO1 A;  3MUL A;  3Q2F A;  2I8N A;  5D1K B;  5D3N A;  3O36 A;  4UYF A;  4O75 A;  5G04 B;  4YAB A;  2JMD A;  3MHH A;  5DKC A;  5BT5 A;  4YY4 A;  4NXJ A;  4YYN A;  1WGM A;  5C4Q A;  4QSU A;  5HQ7 A;  5A83 A;  2KR4 A;  2YYR A;  5H9M A;  5DYA A;  5FG6 A;  4ZQL A;  4FJC A;  4NQM A;  4HXM A;  5I88 A;  4PCE A;  5CQ4 A;  4HXP A;  4O7B A;  3P5O A;  5IGL A;  3SVG A;  5KTU A;  4GNF A;  5F25 A;  4P5O B;  3O35 A;  5FE0 A;  2YUC A;  5L8T A;  2NXB A;  5EVA A;  2YEK A;  2MUM A;  3O34 A;  4WZ0 A;  5EV9 A;  4YYG A;  5G0F A;  5C87 A;  4QSR A;  4YH3 A;  1WEN A;  1WEO A;  2KIZ A;  2ECJ A;  4HBV A;  5FG5 A;  4UIW A;  1JOC A;  3T6R A;  4UP0 A;  4QEW A;  4A0C D;  4QSS A;  3UVD A;  3NG2 A;  5LCW B;  3SVH A;  3SHB A;  4R7E A;  3UVW A;  3KNV A;  1N87 A;  5HRX A;  1JM7 A;  1E4U A;  4WZ3 B;  3S91 A;  4NYW A;  4IR3 A;  5DIN A;  4LYI A;  4RVR A;  2ECI A;  3RPG C;  3S92 A;  5FDZ A;  4HXO A;  2L85 A;  2D82 A;  5E0R A;  2MNY A;  2E3K A;  5CQ3 A;  5C11 A;  4KV4 A;  3GG3 A;  4MEP A;  2G43 A;  5LJ2 A;  2G6Q A;  3EB5 A;  5G05 B;  5I40 A;  5CUE A;  4NS5 A;  2ECT A;  2KWN A;  5TBN A;  4O71 A;  4AP4 A;  4QZS A;  4PPE A;  3ZVZ B;  2YSM A;  1CHC A;  2I50 A;  4PKL A;  5A5S A;  2YU4 A;  4NQN A;  5HFR A;  2E7N A;  2IDA A;  5I3L A;  4L7X A;  4UIZ A;  5F61 A;  2N9G A;  5HEN A;  3M99 A;  4O74 A;  4X2I A;  5JG6 A;  2YDW A;  4MR4 A;  5DLZ A;  5II2 A;  3MQM A;  5KU3 A;  2VPE A;  3O33 A;  3LRQ A;  4N4I A;  2KRE A;  3KQI A;  3U5K A;  1JM4 B;  5D3H A;  5E9Y A;  5L98 A;  3U5O A;  1V87 A;  5E7D A;  4IC2 A;  5DKA A;  4TT6 A;  3JVM A;  3AQA A;  5F3A A;  5CUC A;  5HFQ A;  4CUR A;  2M3H A;  3L1Z B;  5KO4 A;  4TS8 A;  5DYU A;  1JM7 B;  2L0B A;  5I86 A;  5DBM A;  5TCM A;  5F5Z A;  4FIP A;  3QZV A;  5A82 A;  2PNX A;  4V3L C;  5D3P A;  4QST A;  3UV2 A;  4QF3 A;  2I7K A;  3MXF A;  5EWD A;  5EU1 A;  2XB1 A;  3UW9 A;  3HCT A;  3O70 A;  4S3O C;  5B79 A;  3FL2 A;  4HXS A;  5A5Q A;  4NRA A;  4O78 A;  2ECV A;  4TKP B;  4QR3 A;  5HEM A;  2QIZ A;  5CUG A;  4WHU A;  2DVR A;  3ASL A;  2XEU A;  3T7L A;  5JI8 A;  5D3L A;  5CUD A;  5I83 A;  4HBX A;  4QBM A;  5EP7 A;  2UZG A;  2JMJ A;  3ZNI A;  5DKH A;  5A81 A;  4IOQ A;  5EWC A;  2L84 A;  1VYX A;  4N3W A;  2JRJ A;  2RSD A;  4QY4 A;  4MR6 A;  4NR8 A;  5DW1 A;  5EQ1 A;  2MT5 A;  4YBT A;  4IR6 A;  4N4H A;  4TT2 A;  3QZS A;  4IR4 A;  3RCW A;  1WEP A;  3HME A;  3NXB A;  2Y1N A;  4WZ2 A;  5B76 A;  4C67 A;  4Z1Q A;  5G4R A;  4L58 A;  4BW1 A;  4FLP A;  3HCS A;  2OXQ C;  5E73 A;  4O77 A;  5AD2 A;  5LKX A;  1WUG A;  3DQV R;  5HRW A;  3L1X A;  2YEM A;  3P1F A;  4PY6 A;  4DON A;  4F3I A;  5COI A;  2MA5 A;  1X4J A;  1WEU A;  2OO1 A;  1WES A;  3HMF A;  5FE9 A;  5LVR A;  2OUO A;  4O72 A;  2YSJ A;  4FK5 A;  2LN0 A;  4OGI A;  4MEN A;  5FH7 A;  2DKW A;  5EGU A;  2C2L A;  4UI9 B;  4LZ2 A;  1IYM A;  4YYI A;  4MVT A;  4XY8 A;  2YHN A;  4CL9 A;  3U5J A;  