3O35A

Crystal structure of trim24 phd-bromo complexed with h3(23-31)k27ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
178
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 53
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o35A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o35A01
2YURA 5D1KB 5HENA 4V3KC 2R10A 5FG5A 4YY4A 5EWDA 2CT2A 4GPJA 4UIVA 5A5PA 2ECTA 5L8UA 5ACYA 3HCUA 4QUUA 3N9NA 5CQAA 2NAAA 1E6IA 4BW1A 3U5KA 5CRZA 5CTLA 5KH9A 5BT5A 4UIWA 2K17A 2R0YA 4LYSA 4TT4A 5CGPA 4J1PA 3U5PA 5E9IA 2F6NA 2YU4A 4CUUA 3AADA 1WEOA 2LXHC 3JVMA 3ONIA 5J0DA 4YABA 4B7YC 2R0VA 5EPBA 5A5RA 4YBTA 2JRJA 4NQNA 4Z1QA 4L58A 3GG3A 1WEEA 4UYFB 4QSRA 5A81A 2MD7B 1VYXA 5L98A 3UVWA 5L8TA 5F2PA 5IGNA 3O70A 5D1MB 5ENFA 3IU5A 5D3SA 2F6JA 5HLSA 1Z60A 5AIUA 3ZPV1 2VJEA 2BAYA 5EI4A 4OGJA 4QZSA 4QSUA 5IGKA 2MA6A 4AUQB 4C9ZA 1MM2A 5I83A 4YYKA 4QY4A 5EPSA 5HFQA 3C5KA 5LCWB 4HBVA 1HYJA 2LXPC 4MR4A 5CQ5A 2VPEA 4WHUA 5CRMA 3O34A 4N4FA 4UP5A 5TCMA 2DX8A 5FE7A 1FBVA 5DY7A 3IU6A 5AD3A 3P1CA 4NR7A 5D3PA 5CPEA 2DVRA 2RNWA 2M1RA 4XY8A 4Z6HA 3U5LA 4UP0A 5D25A 2RI7A 2ECGA 2KGIA 3QZTA 4O76A 4GNFA 4YYMA 5DW2A 5A82A 5B75A 4QSPA 5EWHA 2E6SA 1RMDA 4NRCA 2IDAA 5D0CA 1U6GB 4Q0OA 3LJWA 1WEWA 4F3IA 5HJCA 4PPEA 5CU8A 4IR3A 4QYLA 4MENA 5EWWA 5TDWA 4NS5A 5B79A 4Q6FA 2E3KA 4NR4A 3PUQA 4CUSA 1JM4B 3MULA 5ETBA 3HCSA 3RPGB 5F5ZA 2DVSA 5I89A 3O7AA 5HQ7A 3I3JA 5E9LA 3HMHA 5HEMA 4UIZA 4MR3A 4QC1A 3DQVR 5KO4A 5EK9A 2KR4A 2NXBA 2Y1NA 3KV6A 5HRWA 3MUKA 3N9LA 5F1LA 5AMFA 5F60A 4UIUA 2YREA 4A49A 5TB6A 4XUAA 4A9IA 4NYVA 5C8GA 1WEUA 3MHHA 3JVJA 4TYLA 4YBSA 3GV4A 5AD2A 4DONA 4HBWA 4YYJA 5F25A 5FH6A 2YELA 4YY6A 4GNGA 4PTBA 4WZ0A 1JM7B 5KTWA 2KREA 4N4HA 2MT5A 5EV9A 2QICA 3L1XA 2MD8C 5A5OA 2KWOA 4MR5A 1X4UA 4A9MA 5D3RA 5CUAA 5H1TA 5E9MA 2FSAA 5C7NA 3QZSA 4YYHA 4HXMA 2VPBA 3N9MA 4LKAA 3ZTGA 4J0SA 5DLXA 3PHDA 2G6QA 4LC2A 2VNFA 5I1QA 4LZRA 5HM0A 3DAIA 2KWKA 5AMEA 5HCLA 2R0SA 2LGLA 3P5OA 4NR5A 4MEQA 2KFTA 3MHSA 3NG2A 4QEWA 2KU3A 2E7NA 3K2JA 5EA1A 4A9KA 5D1LB 4N3WA 3O37A 2F42A 4NN2A 3D7CA 4TQNA 5DYUA 2MIQA 4ZDTA 5I86A 5LKXA 4ZUXU 2ECIA 4HXLA 2G43A 4HXNA 1JM7A 4HXKA 3SOXA 2E6RA 5CP5A 5II1A 1Z6UA 5E9VA 4A4BA 2L75A 2H0DB 2LGKA 3L1ZB 5I80A 3SVGA 4ALHA 4E96A 4CUQA 4YH3A 4YC9A 5FG4A 2L80A 5FB0A 4CFLA 4CURA 3RPGC 2L0BA 5KH7A 2LRIC 3FKMX 5DYAA 3SVFA 5KTUA 5I88A 2YQMA 5H85A 2L5EA 4LRGA 2YW8A 2C2VS 4IORA 3QZVA 4YAXA 5C85A 4PY6A 5FE4A 5KHMA 3KNVA 5LUUA 4O64A 4O72A 4GB0A 5G04B 3RCWA 5A7CA 5FE3A 1XWHA 4FLPA 5FE0A 2OUOA 5ENIA 4YYDA 5EYAF 2H0DA 5EM3A 4NUCA 4LR6A 4CA1A 4KV4A 5EISA 4O7FA 5CUBA 4YYNA 4NUDA 2QIZA 4TT2A 3ZNIA 4R8PK 4GNEA 4TU4A 4WZ2A 3T6RA 3O36A 4O71A 1WGMA 4V3LC 5IG6A 2YHNA 4LADB 4PCIA 2YQDA 4YYIA 5B78A 2M85A 5FFWA 1EQFA 3S91A 2FUUA 5IBNA 4QF2A 4UYFA 5HQ6A 3SVHA 5A83A 4MEPA 2RFJA 2KIZA 4TZ8A 5EWVA 5JWMA 4QSVA 5D3HA 3GL6A 5I3LA 4PCEA 4TS8A 5ENBA 4QEVA 4A9LA 5COIA 4YH4A 2ECJA 4L7XA 4IR5A 5HRVA 4XI1A 5ENHA 5BT4A 3ZYUA 2EGPA 4CLBA 1ZBDB 1WUMA 5A5NA 1HYIA 5A85A 3DPLR 5E7DA 4ZW1A 1JSPB 5DKAA 4A0CD 4UITA 5EVAA 1BORA 3N9OA 4FK5A 5I7XA 2DKWA 2JMJA 5FEYA 4J0RA 5HRXA 1WEQA 2KWNA 2MA5A 