4QUT A;  4XI1 A;  4ALG A;  4XUA A;  5K29 A;  3UVX A;  2K16 A;  5FE3 A;  1HYJ A;  5EWH A;  1FBV A;  4HXK A;  4LAD B;  4HBY A;  5LKT A;  3V43 A;  2WP1 A;  4LZR A;  5CS8 A;  4LC2 A;  4IOO A;  3SOU A;  4A4C A;  2LGG A;  5DYX A;  4ZW1 A;  4NR6 A;  5KH3 A;  5FE5 A;  4LJN A;  5EPS A;  4YYH A;  5FE2 A;  4I7B A;  4MSX A;  4BBQ A;  3P1E A;  2VNF A;  4A9I A;  2E7O A;  2ECG A;  4TZ8 A;  2MNZ A;  3MB3 A;  5LKU A;  4IC3 A;  3ZPV 1;  2VJF B;  5F60 A;  5H85 A;  5ENJ A;  2LDR A;  5F63 A;  4QR4 A;  2G4A A;  2E6R A;  2EOD A;  4CUT A;  2L75 A;  1EQF A;  5CP5 A;  4TU4 A;  5CQA A;  4BW3 A;  2CSY A;  4MR5 A;  3EB6 A;  5CQ7 A;  5DFC A;  5F36 A;  5KTW A;  3GV4 A;  5FE8 A;  4NUC A;  1T1H A;  4MEQ A;  3VK6 A;  4NR4 A;  5CU8 A;  4IR5 A;  5D3S A;  4CA1 A;  5DW2 A;  1FP0 A;  5II1 A;  4UYE A;  4R2Y A;  1DVP A;  2D9E A;  4AVX A;  2VP7 A;  5IID A;  1WFK A;  5D3T A;  4UYF B;  1WEM A;  3O37 A;  5TDW A;  3P1D A;  4O7E A;  2YHO A;  5F2P A;  4NRB A;  1WIM A;  4QSP A;  5IGM A;  4X3G A;  4O7F A;  5ENH A;  3UVY A;  5CUB A;  5KTX A;  3G0L A;  2M85 A;  5HJC A;  4GNE A;  5FH8 A;  5F1L A;  5FE4 A;  2FUU A;  5HLS A;  4OGJ A;  4NYX A;  4C66 A;  2RNX A;  5A7C A;  3MUK A;  5C85 A;  1WE9 A;  5KH7 A;  4J0R A;  1VD4 A;  1Z6U A;  3U5N A;  2Y43 A;  5I7X A;  4GPJ A;  2M1R A;  2Y1M A;  3ZVY A;  3ONI A;  1ZBD B;  5HCL A;  4B7Y C;  1ZS5 A;  4Z6H A;  4Q6F A;  4CCG X;  4LLB A;  4BHW A;  4C9Z A;  5G4S A;  1XWH A;  5CGP A;  5ENB A;  5C8G A;  2YW5 A;  5FFW A;  4TT4 A;  2LGV A;  5E74 A;  5D0C A;  4YH4 A;  5FEY A;  4TYL A;  4UIV A;  2ECN A;  5I89 A;  3DWY A;  5FBX A;  2HYE D;  4YBS A;  2DX8 A;  2KTB B;  5IGN A;  3C6W A;  3I3J A;  5D26 A;  1WIL A;  4YAT A;  4AYC A;  4CUU A;  5HEL A;  5EYA F;  2DWW A;  4YYJ A;  2EGP A;  3LQJ A;  5KH9 A;  3HMH A;  4GNG A;  1BOR A;  5B77 A;  2L80 A;  1MM3 A;  2E6S A;  5A5O A;  4QSQ A;  4QSW A;  3RTR B;  5C7N A;  2RNW A;  4QSX A;  5H1U A;  5TB6 A;  2YYN A;  2DVQ A;  3M62 A;  4ZDT A;  5DKD A;  5D24 A;  5J3X A;  5FB1 A;  2LV9 A;  4LYS A;  5EWV A;  5LVQ A;  3PUR A;  5AIU A;  5HM0 A;  5I1Q A;  4NUE A;  3L11 A;  4QF2 A;  4TU6 A;  4J3I A;  2C2V S;  4A9N A;  5FE1 A;  3K2J A;  5DYC A; 
#chains in the Genus database with same CATH topology
 1Z2Q A;  5L99 A;  5CY9 A;  4HXR A;  2F6N A;  4MR3 A;  3FEH A;  3DAI A;  4YAD A;  5IG6 A;  4OUF A;  4LKA A;  5D3R A;  2JUN A;  4CUP A;  1VFY A;  5CQT A;  5D25 A;  1HYI A;  5FER A;  4XUB A;  2LGL A;  1WEQ A;  3FJU B;  4A9E A;  4Z93 A;  4A9J A;  5C13 A;  4Z1S A;  5HRV A;  3TLP A;  4QUU A;  2KGG A;  2KYU A;  4YYM A;  4I7C A;  2YQD A;  5D1M B;  2YQL A;  5CRM A;  5F1H A;  4YAX A;  3SUB A;  2CRR A;  2YRE A;  2PUY A;  4B86 C;  4XYA A;  2KWK A;  1JSP B;  2KWO A;  4LZS A;  2ZET C;  5CTL A;  5B78 A;  2CSZ A;  3IHP A;  4UIT A;  2RNY A;  3D7C A;  3GL6 A;  4ALH A;  4Q0N A;  5TAB A;  4Z6I A;  2GRC A;  3P1C A;  4HXL A;  3UV5 A;  