4MSXA 5E3GA 4LJNA 4CFKA 4QEUA 3HMFA 3U5OA 5ENGA 4CL9A 4IR6A 2L5UA 4WA6A 5FERA 4R2YA 2G4AA 2L84A 3U5JA 4I7CA 4UIYA 1X0JA 4QB3A 4QR3A 4YADA 3ASLA 5DINA 2GRCA 1WESA 4A9HA 4QSQA 4LDFA 5DFBA 5L96A 5IIDA 3Q2EA 5IGLA 2VJFB 5D3NA 4UI9B 4HXOA 4W4UA 5D26A 2WP1A 1ZS5A 4TKPB 4O7AA 5ENEA 3UV2A 3KQIA 4IOOA 5EP7A 5II2A 4YBMA 5I7YA 2HYED 3EB5A 1IYMA 5D3TA 2D9EA 2UZGA 5DKHA 1F62A 5C87A 3G0LA 1X4JA 3NXBA 5E74A 4ALGA 5K29A 4NR9A 2I7KA 2M6MA 4FJCA 5TRBA 4LLBA 5FBXA 4O77A 4WHWA 3PURA 3EB6A 5TBNA 2VPGA 3O33A 3N9PA 1E4UA 2YT5A 4C66A 5B76A 2H60A 3S92A 4HBYA 5DKCA 2VPDA 5D24A 3M99A 5H1UA 4GNDA 5D7XA 4J3IA 4HXPA 3UW9A 4NR6A 2N9GA 5G05B 4AYCB 5DYXA 1WEMA 4MVTA 2XB1A 4B86C 3P1DA 2MNYA 3SOWA 1DVPA 2PUYA 5LKUA 2AN6A 2YYNA 3UVXA 4Y03A 5FB1A 2I50A 4S3OB 5FE8A 5IGMA 5G0FA 4MR6A 5DKDA 2YEMA 5FFYA 4XY9A 4O75A 5F63A 4QC3A 4F52B 2MUMA 4HBXA 3ZYQA 3O35A 2HDPA 2DWWA 3M63A 4N4IA 5E3DA 2KTBB 5A5QA 3U5MA 4HXSA 2CKLB 2CSYA 4IC3A 3AQAA 5I40A 1F68A 4QF3A 3ZVZB 2MJVB 5DX4A 4X2IA 2K4DA 4BJXA 4QSSA 4UYEA 4CUTA 3UVDA 5CQTA 1WUGA 1WFKA 3UVYA 3LQJA 5C11A 5LKTA 4YK0A 5CUCA 4O7EA 5G4SA 2ECNA 5FE5A 2VJEB 4IC2A 4NR8A 2LV9A 5BT3A 4OUFA 5ETDA 5I29A 4ZC9A 1WENA 4UYDA 4KCXA 3U5NA 3ZPVE 2YDWA 3LXJA 5F3AA 3MXFA 2XEUA 5C13A 5FE6A 3LQIA 3UV5A 5E0RA 4TU6A 5LVRA 5DBMA 5EQ1A 2RNYA 2C2LA 4FO9A 5LJ0A 5ENJA 5B77A 4YYGA 3MQMA 2CKLA 3JVKA 4O78A 4UYHA 2D82A 4TT6A 5F1HA 2EODA 4A9NA 4P5OB 5JG6A 4C67A 4Z93A 4N4GA 2KYUA 2EA6A 2KGGA 1WEVA 4UYGA 4O70A 1N72A 4PS5A 4A9OA 3HTKC 3MB4A 3I2DA 1VFYA 5LJ1A 4NXJA 3IHPA 2OO1A 4NRBA 4QBMA 3JVLA 4XYAA 5C89A 5J3XA 5B8DA 5CS8A 5FH8A 4BHWA 2K16A 2Y43A 5CFWA 5FE9A 2ECVA 5E9KA 2L43A 1T1HA 3V43A 4LYIA 2RSDA 1Z2QA 4ZQLA 5F36A 2YSJA 2YUCA 4S3OC 4XUBA 4BW2A 1VD4A 5AITA 1JOCA 4AVXA 4QSXA 3KV5A 3FL2A 4TZ2A 4KV1A 4QR4A 1WE9A 5DFCA 1LDJB 5KH3A 4O7BA 2YHOA 2YQLA 4QSWA 1CHCA 5TDRA 4A4CA 4X3GA 4CCGX 2K1JA 4FIPA 5CUDA 2YSMA 3SOUA 2E7OA 3C6WA 4NRAA 4R7EA 4O74A 4UIXA 5DFDA 5CQ4A 5EGUA 4LYWA 5D3LA 4QSTA 3P1FA 5FG6A 2I8NA 4OGIA 4BBQA 4IR4A 2L85A 3G0JA 5CUEA 5KU3A 5HQ5A 2LQ6A 2RO1A 3DWYA 4QR5A 4IOQA 5FE2A 2WP2A 2OXQC 5E73A 3T7LA 3VK6A 4BW4A 2ZETC 3UV4A 5CQ3A 2JMIA 4NYXA 2YYRA 3HCTA 2RNXA 3M62A 3HMEA 4YATA 1N87A 2ECWA 4LZ2A 5DLZA 5TABA 2OSSA 5DW1A 4Z1SA 5EPRA 2KE1A 5JI8A 4QNSA 5LKZA 5H1VA 2LSPB 5HFRA 4WIVA 5HELA 3MB3A 2KWJA 4AKNA 5L99A 2QJ0A 5KTXA 5L97A 2G45A 4A9EA 2LN0A 4LZSA 4NUEA 4O7CA 4PKLA 5EWCA 2D8SA 5F62A 4Q0NA 5FE1A 5D3JA 5EICA 5FH7A 5FFVA 1G25A 2LGVA 4A9JA 5DYCA 5G4RA 3Q2FA 5CQ6A 5FDZA 2M3HA 4BW3A 3SHBA 2MNZA 3ZVYA 4QUTA 2VJFA 4TTEA 1WILA 5CQ8A 5A5SA 4I7BA 5C4QA 4AP4A 4I7DA 2DATA 4NYWA 2PNXA 1V87A 4LK9A 5CY9A 5E9YA 4Z6IA 3L11A 1WIMA 2VP7A 4MEOA 2YEKA 1MM3A 2FUIA 2JMDA 1X4IA 2Y1MA 5CZGA 5EU1A 2CSZA 5F61A 1LDKC 4RVRA 4CUPA 2DVQA 2RS9B 4QYDA 3P1EA 5ENCA 3N9QA 5H9MA 2DVVA 2LDRA 2YW5A 4HXRA 5LVQA 1FP0A 4WZ3B 4A9FA 3LRQA 3LQHA 4NQMA 2LGGA 3RTRB 5CUGA 3TLPA 4AYCA 1K2FA 1WEPA 5LJ2A 5CQ7A
chains in the Genus database with same CATH superfamily
2YURA 5D1KB 5HENA 4V3KC 2R10A 5FG5A 4YY4A 5EWDA 4AKHA 2CT2A 4Z0OA 4GPJA 4UIVA 3H7HA 5A5PA 2ECTA 5L8UA 5ACYA 3HCUA 4QUUA 3N9NA 5CQAA 4O62A 2NAAA 1E6IA 4BW1A 3U5KA 5CRZA 5CTLA 5KH9A 5BT5A 4UIWA 2K17A 2R0YA 4LYSA 4TT4A 5CGPA 3MDBC 4J1PA 3U5PA 5E9IA 2F6NA 2YU4A 4CUUA 3AADA 1WEOA 2LXHC 3JVMA 3ONIA 5J0DA 4YABA 4B7YC 2R0VA 5EPBA 5A5RA 4YBTA 2LAUA 4H9DA 2JRJA 4NQNA 4Z1QA 4L58A 3GG3A 1WEEA 4UYFB 4QSRA 5A81A 2MD7B 1VYXA 5L98A 3UVWA 5L8TA 5F2PA 5IGNA 3O70A 5D1MB 5ENFA 5D3SA 1ZKRA 3IU5A 2F6JA 5HLSA 1Z60A 5AIUA 3ZPV1 2VJEA 2BAYA 5EI4A 4OGJA 4QZSA 4QSUA 5IGKA 2MA6A 4AUQB 4OGCA 1MM2A 5I83A 4C9ZA 4YYKA 4QY4A 5EPSA 5HFQA 3C5KA 5LCWB 4HBVA 4AKGA 1HYJA 2LXPC 4MR4A 2EGMA 5CQ5A 2VPEA 4WHUA 5CRMA 3FJUB 3O34A 4N4FA 4UP5A 5TCMA 2DX8A 3DDTA 5FE7A 1FBVA 5DY7A 3IU6A 5AD3A 3P1CA 4NR7A 5D3PA 5CPEA 2DVRA 2RNWA 2M1RA 4XY8A 4Z6HA 3U5LA 4UP0A 5D25A 2RI7A 3DWDA 3ERRA 2ECGA 2KGIA 3QZTA 4O76A 4GNFA 4QQ4A 4YYMA 5DW2A 5A82A 5B75A 4QSPA 5EWHA 2E6SA 1RMDA 4NRCA 2IDAA 5D0CA 1U6GB 4Q0OA 3LJWA 1WEWA 4F3IA 5HJCA 4PPEA 5CU8A 4IR3A 4QYLA 2XOCA 4MENA 5EWWA 5TDWA 4NS5A 5B79A 4Q6FA 2E3KA 4NR4A 3PUQA 4CUSA 1JM4B 2FFWA 3MULA 5ETBA 3HCSA 4OGEA 3RPGB 5F5ZA 2DVSA 5I89A 3O7AA 5HQ7A 3I3JA 5E9LA 3HMHA 5HEMA 2B0OE 4UIZA 4MR3A 4QC1A 3DQVR 5KO4A 5EK9A 2KR4A 2NXBA 2CONA 2Y1NA 3KV6A 5HRWA 3MUKA 3N9LA 5F1LA 5AMFA 5F60A 4UIUA 2YREA 4A49A 5TB6A 4XUAA 4A9IA 4NYVA 5C8GA 1WEUA 3MHHA 2EXUA 3JVJA 4TYLA 4YBSA 3GV4A 5AD2A 3O47A 4DONA 4HBWA 4YYJA 5F25A 2YVRA 5FH6A 2YELA 4YY6A 4GNGA 4PTBA 4WZ0A 1JM7B 5KTWA 2KREA 4N4HA 3E2DA 3LDYA 2MT5A 5EV9A 2QICA 3L1XA 2MD8C 5A5OA 2KWOA 4MR5A 1X4UA 4A9MA 5D3RA 5CUAA 5H1TA 5E9MA 2FSAA 5C7NA 3QZSA 4YYHA 2XOYA 4HXMA 2VPBA 3N9MA 4LKAA 3ZTGA 4J0SA 3D1DA 5DLXA 3PHDA 2G6QA 4LC2A 2VNFA 3Q1DA 5SVIB 5I1QA 4LZRA 5HM0A 3DAIA 2KWKA 5AMEA 5HCLA 2R0SA 2E61A 2LGLA 3P5OA 4NR5A 4MEQA 4Z0RA 2KFTA 3MHSA 3NG2A 3D1BA 4QEWA 2E7NA 3K2JA 5EA1A 4A9KA 2KU3A 5D1LB 4N3WA 3O37A 2F42A 4NN2A 3D7CA 4TQNA 5DYUA 2MIQA 3VKHA 2XP0A 5I86A 5LKXA 4ZDTA 4ZUXU 2ECIA 4HXLA 2G43A 4HXNA 1JM7A 4HXKA 3SOXA 2E6RA 5CP5A 5II1A 2CSVA 1Z6UA 5E9VA 4A4BA 2L75A 2H0DB 2LGKA 3L1ZB 5I80A 3SVGA 4ALHA 4E96A 4CUQA 4YH3A 4YC9A 5FG4A 2L80A 5FB0A 4CFLA 4CURA 3RPGC 2L0BA 5KH7A 2LRIC 3FKMX 5DYAA 3SVFA 5KTUA 5I88A 2YQMA 5H85A 2L5EA 4LRGA 2YW8A 2FD4A 2C2VS 4IORA 3QZVA 4YAXA 5C85A 2CRWA 4PY6A 5FE4A 5KHMA 3KNVA 5LUUA 4O64A 4O72A 4GB0A 5G04B 5K3QA 3RCWA 2L7PA 5A7CA 5FE3A 1XWHA 4FLPA 5FE0A 3LJUX 2OUOA 2JUNA 5ENIA 4YYDA 5EYAF 2H0DA 5EM3A 4NUCA 4LR6A 4CA1A 4KV4A 5EISA 4O7FA 5CUBA 4YYNA 4NUDA 2QIZA 4TT2A 3ZNIA 4R8PK 4GNEA 4TU4A 1PUOA 4WZ2A 3T6RA 3O36A 4O71A 1WGMA 4V3LC 2JM3A 5IG6A 2YHNA 4LADB 4PCIA 2YQDA 4YYIA 5B78A 2M85A 5FFWA 1EQFA 3S91A 4AKIA 5IBNA 2FUUA 4QF2A 4UYFA 5HQ6A 3SVHA 3T9KA 5A83A 4MEPA 2RFJA 2KIZA 4TZ8A 5EWVA 5JWMA 4QSVA 5D3HA 3GL6A 5I3LA 4PCEA 4TS8A 5ENBA 4QEVA 4A9LA 5COIA 4YH4A 2DSMA 2ECJA 4L7XA 4IR5A 5HRVA 4XI1A 5ENHA 5BT4A 3ZYUA 1DCQA 2EGPA 4CLBA 1ZBDB 1WUMA 5A5NA 1HYIA 5A85A 3DPLR 5E7DA 4ZW1A 1JSPB 3FANA 5DKAA 4A0CD 4UITA 5EVAA 1BORA 3N9OA 4FK5A 5I7XA 2DKWA 2JMJA 5FEYA 2P57A 4J0RA 5HRXA 1WEQA 2KWNA 2MA5A 2KKYA 5E3GA 4LJNA 4CFKA 4QEUA 3HMFA 3U5OA 4MSXA 5ENGA 4CL9A 4IR6A 2L5UA 4WA6A 5FERA 4R2YA 2G4AA 2L84A 3U5JA 4I7CA 4UIYA 1X0JA 4QB3A 4QR3A 4YADA 