5FFY A;  2YUR A;  2MD7 B;  2QJ0 A;  5CUA A;  5C89 A;  2VJE A;  3LXJ A;  5LKZ A;  3UV4 A;  4WA6 A;  3FAO A;  2KKY A;  2LQ6 A;  4QSV A;  2K1J A;  5I29 A;  2MIQ A;  3O7A A;  5DX4 A;  5IGK A;  3LQI A;  3I2D A;  4HBW A;  4A9L A;  4O7C A;  4QEV A;  2L5U A;  4WIV A;  4IOR A;  4ZUX U;  4NR5 A;  5E9V A;  2R0V A;  5J0D A;  2LRI C;  3DPL R;  4O70 A;  2CT2 A;  2F6J A;  5E9M A;  3DDT A;  3IU5 A;  2KGI A;  2D8U A;  2KFT A;  2JMI A;  4A9O A;  5CFW A;  4NR7 A;  4O7A A;  2LXP C;  4QYL A;  1U6G B;  1G25 A;  4CUQ A;  5F62 A;  4WHW A;  5ENE A;  5FFV A;  5IBN A;  5CQ8 A;  5A85 A;  4CLB A;  1LDK C;  2EA6 A;  5L96 A;  4AKN A;  5ETD A;  5H1T A;  5HQ6 A;  5DFB A;  3HTK C;  3HCU A;  2BAY A;  2F42 A;  4A9K A;  4ZC9 A;  3DWD A;  2DVS A;  1RMD A;  2VJE B;  4R8P K;  5I80 A;  4UYD A;  2G45 A;  5FE6 A;  4BJX A;  4N4F A;  2YQM A;  2R10 A;  2CKL A;  4CFK A;  2EJN A;  1WEV A;  2VPG A;  4A49 A;  5K3Q A;  3JVJ A;  3ZYQ A;  5KHM A;  5SVI A;  4UIU A;  2R0Y A;  5ENI A;  4UYH A;  5EIS A;  2D8S A;  5E9L A;  3QZT A;  5ENC A;  4PS5 A;  4N4G A;  5A5R A;  2MD8 C;  3E2D A;  3PUQ A;  4A9M A;  2RS9 B;  2VPD A;  4GB0 A;  3U5P A;  5EPR A;  1Z60 A;  3MHS A;  2RFJ A;  5CPE A;  3PHD A;  2HDP A;  5FE7 A;  1K2F A;  5EWW A;  5EM3 A;  3T9K A;  5B8D A;  5ENF A;  4BW2 A;  2NAA A;  5B75 A;  3AAD A;  5CQ6 A;  1F68 A;  2KE1 A;  4V3K C;  3FKM X;  5DFD A;  4NUD A;  2FFW A;  3SVF A;  4TQN A;  2K4D A;  4LR6 A;  3LDY A;  5E9I A;  3RPG B;  3C5K A;  5CQ5 A;  2QIC A;  3N9N A;  5AMF A;  3U5M A;  4QNS A;  1X4U A;  4CFL A;  4W4U A;  3G0J A;  4Q0O A;  4NYV A;  2OSS A;  5E3D A;  3SOW A;  5FB0 A;  3U5L A;  3N9Q A;  5BT3 A;  4E96 A;  2YW8 A;  4A4B A;  1X0J A;  4KCX A;  2LXH C;  4UP5 A;  3LQH A;  4UIY A;  1E6I A;  5D3J A;  5EIC A;  5HQ5 A;  3N9O A;  2H60 A;  4GND A;  4LK9 A;  4Y03 A;  2ECW A;  2KWJ A;  4UYG A;  2LGK A;  1N72 A;  2DAT A;  4OGE A;  4TZ2 A;  1F62 A;  2LSP B;  5ETB A;  5FG4 A;  3ZYU A;  2YT5 A;  4QR5 A;  2H0D A;  4QC3 A;  2CKL B;  2M6M A;  5CRZ A;  5D1L B;  5TRB A;  2MA6 A;  5EK9 A;  2P57 A;  3MB4 A;  5DLX A;  5SVI B;  3LJU X;  4LRG A;  4LYW A;  5I7Y A;  4TTE A;  1WEW A;  4XY9 A;  2XOZ A;  4NN2 A;  4YYK A;  4QEU A;  5AIT A;  5AME A;  4KV1 A;  3LVR E;  4HXN A;  2DVV A;  3ZPV E;  4NRC A;  4A9F A;  5A5P A;  4MEO A;  4J0S A;  5A5N A;  4YY6 A;  4O76 A;  4YC9 A;  3KV5 A;  3ZTG A;  1X4I A;  3SOX A;  5JWM A;  4LDF A;  3LJW A;  4UIX A;  3IU6 A;  2VPB A;  5TDR A;  4I7D A;  1MM2 A;  4PCI A;  5LUU A;  2WP2 A;  4QC1 A;  5L97 A;  5CZG A;  4PTB A;  5AD3 A;  2L43 A;  3VKH A;  2L5E A;  3JVK A;  4QYD A;  3KV6 A;  5FH6 A;  3M63 A;  4FO9 A;  4AYC B;  3JVL A;  2MJV B;  5D7X A;  5EI4 A;  4O64 A;  4A9H A;  2R0S A;  5EA1 A;  5ENG A;  2VJF A;  3N9P A;  3N9L A;  4NR9 A;  4CUS A;  5B76 A;  4S3O B;  1WUM A;  5DY7 A;  5LJ1 A;  4Z0R A;  4AUQ B;  3N9M A;  4YYD A;  3Q2E A;  4J1P A;  1PUO A;  4BW4 A;  2KU3 A;  5H1V A;  2FSA A;  4YBM A;  5BT4 A;  5ACY A;  1LDJ B;  5E9K A;  2FUI A;  4YK0 A;  2K17 A;  4F52 B;  2H0D B;  5LJ0 A;  3LVQ E;  2RI7 A;  2YEL A;  4QB3 A;  5EPB A;  1WEE A;  2AN6 A;  5E3G A;  5L8U A;  2RO1 A;  3MUL A;  3Q2F A;  2I8N A;  5D1K B;  5D3N A;  3O36 A;  4UYF A;  4O75 A;  5G04 B;  4YAB A;  2JMD A;  3MHH A;  5DKC A;  5BT5 A;  4YY4 A;  4NXJ A;  4YYN A;  1WGM A;  5C4Q A;  4QSU A;  5HQ7 A;  4O62 A;  4H9D A;  3ERR A;  5A83 A;  2KR4 A;  2YYR A;  5H9M A;  5DYA A;  5FG6 A;  4ZQL A;  4FJC A;  4NQM A;  4HXM A;  5I88 A;  4PCE A;  5CQ4 A;  5SVY A;  4HXP A;  4O7B A;  3P5O A;  5IGL A;  3SVG A;  2KKX A;  5KTU A;  4GNF A;  5F25 A;  4P5O B;  2JM3 A;  3O35 A;  5FE0 A;  2FD4 A;  2YUC A;  5L8T A;  2NXB A;  5EVA A;  2YEK A;  2MUM A;  3O34 A;  4WZ0 A;  5EV9 A;  4YYG A;  5G0F A;  5C87 A;  4QSR A;  4YH3 A;  1WEN A;  1WEO A;  2KIZ A;  2ECJ A;  4HBV A;  5FG5 A;  4UIW A;  1JOC A;  3T6R A;  4UP0 A;  4QEW A;  4A0C D;  4QSS A;  3UVD A;  3NG2 A;  5LCW B;  3SVH A;  3SHB A;  3FAN A;  4R7E A;  3UVW A;  3KNV A;  2EXU A;  1N87 A;  5HRX A;  1JM7 A;  1E4U A;  4WZ3 B;  3S91 A;  4NYW A;  4IR3 A;  5DIN A;  4LYI A;  4RVR A;  2ECI A;  4FK5 A;  3RPG C;  3S92 A;  2YVR A;  5FDZ A;  4HXO A;  2L85 A;  2D82 A;  5E0R A;  2MNY A;  2E3K A;  5CQ3 A;  5C11 A;  4KV4 A;  3GG3 A;  4MEP A;  2G43 A;  5LJ2 A;  2G6Q A;  3EB5 A;  5G05 B;  5I40 A;  5CUE A;  4NS5 A;  2ECT A;  2KWN A;  5TBN A;  2XOY A;  4O71 A;  4Z0O A;  4AP4 A;  4QZS A;  4PPE A;  3ZVZ B;  1ZKR A;  2YSM A;  1CHC A;  2I50 A;  4PKL A;  5A5S A;  2YU4 A;  4NQN A;  5HFR A;  2E7N A;  2IDA A;  5I3L A;  4L7X A;  4UIZ A;  5F61 A;  2N9G A;  3FM8 C;  3MDB C;  5HEN A;  3M99 A;  4O74 A;  4X2I A;  5JG6 A;  2YDW A;  4MR4 A;  5DLZ A;  5II2 A;  3MQM A;  5KU3 A;  2VPE A;  3O33 A;  3LRQ A;  4N4I A;  2KRE A;  3KQI A;  3U5K A;  1JM4 B;  5D3H A;  5E9Y A;  5L98 A;  3U5O A;  1V87 A;  5E7D A;  2OWA A;  4IC2 A;  5DKA A;  4TT6 A;  2RR4 A;  3JVM A;  3AQA A;  5F3A A;  5CUC A;  5HFQ A;  4CUR A;  2M3H A;  3L1Z B;  5KO4 A;  1MBM A;  4TS8 A;  5DYU A;  1JM7 B;  2L0B A;  5I86 A;  5DBM A;  5TCM A;  5F5Z A;  4FIP A;  3QZV A;  5A82 A;  2MKE A;  2PNX A;  3H7H A;  4V3L C;  5D3P A;  4QST A;  3UV2 A;  2M13 A;  4QF3 A;  2I7K A;  3MXF A;  5EWD A;  5EU1 A;  2XB1 A;  3UW9 A;  3HCT A;  3O70 A;  4S3O C;  5B79 A;  3FL2 A;  4HXS A;  5A5Q A;  4NRA A;  4O78 A;  2ECV A;  4TKP B;  4QR3 A;  5HEM A;  2QIZ A;  5CUG A;  4WHU A;  2DVR A;  3ASL A;  2XEU A;  3T7L A;  5JI8 A;  5D3L A;  5CUD A;  5I83 A;  4HBX A;  4QBM A;  5EP7 A;  2UZG A;  2JMJ A;  3ZNI A;  5DKH A;  5A81 A;  4IOQ A;  5EWC A;  2L84 A;  1VYX A;  4N3W A;  2JRJ A;  2RSD A;  4QY4 A;  4MR6 A;  4QQ4 A;  4NR8 A;  5DW1 A;  5EQ1 A;  2MT5 A;  3PLW A;  4YBT A;  4IR6 A;  4N4H A;  4TT2 A;  3QZS A;  4IR4 A;  3RCW A;  1WEP A;  3HME A;  3NXB A;  2Y1N A;  3O47 A;  4WZ2 A;  4C67 A;  4Z1Q A;  5G4R A;  