3ASLA 5DINA 2GRCA 1WESA 4A9HA 4QSQA 4LDFA 5DFBA 5L96A 5IIDA 3Q2EA 5IGLA 2VJFB 5D3NA 4UI9B 4HXOA 4W4UA 5D26A 2WP1A 1ZS5A 4TKPB 4O7AA 5ENEA 3UV2A 3KQIA 4IOOA 5EP7A 5II2A 4YBMA 5I7YA 2HYED 3EB5A 3KDEC 1IYMA 5D3TA 2KKXA 2D9EA 2UZGA 5DKHA 1F62A 5C87A 5SVYA 3SUBA 3G0LA 1X4JA 3NXBA 5E74A 4ALGA 5K29A 4NR9A 2I7KA 2M6MA 4FJCA 5TRBA 4LLBA 5FBXA 4O77A 4WHWA 2EJNA 2DJAA 3PURA 3EB6A 5TBNA 2VPGA 3O33A 3N9PA 1E4UA 2YT5A 4C66A 3JUEA 2H60A 3S92A 5B76A 4HBYA 5DKCA 2VPDA 5D24A 3M99A 5H1UA 4GNDA 5D7XA 4J3IA 4HXPA 3UW9A 4NR6A 2N9GA 5G05B 4AYCB 5DYXA 1WEMA 4MVTA 2XB1A 4B86C 3P1DA 2MNYA 5SVXA 3SOWA 1DVPA 2PUYA 5LKUA 2AN6A 2YYNA 3UVXA 4Y03A 5FB1A 2I50A 4S3OB 5FE8A 5IGMA 5G0FA 4MR6A 5DKDA 2YEMA 5FFYA 4XY9A 4O75A 5F63A 4QC3A 4F52B 2MUMA 4HBXA 3ZYQA 3O35A 2HDPA 2DWWA 1MBMA 4N4IA 5E3DA 3M63A 2D8UA 2KTBB 5A5QA 2CRRA 3U5MA 2M13A 4HXSA 2CKLB 2CSYA 4IC3A 3AQAA 5I40A 1F68A 4QF3A 3ZVZB 2MJVB 5DX4A 3PLWA 4X2IA 2K4DA 4BJXA 4QSSA 4UYEA 4CUTA 3UVDA 3LVQE 5SVIA 5CQTA 1WUGA 1WFKA 3UVYA 3LQJA 5C11A 5LKTA 4YK0A 5CUCA 4O7EA 5G4SA 2ECNA 5FE5A 2VJEB 4IC2A 4NR8A 3M7KA 2LV9A 2MKEA 5BT3A 4OUFA 5ETDA 5I29A 4ZC9A 1WENA 4UYDA 4KCXA 3U5NA 3ZPVE 2YDWA 3LXJA 5F3AA 3MXFA 2XEUA 5C13A 5FE6A 3LQIA 3UV5A 5E0RA 4TU6A 5LVRA 5DBMA 5EQ1A 2RNYA 2C2LA 4FO9A 5LJ0A 5ENJA 5B77A 4YYGA 3MQMA 2CKLA 3JVKA 4O78A 4UYHA 2D82A 4TT6A 5F1HA 2EODA 4A9NA 4P5OB 5JG6A 4C67A 4Z93A 4N4GA 2KYUA 2EA6A 2KGGA 1WEVA 4UYGA 4O70A 1N72A 4PS5A 4A9OA 3HTKC 3MB4A 3I2DA 1VFYA 5LJ1A 4NXJA 2RR4A 2OO1A 3IHPA 4NRBA 4QBMA 3JVLA 4XYAA 5C89A 5J3XA 5B8DA 5CS8A 5FH8A 4BHWA 2K16A 2Y43A 5CFWA 5FE9A 2ECVA 5E9KA 2L43A 1T1HA 3V43A 4LYIA 2RSDA 1Z2QA 4ZQLA 5F36A 2YSJA 2IQJA 2YUCA 4S3OC 4XUBA 4BW2A 1VD4A 5AITA 1JOCA 4AVXA 4QSXA 4AI6A 3KV5A 3FL2A 4TZ2A 4KV1A 4QR4A 1WE9A 5DFCA 1LDJB 5KH3A 4O7BA 2YHOA 2YQLA 4QSWA 1CHCA 5TDRA 4A4CA 4X3GA 4CCGX 2K1JA 4FIPA 5CUDA 2YSMA 3SOUA 2E7OA 3C6WA 4NRAA 3FAOA 4O74A 4UIXA 5DFDA 4R7EA 2OWAA 5CQ4A 5EGUA 4LYWA 5D3LA 4QSTA 3P1FA 5FG6A 2I8NA 4OGIA 4BBQA 4IR4A 2L85A 3G0JA 5CUEA 5KU3A 5HQ5A 2LQ6A 2RO1A 3DWYA 4QR5A 4IOQA 5FE2A 2WP2A 2OXQC 5E73A 3T7LA 3VK6A 4BW4A 2ZETC 3UV4A 5CQ3A 2JMIA 4NYXA 2YYRA 3HCTA 2RNXA 3M62A 3HMEA 4YATA 1N87A 3LVRE 2ECWA 4LZ2A 5DLZA 5TABA 2OSSA 5DW1A 4Z1SA 5EPRA 2KE1A 5JI8A 4QNSA 5LKZA 5H1VA 2LSPB 5HFRA 4WIVA 5HELA 3MB3A 2KWJA 4AKNA 5L99A 2QJ0A 5KTXA 5L97A 2G45A 4A9EA 3FEHA 2LN0A 4LZSA 4NUEA 4O7CA 4PKLA 5EWCA 2D8SA 5F62A 4Q0NA 5FE1A 5D3JA 5EICA 5FH7A 5FFVA 1G25A 2LGVA 4A9JA 4F1PA 5DYCA 5G4RA 3Q2FA 5CQ6A 5FDZA 2M3HA 4BW3A 3SHBA 2MNZA 3ZVYA 4QUTA 2VJFA 4TTEA 1WILA 2XOZA 5CQ8A 5A5SA 4I7BA 5C4QA 4AP4A 4I7DA 2DATA 4NYWA 3FM8C 2PNXA 1V87A 4LK9A 5CY9A 5E9YA 4Z6IA 3L11A 1WIMA 2VP7A 4MEOA 2YEKA 1MM3A 2FUIA 2JMDA 1X4IA 2Y1MA 5CZGA 5EU1A 2CSZA 5F61A 1LDKC 4RVRA 4CUPA 2DVQA 2RS9B 4QYDA 3P1EA 5ENCA 3N9QA 5H9MA 2DVVA 2LDRA 2YW5A 4HXRA 5LVQA 1FP0A 4WZ3B 4A9FA 3LRQA 3LQHA 4NQMA 2LGGA 3RTRB 5CUGA 3TLPA 3VKGA 4AYCA 1K2FA 1WEPA 5LJ2A 5CQ7A
chains in the Genus database with same CATH topology
2YURA 5D1KB 5HENA 4V3KC 2R10A 5FG5A 4YY4A 5EWDA 2CT2A 4GPJA 4UIVA 5A5PA 2ECTA 5L8UA 5ACYA 3HCUA 4QUUA 3N9NA 5CQAA 2NAAA 1E6IA 4BW1A 3U5KA 5CRZA 5CTLA 5KH9A 5BT5A 4UIWA 2K17A 2R0YA 4LYSA 4TT4A 5CGPA 4J1PA 3U5PA 5E9IA 2F6NA 2YU4A 4CUUA 3AADA 1WEOA 2LXHC 3JVMA 3ONIA 5J0DA 4YABA 4B7YC 2R0VA 5EPBA 5A5RA 4YBTA 2JRJA 4NQNA 4Z1QA 4L58A 3GG3A 1WEEA 4UYFB 4QSRA 5A81A 2MD7B 1VYXA 5L98A 3UVWA 5L8TA 5F2PA 5IGNA 3O70A 5D1MB 5ENFA 3IU5A 5D3SA 2F6JA 5HLSA 1Z60A 5AIUA 3ZPV1 2VJEA 2BAYA 5EI4A 4OGJA 4QZSA 4QSUA 5IGKA 2MA6A 4AUQB 4C9ZA 1MM2A 5I83A 4YYKA 4QY4A 5EPSA 5HFQA 3C5KA 5LCWB 4HBVA 1HYJA 2LXPC 4MR4A 5CQ5A 2VPEA 4WHUA 5CRMA 3O34A 4N4FA 4UP5A 5TCMA 2DX8A 5FE7A 1FBVA 5DY7A 3IU6A 5AD3A 3P1CA 4NR7A 5D3PA 5CPEA 2DVRA 2RNWA 2M1RA 4XY8A 4Z6HA 3U5LA 4UP0A 5D25A 2RI7A 2ECGA 2KGIA 3QZTA 4O76A 4GNFA 4YYMA 5DW2A 5A82A 5B75A 4QSPA 5EWHA 2E6SA 1RMDA 4NRCA 2IDAA 5D0CA 1U6GB 4Q0OA 3LJWA 1WEWA 4F3IA 5HJCA 4PPEA 5CU8A 4IR3A 4QYLA 4MENA 5EWWA 5TDWA 4NS5A 5B79A 4Q6FA 2E3KA 4NR4A 3PUQA 4CUSA 1JM4B 3MULA 5ETBA 3HCSA 3RPGB 5F5ZA 2DVSA 5I89A 3O7AA 5HQ7A 3I3JA 5E9LA 3HMHA 5HEMA 4UIZA 4MR3A 4QC1A 3DQVR 5KO4A 5EK9A 2KR4A 2NXBA 2Y1NA 3KV6A 5HRWA 3MUKA 3N9LA 5F1LA 5AMFA 5F60A 4UIUA 2YREA 4A49A 5TB6A 4XUAA 4A9IA 4NYVA 5C8GA 1WEUA 3MHHA 3JVJA 4TYLA 4YBSA 3GV4A 5AD2A 4DONA 4HBWA 4YYJA 5F25A 5FH6A 2YELA 4YY6A 4GNGA 4PTBA 4WZ0A 1JM7B 5KTWA 2KREA 4N4HA 2MT5A 5EV9A 2QICA 3L1XA 2MD8C 5A5OA 2KWOA 4MR5A 1X4UA 4A9MA 5D3RA 5CUAA 5H1TA 5E9MA 2FSAA 5C7NA 3QZSA 4YYHA 4HXMA 2VPBA 3N9MA 4LKAA 3ZTGA 4J0SA 5DLXA 3PHDA 2G6QA 4LC2A 2VNFA 5I1QA 4LZRA 5HM0A 3DAIA 2KWKA 5AMEA 5HCLA 2R0SA 2LGLA 3P5OA 4NR5A 4MEQA 2KFTA 3MHSA 3NG2A 4QEWA 2KU3A 2E7NA 3K2JA 5EA1A 4A9KA 5D1LB 4N3WA 3O37A 2F42A 4NN2A 3D7CA 4TQNA 5DYUA 2MIQA 4ZDTA 5I86A 5LKXA 4ZUXU 2ECIA 4HXLA 2G43A 4HXNA 1JM7A 4HXKA 3SOXA 2E6RA 5CP5A 5II1A 1Z6UA 5E9VA 4A4BA 2L75A 2H0DB 2LGKA 3L1ZB 5I80A 3SVGA 4ALHA 4E96A 4CUQA 4YH3A 4YC9A 5FG4A 2L80A 5FB0A 4CFLA 4CURA 3RPGC 2L0BA 5KH7A 2LRIC 3FKMX 5DYAA 3SVFA 5KTUA 5I88A 2YQMA 5H85A 2L5EA 4LRGA 2YW8A 2C2VS 4IORA 3QZVA 4YAXA 5C85A 4PY6A 5FE4A 5KHMA 3KNVA 5LUUA 4O64A 4O72A 4GB0A 5G04B 3RCWA 5A7CA 5FE3A 1XWHA 4FLPA 5FE0A 2OUOA 5ENIA 4YYDA 5EYAF 2H0DA 5EM3A 4NUCA 4LR6A 4CA1A 4KV4A 5EISA 4O7FA 5CUBA 4YYNA 4NUDA 2QIZA 4TT2A 3ZNIA 4R8PK 4GNEA 4TU4A 4WZ2A 3T6RA 3O36A 4O71A 1WGMA 4V3LC 5IG6A 2YHNA 4LADB 4PCIA 2YQDA 4YYIA 5B78A 2M85A 5FFWA 1EQFA 3S91A 2FUUA 5IBNA 4QF2A 4UYFA 5HQ6A 3SVHA 5A83A 4MEPA 2RFJA 2KIZA 4TZ8A 5EWVA 5JWMA 4QSVA 5D3HA 3GL6A 5I3LA 4PCEA 4TS8A 5ENBA 4QEVA 4A9LA 5COIA 4YH4A 2ECJA 4L7XA 4IR5A 5HRVA 4XI1A 5ENHA 5BT4A 3ZYUA 2EGPA 4CLBA 1ZBDB 1WUMA 5A5NA 1HYIA 5A85A 3DPLR 5E7DA 4ZW1A 1JSPB 5DKAA 4A0CD 4UITA 5EVAA 1BORA 3N9OA 4FK5A 5I7XA 2DKWA 2JMJA 5FEYA 4J0RA 5HRXA 1WEQA 2KWNA 2MA5A 4MSXA 5E3GA 4LJNA 4CFKA 4QEUA 3HMFA 3U5OA 5ENGA 4CL9A 4IR6A 2L5UA 4WA6A 5FERA 4R2YA 2G4AA 2L84A 3U5JA 4I7CA 4UIYA 1X0JA 4QB3A 4QR3A 4YADA 3ASLA 5DINA 2GRCA 1WESA 4A9HA 4QSQA 4LDFA 5DFBA 5L96A 5IIDA 3Q2EA 5IGLA 2VJFB 5D3NA 4UI9B 4HXOA 4W4UA 5D26A 2WP1A 1ZS5A 4TKPB 4O7AA 5ENEA 3UV2A 3KQIA 4IOOA 5EP7A 5II2A 4YBMA 5I7YA 2HYED 3EB5A 1IYMA 5D3TA 2D9EA 2UZGA 5DKHA 1F62A 5C87A 3G0LA 1X4JA 3NXBA 5E74A 4ALGA 5K29A 4NR9A 