4L58 A;  4BW1 A;  3M7K A;  4FLP A;  3HCS A;  2OXQ C;  3D1B A;  5E73 A;  4O77 A;  5AD2 A;  5LKX A;  3D1D A;  1WUG A;  2DSM A;  2IQJ A;  3DQV R;  5HRW A;  3L1X A;  2YEM A;  3P1F A;  4PY6 A;  4DON A;  4F3I A;  5COI A;  2MA5 A;  1X4J A;  2XOC A;  1WEU A;  2OO1 A;  1WES A;  3HMF A;  5FE9 A;  5LVR A;  2OUO A;  4O72 A;  2XP0 A;  2YSJ A;  2LN0 A;  4OGI A;  4MEN A;  5FH7 A;  2DKW A;  5EGU A;  2C2L A;  4UI9 B;  4LZ2 A;  1IYM A;  4YYI A;  3Q1D A;  4MVT A;  4XY8 A;  2YHN A;  4CL9 A;  3U5J A;  4QUT A;  4XI1 A;  4ALG A;  4XUA A;  5K29 A;  3UVX A;  3VKG A;  2K16 A;  5FE3 A;  1HYJ A;  5EWH A;  4AKI A;  1FBV A;  4HXK A;  4LAD B;  4HBY A;  5LKT A;  3V43 A;  2WP1 A;  4LZR A;  5CS8 A;  4LC2 A;  4IOO A;  3SOU A;  4A4C A;  4OGC A;  2LGG A;  5DYX A;  4ZW1 A;  4NR6 A;  5KH3 A;  5FE5 A;  4LJN A;  5EPS A;  4YYH A;  5FE2 A;  4I7B A;  5SVX A;  4MSX A;  4BBQ A;  3P1E A;  2VNF A;  4A9I A;  2E7O A;  2ECG A;  4TZ8 A;  2MNZ A;  3MB3 A;  5LKU A;  4IC3 A;  3ZPV 1;  2CRW A;  2VJF B;  5F60 A;  5H85 A;  5ENJ A;  2LDR A;  5F63 A;  4QR4 A;  2G4A A;  2E6R A;  2EOD A;  4CUT A;  2L75 A;  1EQF A;  5CP5 A;  4TU4 A;  5CQA A;  4BW3 A;  2CSY A;  4MR5 A;  3EB6 A;  5CQ7 A;  5DFC A;  4F1P A;  5F36 A;  5KTW A;  2LAU A;  3GV4 A;  5FE8 A;  4NUC A;  1T1H A;  4MEQ A;  3VK6 A;  4NR4 A;  5CU8 A;  4IR5 A;  5D3S A;  2DJA A;  4CA1 A;  5DW2 A;  1FP0 A;  5II1 A;  4UYE A;  4R2Y A;  1DVP A;  2D9E A;  4AVX A;  2VP7 A;  3KDE C;  5IID A;  1WFK A;  5D3T A;  4UYF B;  1WEM A;  3O37 A;  5TDW A;  3P1D A;  4O7E A;  2YHO A;  5F2P A;  4NRB A;  1WIM A;  4QSP A;  5IGM A;  4X3G A;  4O7F A;  5ENH A;  3UVY A;  5CUB A;  5KTX A;  3G0L A;  2M85 A;  5HJC A;  4GNE A;  5FH8 A;  5F1L A;  5FE4 A;  2FUU A;  5HLS A;  4OGJ A;  4NYX A;  4C66 A;  2RNX A;  5A7C A;  3MUK A;  5C85 A;  1WE9 A;  5KH7 A;  4AI6 A;  4J0R A;  1VD4 A;  1Z6U A;  3U5N A;  2Y43 A;  2L7P A;  2B0O E;  5I7X A;  4GPJ A;  2M1R A;  2Y1M A;  3ZVY A;  3ONI A;  1ZBD B;  5HCL A;  4B7Y C;  1ZS5 A;  4Z6H A;  4Q6F A;  4CCG X;  4LLB A;  4BHW A;  4C9Z A;  5G4S A;  1XWH A;  5CGP A;  5ENB A;  5C8G A;  3JUE A;  2YW5 A;  5FFW A;  4TT4 A;  2EGM A;  5E74 A;  5D0C A;  2LGV A;  4YH4 A;  5FEY A;  4TYL A;  4UIV A;  2ECN A;  5I89 A;  3DWY A;  5FBX A;  2HYE D;  4YBS A;  2DX8 A;  2KTB B;  5IGN A;  3C6W A;  2E61 A;  3I3J A;  5D26 A;  1WIL A;  4YAT A;  4AYC A;  4CUU A;  5HEL A;  5EYA F;  2DWW A;  4YYJ A;  2EGP A;  4AKG A;  3LQJ A;  5KH9 A;  3HMH A;  4GNG A;  1BOR A;  5B77 A;  2L80 A;  1MM3 A;  2E6S A;  5A5O A;  4QSQ A;  2CON A;  4QSW A;  4AKH A;  1DCQ A;  5C7N A;  2RNW A;  4QSX A;  3RTR B;  5H1U A;  5TB6 A;  2YYN A;  2DVQ A;  3M62 A;  4ZDT A;  5DKD A;  5D24 A;  5J3X A;  5FB1 A;  2LV9 A;  4LYS A;  5EWV A;  5LVQ A;  3PUR A;  2CSV A;  5AIU A;  5HM0 A;  5I1Q A;  4NUE A;  3L11 A;  4QF2 A;  4TU6 A;  4J3I A;  2C2V S;  4A9N A;  5FE1 A;  3K2J A;  5DYC A; 