2I7KA 2M6MA 4FJCA 5TRBA 4LLBA 5FBXA 4O77A 4WHWA 3PURA 3EB6A 5TBNA 2VPGA 3O33A 3N9PA 1E4UA 2YT5A 4C66A 5B76A 2H60A 3S92A 4HBYA 5DKCA 2VPDA 5D24A 3M99A 5H1UA 4GNDA 5D7XA 4J3IA 4HXPA 3UW9A 4NR6A 2N9GA 5G05B 4AYCB 5DYXA 1WEMA 4MVTA 2XB1A 4B86C 3P1DA 2MNYA 3SOWA 1DVPA 2PUYA 5LKUA 2AN6A 2YYNA 3UVXA 4Y03A 5FB1A 2I50A 4S3OB 5FE8A 5IGMA 5G0FA 4MR6A 5DKDA 2YEMA 5FFYA 4XY9A 4O75A 5F63A 4QC3A 4F52B 2MUMA 4HBXA 3ZYQA 3O35A 2HDPA 2DWWA 3M63A 4N4IA 5E3DA 2KTBB 5A5QA 3U5MA 4HXSA 2CKLB 2CSYA 4IC3A 3AQAA 5I40A 1F68A 4QF3A 3ZVZB 2MJVB 5DX4A 4X2IA 2K4DA 4BJXA 4QSSA 4UYEA 4CUTA 3UVDA 5CQTA 1WUGA 1WFKA 3UVYA 3LQJA 5C11A 5LKTA 4YK0A 5CUCA 4O7EA 5G4SA 2ECNA 5FE5A 2VJEB 4IC2A 4NR8A 2LV9A 5BT3A 4OUFA 5ETDA 5I29A 4ZC9A 1WENA 4UYDA 4KCXA 3U5NA 3ZPVE 2YDWA 3LXJA 5F3AA 3MXFA 2XEUA 5C13A 5FE6A 3LQIA 3UV5A 5E0RA 4TU6A 5LVRA 5DBMA 5EQ1A 2RNYA 2C2LA 4FO9A 5LJ0A 5ENJA 5B77A 4YYGA 3MQMA 2CKLA 3JVKA 4O78A 4UYHA 2D82A 4TT6A 5F1HA 2EODA 4A9NA 4P5OB 5JG6A 4C67A 4Z93A 4N4GA 2KYUA 2EA6A 2KGGA 1WEVA 4UYGA 4O70A 1N72A 4PS5A 4A9OA 3HTKC 3MB4A 3I2DA 1VFYA 5LJ1A 4NXJA 3IHPA 2OO1A 4NRBA 4QBMA 3JVLA 4XYAA 5C89A 5J3XA 5B8DA 5CS8A 5FH8A 4BHWA 2K16A 2Y43A 5CFWA 5FE9A 2ECVA 5E9KA 2L43A 1T1HA 3V43A 4LYIA 2RSDA 1Z2QA 4ZQLA 5F36A 2YSJA 2YUCA 4S3OC 4XUBA 4BW2A 1VD4A 5AITA 1JOCA 4AVXA 4QSXA 3KV5A 3FL2A 4TZ2A 4KV1A 4QR4A 1WE9A 5DFCA 1LDJB 5KH3A 4O7BA 2YHOA 2YQLA 4QSWA 1CHCA 5TDRA 4A4CA 4X3GA 4CCGX 2K1JA 4FIPA 5CUDA 2YSMA 3SOUA 2E7OA 3C6WA 4NRAA 4R7EA 4O74A 4UIXA 5DFDA 5CQ4A 5EGUA 4LYWA 5D3LA 4QSTA 3P1FA 5FG6A 2I8NA 4OGIA 4BBQA 4IR4A 2L85A 3G0JA 5CUEA 5KU3A 5HQ5A 2LQ6A 2RO1A 3DWYA 4QR5A 4IOQA 5FE2A 2WP2A 2OXQC 5E73A 3T7LA 3VK6A 4BW4A 2ZETC 3UV4A 5CQ3A 2JMIA 4NYXA 2YYRA 3HCTA 2RNXA 3M62A 3HMEA 4YATA 1N87A 2ECWA 4LZ2A 5DLZA 5TABA 2OSSA 5DW1A 4Z1SA 5EPRA 2KE1A 5JI8A 4QNSA 5LKZA 5H1VA 2LSPB 5HFRA 4WIVA 5HELA 3MB3A 2KWJA 4AKNA 5L99A 2QJ0A 5KTXA 5L97A 2G45A 4A9EA 2LN0A 4LZSA 4NUEA 4O7CA 4PKLA 5EWCA 2D8SA 5F62A 4Q0NA 5FE1A 5D3JA 5EICA 5FH7A 5FFVA 1G25A 2LGVA 4A9JA 5DYCA 5G4RA 3Q2FA 5CQ6A 5FDZA 2M3HA 4BW3A 3SHBA 2MNZA 3ZVYA 4QUTA 2VJFA 4TTEA 1WILA 5CQ8A 5A5SA 4I7BA 5C4QA 4AP4A 4I7DA 2DATA 4NYWA 2PNXA 1V87A 4LK9A 5CY9A 5E9YA 4Z6IA 3L11A 1WIMA 2VP7A 4MEOA 2YEKA 1MM3A 2FUIA 2JMDA 1X4IA 2Y1MA 5CZGA 5EU1A 2CSZA 5F61A 1LDKC 4RVRA 4CUPA 2DVQA 2RS9B 4QYDA 3P1EA 5ENCA 3N9QA 5H9MA 2DVVA 2LDRA 2YW5A 4HXRA 5LVQA 1FP0A 4WZ3B 4A9FA 3LRQA 3LQHA 4NQMA 2LGGA 3RTRB 5CUGA 3TLPA 4AYCA 1K2FA 1WEPA 5LJ2A 5CQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUR A;  5D1K B;  5HEN A;  4V3K C;  2R10 A;  5FG5 A;  4YY4 A;  5EWD A;  2CT2 A;  4GPJ A;  4UIV A;  5A5P A;  2ECT A;  5L8U A;  5ACY A;  3HCU A;  4QUU A;  3N9N A;  5CQA A;  2NAA A;  1E6I A;  4BW1 A;  3U5K A;  5CRZ A;  5CTL A;  5KH9 A;  5BT5 A;  4UIW A;  2K17 A;  2R0Y A;  4LYS A;  4TT4 A;  5CGP A;  4J1P A;  3U5P A;  5E9I A;  2F6N A;  2YU4 A;  4CUU A;  3AAD A;  1WEO A;  2LXH C;  3JVM A;  3ONI A;  5J0D A;  4YAB A;  4B7Y C;  2R0V A;  5EPB A;  5A5R A;  4YBT A;  2JRJ A;  4NQN A;  4Z1Q A;  4L58 A;  3GG3 A;  1WEE A;  4UYF B;  4QSR A;  5A81 A;  2MD7 B;  1VYX A;  5L98 A;  3UVW A;  5L8T A;  5F2P A;  5IGN A;  3O70 A;  5D1M B;  5ENF A;  3IU5 A;  5D3S A;  2F6J A;  5HLS A;  1Z60 A;  5AIU A;  3ZPV 1;  2VJE A;  2BAY A;  5EI4 A;  4OGJ A;  4QZS A;  4QSU A;  5IGK A;  2MA6 A;  4AUQ B;  4C9Z A;  1MM2 A;  5I83 A;  4YYK A;  4QY4 A;  5EPS A;  5HFQ A;  3C5K A;  5LCW B;  4HBV A;  1HYJ A;  2LXP C;  4MR4 A;  5CQ5 A;  2VPE A;  4WHU A;  5CRM A;  3O34 A;  4N4F A;  4UP5 A;  5TCM A;  2DX8 A;  5FE7 A;  1FBV A;  5DY7 A;  3IU6 A;  5AD3 A;  3P1C A;  4NR7 A;  5D3P A;  5CPE A;  2DVR A;  2RNW A;  2M1R A;  4XY8 A;  4Z6H A;  3U5L A;  4UP0 A;  5D25 A;  2RI7 A;  2ECG A;  2KGI A;  3QZT A;  4O76 A;  4GNF A;  4YYM A;  5DW2 A;  5A82 A;  5B75 A;  4QSP A;  5EWH A;  2E6S A;  1RMD A;  4NRC A;  2IDA A;  5D0C A;  1U6G B;  4Q0O A;  3LJW A;  1WEW A;  4F3I A;  5HJC A;  4PPE A;  5CU8 A;  4IR3 A;  4QYL A;  4MEN A;  5EWW A;  5TDW A;  4NS5 A;  5B79 A;  4Q6F A;  2E3K A;  4NR4 A;  3PUQ A;  4CUS A;  1JM4 B;  3MUL A;  5ETB A;  3HCS A;  3RPG B;  5F5Z A;  2DVS A;  5I89 A;  3O7A A;  5HQ7 A;  3I3J A;  5E9L A;  3HMH A;  5HEM A;  4UIZ A;  4MR3 A;  4QC1 A;  3DQV R;  5KO4 A;  5EK9 A;  2KR4 A;  2NXB A;  2Y1N A;  3KV6 A;  5HRW A;  3MUK A;  3N9L A;  5F1L A;  5AMF A;  5F60 A;  4UIU A;  2YRE A;  4A49 A;  5TB6 A;  4XUA A;  4A9I A;  4NYV A;  5C8G A;  1WEU A;  3MHH A;  3JVJ A;  4TYL A;  4YBS A;  3GV4 A;  5AD2 A;  4DON A;  4HBW A;  4YYJ A;  5F25 A;  5FH6 A;  2YEL A;  4YY6 A;  4GNG A;  4PTB A;  4WZ0 A;  1JM7 B;  5KTW A;  2KRE A;  4N4H A;  2MT5 A;  5EV9 A;  2QIC A;  3L1X A;  2MD8 C;  5A5O A;  2KWO A;  4MR5 A;  1X4U A;  4A9M A;  5D3R A;  5CUA A;  5H1T A;  5E9M A;  2FSA A;  5C7N A;  3QZS A;  4YYH A;  4HXM A;  2VPB A;  3N9M A;  4LKA A;  3ZTG A;  4J0S A;  5DLX A;  3PHD A;  2G6Q A;  4LC2 A;  2VNF A;  5I1Q A;  4LZR A;  5HM0 A;  3DAI A;  2KWK A;  5AME A;  5HCL A;  2R0S A;  2LGL A;  3P5O A;  4NR5 A;  4MEQ A;  2KFT A;  3MHS A;  3NG2 A;  4QEW A;  2KU3 A;  2E7N A;  3K2J A;  5EA1 A;  4A9K A;  5D1L B;  4N3W A;  3O37 A;  2F42 A;  4NN2 A;  3D7C A;  4TQN A;  5DYU A;  2MIQ A;  4ZDT A;  5I86 A;  5LKX A;  4ZUX U;  2ECI A;  4HXL A;  2G43 A;  4HXN A;  1JM7 A;  4HXK A;  3SOX A;  2E6R A;  5CP5 A;  5II1 A;  1Z6U A;  5E9V A;  4A4B A;  2L75 A;  2H0D B;  2LGK A;  3L1Z B;  5I80 A;  3SVG A;  4ALH A;  4E96 A;  4CUQ A;  4YH3 A;  4YC9 A;  5FG4 A;  2L80 A;  5FB0 A;  4CFL A;  4CUR A;  3RPG C;  2L0B A;  5KH7 A;  2LRI C;  3FKM X;  5DYA A;  3SVF A;  5KTU A;  5I88 A;  2YQM A;  5H85 A;  2L5E A;  4LRG A;  2YW8 A;  2C2V S;  4IOR A;  3QZV A;  4YAX A;  5C85 A;  4PY6 A;  5FE4 A;  5KHM A;  3KNV A;  5LUU A;  4O64 A;  4O72 A;  4GB0 A;  5G04 B;  3RCW A;  5A7C A;  5FE3 A;  1XWH A;  4FLP A;  5FE0 A;  2OUO A;  5ENI A;  4YYD A;  5EYA F;  2H0D A;  5EM3 A;  4NUC A;  4LR6 A;  4CA1 A;  4KV4 A;  5EIS A;  4O7F A;  5CUB A;  4YYN A;  4NUD A;  2QIZ A;  4TT2 A;  3ZNI A;  4R8P K;  4GNE A;  4TU4 A;  4WZ2 A;  3T6R A;  3O36 A;  4O71 A;  1WGM A;  4V3L C;  5IG6 A;  2YHN A;  4LAD B;  4PCI A;  2YQD A;  4YYI A;  5B78 A;  2M85 A;  5FFW A;  1EQF A;  3S91 A;  2FUU A;  5IBN A;  4QF2 A;  4UYF A;  5HQ6 A;  3SVH A;  5A83 