#chains in the Genus database with same CATH homology
 1Z2Q A;  5L99 A;  5CY9 A;  4HXR A;  2F6N A;  4MR3 A;  3DAI A;  4YAD A;  5IG6 A;  4OUF A;  4LKA A;  5D3R A;  4CUP A;  1VFY A;  5CQT A;  5D25 A;  1HYI A;  5FER A;  4XUB A;  2LGL A;  1WEQ A;  4A9E A;  4Z93 A;  4A9J A;  5C13 A;  4Z1S A;  5HRV A;  3TLP A;  4QUU A;  2KGG A;  2KYU A;  4YYM A;  4I7C A;  2YQD A;  5D1M B;  2YQL A;  5CRM A;  5F1H A;  4YAX A;  2YRE A;  2PUY A;  4B86 C;  4XYA A;  2KWK A;  1JSP B;  2KWO A;  4LZS A;  2ZET C;  5CTL A;  5B78 A;  2CSZ A;  3IHP A;  4UIT A;  2RNY A;  3D7C A;  3GL6 A;  4ALH A;  4Q0N A;  5TAB A;  4Z6I A;  2GRC A;  3P1C A;  4HXL A;  3UV5 A;  5FFY A;  2YUR A;  2MD7 B;  2QJ0 A;  5CUA A;  5C89 A;  2VJE A;  3LXJ A;  5LKZ A;  3UV4 A;  4WA6 A;  2LQ6 A;  4QSV A;  2K1J A;  5I29 A;  2MIQ A;  3O7A A;  5DX4 A;  5IGK A;  3LQI A;  3I2D A;  4HBW A;  4A9L A;  4O7C A;  4QEV A;  2L5U A;  4WIV A;  4IOR A;  4ZUX U;  4NR5 A;  5E9V A;  2R0V A;  5J0D A;  2LRI C;  3DPL R;  4O70 A;  2CT2 A;  2F6J A;  5E9M A;  3IU5 A;  2KGI A;  2KFT A;  2JMI A;  4A9O A;  5CFW A;  4NR7 A;  4O7A A;  2LXP C;  4QYL A;  1U6G B;  1G25 A;  4CUQ A;  5F62 A;  4WHW A;  5ENE A;  5FFV A;  5IBN A;  5CQ8 A;  5A85 A;  4CLB A;  1LDK C;  2EA6 A;  5L96 A;  4AKN A;  5ETD A;  5H1T A;  5HQ6 A;  5DFB A;  3HTK C;  3HCU A;  2BAY A;  2F42 A;  4A9K A;  4ZC9 A;  2DVS A;  1RMD A;  2VJE B;  4R8P K;  5I80 A;  4UYD A;  2G45 A;  5FE6 A;  4BJX A;  4N4F A;  2YQM A;  2R10 A;  2CKL A;  4CFK A;  1WEV A;  2VPG A;  4A49 A;  3JVJ A;  3ZYQ A;  5KHM A;  4UIU A;  2R0Y A;  5ENI A;  4UYH A;  5EIS A;  2D8S A;  5E9L A;  3QZT A;  5ENC A;  4PS5 A;  4N4G A;  5A5R A;  2MD8 C;  3PUQ A;  4A9M A;  2RS9 B;  2VPD A;  4GB0 A;  3U5P A;  5EPR A;  1Z60 A;  3MHS A;  2RFJ A;  5CPE A;  3PHD A;  2HDP A;  5FE7 A;  1K2F A;  5EWW A;  5EM3 A;  5B8D A;  5ENF A;  4BW2 A;  2NAA A;  5B75 A;  3AAD A;  5CQ6 A;  1F68 A;  2KE1 A;  4V3K C;  3FKM X;  5DFD A;  4NUD A;  2K4D A;  3SVF A;  4TQN A;  4LR6 A;  5E9I A;  3RPG B;  3C5K A;  5CQ5 A;  2QIC A;  3N9N A;  5AMF A;  3U5M A;  4QNS A;  1X4U A;  4CFL A;  4W4U A;  3G0J A;  4Q0O A;  4NYV A;  2OSS A;  5E3D A;  3SOW A;  5FB0 A;  3U5L A;  3N9Q A;  5BT3 A;  4E96 A;  2YW8 A;  4A4B A;  1X0J A;  4KCX A;  2LXH C;  4UP5 A;  3LQH A;  4UIY A;  1E6I A;  5D3J A;  5EIC A;  5HQ5 A;  3N9O A;  2H60 A;  4GND A;  4LK9 A;  4Y03 A;  2ECW A;  2KWJ A;  4UYG A;  2LGK A;  1N72 A;  2DAT A;  4TZ2 A;  1F62 A;  2LSP B;  5ETB A;  5FG4 A;  3ZYU A;  2YT5 A;  4QR5 A;  2H0D A;  4QC3 A;  2CKL B;  2M6M A;  5CRZ A;  5D1L B;  5TRB A;  2MA6 A;  5EK9 A;  3MB4 A;  5DLX A;  4NN2 A;  4LRG A;  4LYW A;  5I7Y A;  4TTE A;  1WEW A;  4XY9 A;  4YYK A;  4QEU A;  5AIT A;  5AME A;  4KV1 A;  4HXN A;  2DVV A;  3ZPV E;  4NRC A;  4A9F A;  5A5P A;  4MEO A;  4J0S A;  5A5N A;  4YY6 A;  4O76 A;  4YC9 A;  3KV5 A;  3ZTG A;  1X4I A;  3SOX A;  5JWM A;  4LDF A;  3LJW A;  4UIX A;  3IU6 A;  2VPB A;  5TDR A;  4I7D A;  1MM2 A;  4PCI A;  5LUU A;  2WP2 A;  4QC1 A;  5L97 A;  5CZG A;  4PTB A;  5AD3 A;  2L43 A;  2L5E A;  3JVK A;  4QYD A;  3KV6 A;  5FH6 A;  3M63 A;  4FO9 A;  4AYC B;  3JVL A;  2MJV B;  5D7X A;  5EI4 A;  4O64 A;  4A9H A;  2R0S A;  5EA1 A;  5ENG A;  2VJF A;  3N9P A;  3N9L A;  4NR9 A;  4CUS A;  4S3O B;  1WUM A;  5DY7 A;  5LJ1 A;  4AUQ B;  3N9M A;  4YYD A;  3Q2E A;  4J1P A;  4BW4 A;  2KU3 A;  5H1V A;  2FSA A;  4YBM A;  5BT4 A;  5ACY A;  1LDJ B;  5E9K A;  2FUI A;  4YK0 A;  2K17 A;  4F52 B;  2H0D B;  5LJ0 A;  2RI7 A;  2YEL A;  4QB3 A;  5EPB A;  1WEE A;  2AN6 A;  5E3G A;  5L8U A;  2RO1 A;  3MUL A;  3Q2F A;  2I8N A;  5D1K B;  5D3N A;  3O36 A;  4UYF A;  4O75 A;  5G04 B;  4YAB A;  2JMD A;  3MHH A;  5DKC A;  5BT5 A;  4YY4 A;  4NXJ A;  4YYN A;  1WGM A;  5C4Q A;  4QSU A;  5HQ7 A;  5A83 A;  2KR4 A;  2YYR A;  5H9M A;  5DYA A;  5FG6 A;  4ZQL A;  4FJC A;  4NQM A;  4HXM A;  5I88 A;  4PCE A;  5CQ4 A;  4HXP A;  4O7B A;  3P5O A;  5IGL A;  3SVG A;  5KTU A;  4GNF A;  5F25 A;  4P5O B;  3O35 A;  5FE0 A;  2YUC A;  5L8T A;  2NXB A;  5EVA A;  2YEK A;  2MUM A;  3O34 A;  4WZ0 A;  5EV9 A;  4YYG A;  5G0F A;  5C87 A;  4QSR A;  4YH3 A;  1WEN A;  1WEO A;  2KIZ A;  2ECJ A;  4HBV A;  5FG5 A;  4UIW A;  1JOC A;  3T6R A;  4UP0 A;  4QEW A;  4A0C D;  4QSS A;  3UVD A;  3NG2 A;  5LCW B;  3SVH A;  3SHB A;  4R7E A;  3UVW A;  3KNV A;  1N87 A;  5HRX A;  1JM7 A;  1E4U A;  4WZ3 B;  3S91 A;  4NYW A;  4IR3 A;  5DIN A;  4LYI A;  4RVR A;  2ECI A;  3RPG C;  3S92 A;  5FDZ A;  4HXO A;  2L85 A;  2D82 A;  5E0R A;  2MNY A;  2E3K A;  5CQ3 A;  5C11 A;  4KV4 A;  3GG3 A;  4MEP A;  2G43 A;  5LJ2 A;  2G6Q A;  3EB5 A;  5G05 B;  5I40 A;  5CUE A;  4NS5 A;  2ECT A;  2KWN A;  5TBN A;  4O71 A;  4AP4 A;  4QZS A;  4PPE A;  3ZVZ B;  2YSM A;  1CHC A;  2I50 A;  4PKL A;  5A5S A;  2YU4 A;  4NQN A;  5HFR A;  2E7N A;  2IDA A;  5I3L A;  4L7X A;  4UIZ A;  5F61 A;  2N9G A;  5HEN A;  3M99 A;  4O74 A;  4X2I A;  5JG6 A;  2YDW A;  4MR4 A;  5DLZ A;  5II2 A;  3MQM A;  5KU3 A;  2VPE A;  3O33 A;  3LRQ A;  4N4I A;  2KRE A;  3KQI A;  3U5K A;  1JM4 B;  5D3H A;  5E9Y A;  5L98 A;  3U5O A;  1V87 A;  5E7D A;  4IC2 A;  5DKA A;  4TT6 A;  3JVM A;  3AQA A;  5F3A A;  5CUC A;  5HFQ A;  4CUR A;  2M3H A;  3L1Z B;  5KO4 A;  4TS8 A;  5DYU A;  1JM7 B;  2L0B A;  5I86 A;  5DBM A;  5TCM A;  5F5Z A;  4FIP A;  3QZV A;  5A82 A;  2PNX A;  4V3L C;  5D3P A;  4QST A;  3UV2 A;  4QF3 A;  2I7K A;  3MXF A;  5EWD A;  5EU1 A;  2XB1 A;  3UW9 A;  3HCT A;  3O70 A;  4S3O C;  5B79 A;  3FL2 A;  4HXS A;  5A5Q A;  4NRA A;  4O78 A;  2ECV A;  4TKP B;  4QR3 A;  5HEM A;  2QIZ A;  5CUG A;  4WHU A;  2DVR A;  3ASL A;  2XEU A;  3T7L A;  5JI8 A;  5D3L A;  5CUD A;  5I83 A;  4HBX A;  4QBM A;  5EP7 A;  2UZG A;  2JMJ A;  3ZNI A;  5DKH A;  5A81 A;  4IOQ A;  5EWC A;  2L84 A;  1VYX A;  4N3W A;  2JRJ A;  2RSD A;  4QY4 A;  4MR6 A;  4NR8 A;  5DW1 A;  5EQ1 A;  2MT5 A;  4YBT A;  4IR6 A;  4N4H A;  4TT2 A;  3QZS A;  4IR4 A;  3RCW A;  1WEP A;  3HME A;  3NXB A;  2Y1N A;  4WZ2 A;  5B76 A;  4C67 A;  4Z1Q A;  5G4R A;  4L58 A;  4BW1 A;  4FLP A;  3HCS A;  2OXQ C;  5E73 A;  4O77 A;  5AD2 A;  5LKX A;  1WUG A;  3DQV R;  5HRW A;  3L1X A;  2YEM A;  3P1F A;  4PY6 A;  4DON A;  4F3I A;  5COI A;  2MA5 A;  1X4J A;  1WEU A;  2OO1 A;  1WES A;  3HMF A;  5FE9 A;  5LVR A;  2OUO A;  4O72 A;  2YSJ A;  4FK5 A;  2LN0 A;  4OGI A;  4MEN A;  5FH7 A;  2DKW A;  5EGU A;  2C2L A;  4UI9 B;  4LZ2 A;  1IYM A;  4YYI A;  4MVT A;  4XY8 A;  2YHN A;  4CL9 A;  3U5J A;  4QUT A;  4XI1 A;  4ALG A;  4XUA A;  5K29 A;  3UVX A;  2K16 A;  5FE3 A;  1HYJ A;  5EWH A;  1FBV A;  4HXK A;  4LAD B;  4HBY A;  5LKT A;  3V43 A;  2WP1 A;  4LZR A;  5CS8 A;  4LC2 A;  4IOO A;  3SOU A;  4A4C A;  2LGG A;  5DYX A;  4ZW1 A;  4NR6 A;  5KH3 A;  5FE5 A;  4LJN A;  5EPS A;  4YYH A;  5FE2 A;  4I7B A;  4MSX A;  4BBQ A;  3P1E A;  2VNF A;  4A9I A;  2E7O A;  2ECG A;  4TZ8 A;  2MNZ A;  3MB3 A;  5LKU A;  4IC3 A;  3ZPV 1;  2VJF B;  5F60 A;  5H85 A;  5ENJ A;  2LDR A;  5F63 A;  4QR4 A;  2G4A A;  2E6R A;  2EOD A;  4CUT A;  2L75 A;  1EQF A;  5CP5 A;  4TU4 A;  5CQA A;  4BW3 A;  2CSY A;  4MR5 A;  3EB6 A;  5CQ7 A;  5DFC A;  5F36 A;  5KTW A;  3GV4 A;  5FE8 A;  4NUC A;  1T1H A;  4MEQ A;  3VK6 A;  4NR4 A;  5CU8 A;  4IR5 A;  5D3S A;  4CA1 A;  5DW2 A;  1FP0 A;  5II1 A;  4UYE A;  4R2Y A;  1DVP A;  2D9E A;  4AVX A;  2VP7 A;  5IID A;  1WFK A;  5D3T A;  4UYF B;  1WEM A;  3O37 A;  5TDW A;  3P1D A;  4O7E A;  2YHO A;  5F2P A;  4NRB A;  1WIM A;  4QSP A;  5IGM A;  4X3G A;  4O7F A;  5ENH A;  3UVY A;  5CUB A;  5KTX A;  3G0L A;  2M85 A;  5HJC A;  4GNE A;  5FH8 A;  5F1L A;  5FE4 A;  2FUU A;  5HLS A;  4OGJ A;  4NYX A;  4C66 A;  2RNX A;  5A7C A;  3MUK A;  5C85 A;  1WE9 A;  5KH7 A;  4J0R A;  1VD4 A;  1Z6U A;  3U5N A;  2Y43 A;  5I7X A;  4GPJ A;  2M1R A;  2Y1M A;  3ZVY A;  3ONI A;  1ZBD B;  5HCL A;  4B7Y C;  1ZS5 A;  4Z6H A;  4Q6F A;  4CCG X;  4LLB A;  4BHW A;  4C9Z A;  5G4S A;  1XWH A;  5CGP A;  5ENB A;  5C8G A;  2YW5 A;  5FFW A;  4TT4 A;  2LGV A;  5E74 A;  5D0C A;  4YH4 A;  5FEY A;  4TYL A;  4UIV A;  2ECN A;  5I89 A;  3DWY A;  5FBX A;  2HYE D;  4YBS A;  2DX8 A;  2KTB B;  5IGN A;  3C6W A;  3I3J A;  5D26 A;  1WIL A;  4YAT A;  4AYC A;  4CUU A;  5HEL A;  5EYA F;  2DWW A;  4YYJ A;  2EGP A;  3LQJ A;  5KH9 A;  3HMH A;  4GNG A;  1BOR A;  5B77 A;  2L80 A;  1MM3 A;  2E6S A;  5A5O A;  4QSQ A;  4QSW A;  3RTR B;  5C7N A;  2RNW A;  4QSX A;  5H1U A;  5TB6 A;  2YYN A;  2DVQ A;  3M62 A;  4ZDT A;  5DKD A;  5D24 A;  5J3X A;  5FB1 A;  2LV9 A;  4LYS A;  5EWV A;  5LVQ A;  3PUR A;  5AIU A;  5HM0 A;  5I1Q A;  4NUE A;  3L11 A;  4QF2 A;  4TU6 A;  4J3I A;  2C2V S;  4A9N A;  5FE1 A;  3K2J A;  5DYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...