A;  4MEP A;  2RFJ A;  2KIZ A;  4TZ8 A;  5EWV A;  5JWM A;  4QSV A;  5D3H A;  3GL6 A;  5I3L A;  4PCE A;  4TS8 A;  5ENB A;  4QEV A;  4A9L A;  5COI A;  4YH4 A;  2ECJ A;  4L7X A;  4IR5 A;  5HRV A;  4XI1 A;  5ENH A;  5BT4 A;  3ZYU A;  2EGP A;  4CLB A;  1ZBD B;  1WUM A;  5A5N A;  1HYI A;  5A85 A;  3DPL R;  5E7D A;  4ZW1 A;  1JSP B;  5DKA A;  4A0C D;  4UIT A;  5EVA A;  1BOR A;  3N9O A;  4FK5 A;  5I7X A;  2DKW A;  2JMJ A;  5FEY A;  4J0R A;  5HRX A;  1WEQ A;  2KWN A;  2MA5 A;  4MSX A;  5E3G A;  4LJN A;  4CFK A;  4QEU A;  3HMF A;  3U5O A;  5ENG A;  4CL9 A;  4IR6 A;  2L5U A;  4WA6 A;  5FER A;  4R2Y A;  2G4A A;  2L84 A;  3U5J A;  4I7C A;  4UIY A;  1X0J A;  4QB3 A;  4QR3 A;  4YAD A;  3ASL A;  5DIN A;  2GRC A;  1WES A;  4A9H A;  4QSQ A;  4LDF A;  5DFB A;  5L96 A;  5IID A;  3Q2E A;  5IGL A;  2VJF B;  5D3N A;  4UI9 B;  4HXO A;  4W4U A;  5D26 A;  2WP1 A;  1ZS5 A;  4TKP B;  4O7A A;  5ENE A;  3UV2 A;  3KQI A;  4IOO A;  5EP7 A;  5II2 A;  4YBM A;  5I7Y A;  2HYE D;  3EB5 A;  1IYM A;  5D3T A;  2D9E A;  2UZG A;  5DKH A;  1F62 A;  5C87 A;  3G0L A;  1X4J A;  3NXB A;  5E74 A;  4ALG A;  5K29 A;  4NR9 A;  2I7K A;  2M6M A;  4FJC A;  5TRB A;  4LLB A;  5FBX A;  4O77 A;  4WHW A;  3PUR A;  3EB6 A;  5TBN A;  2VPG A;  3O33 A;  3N9P A;  1E4U A;  2YT5 A;  4C66 A;  5B76 A;  2H60 A;  3S92 A;  4HBY A;  5DKC A;  2VPD A;  5D24 A;  3M99 A;  5H1U A;  4GND A;  5D7X A;  4J3I A;  4HXP A;  3UW9 A;  4NR6 A;  2N9G A;  5G05 B;  4AYC B;  5DYX A;  1WEM A;  4MVT A;  2XB1 A;  4B86 C;  3P1D A;  2MNY A;  3SOW A;  1DVP A;  2PUY A;  5LKU A;  2AN6 A;  2YYN A;  3UVX A;  4Y03 A;  5FB1 A;  2I50 A;  4S3O B;  5FE8 A;  5IGM A;  5G0F A;  4MR6 A;  5DKD A;  2YEM A;  5FFY A;  4XY9 A;  4O75 A;  5F63 A;  4QC3 A;  4F52 B;  2MUM A;  4HBX A;  3ZYQ A;  3O35 A;  2HDP A;  2DWW A;  3M63 A;  4N4I A;  5E3D A;  2KTB B;  5A5Q A;  3U5M A;  4HXS A;  2CKL B;  2CSY A;  4IC3 A;  3AQA A;  5I40 A;  1F68 A;  4QF3 A;  3ZVZ B;  2MJV B;  5DX4 A;  4X2I A;  2K4D A;  4BJX A;  4QSS A;  4UYE A;  4CUT A;  3UVD A;  5CQT A;  1WUG A;  1WFK A;  3UVY A;  3LQJ A;  5C11 A;  5LKT A;  4YK0 A;  5CUC A;  4O7E A;  5G4S A;  2ECN A;  5FE5 A;  2VJE B;  4IC2 A;  4NR8 A;  2LV9 A;  5BT3 A;  4OUF A;  5ETD A;  5I29 A;  4ZC9 A;  1WEN A;  4UYD A;  4KCX A;  3U5N A;  3ZPV E;  2YDW A;  3LXJ A;  5F3A A;  3MXF A;  2XEU A;  5C13 A;  5FE6 A;  3LQI A;  3UV5 A;  5E0R A;  4TU6 A;  5LVR A;  5DBM A;  5EQ1 A;  2RNY A;  2C2L A;  4FO9 A;  5LJ0 A;  5ENJ A;  5B77 A;  4YYG A;  3MQM A;  2CKL A;  3JVK A;  4O78 A;  4UYH A;  2D82 A;  4TT6 A;  5F1H A;  2EOD A;  4A9N A;  4P5O B;  5JG6 A;  4C67 A;  4Z93 A;  4N4G A;  2KYU A;  2EA6 A;  2KGG A;  1WEV A;  4UYG A;  4O70 A;  1N72 A;  4PS5 A;  4A9O A;  3HTK C;  3MB4 A;  3I2D A;  1VFY A;  5LJ1 A;  4NXJ A;  3IHP A;  2OO1 A;  4NRB A;  4QBM A;  3JVL A;  4XYA A;  5C89 A;  5J3X A;  5B8D A;  5CS8 A;  5FH8 A;  4BHW A;  2K16 A;  2Y43 A;  5CFW A;  5FE9 A;  2ECV A;  5E9K A;  2L43 A;  1T1H A;  3V43 A;  4LYI A;  2RSD A;  1Z2Q A;  4ZQL A;  5F36 A;  2YSJ A;  2YUC A;  4S3O C;  4XUB A;  4BW2 A;  1VD4 A;  5AIT A;  1JOC A;  4AVX A;  4QSX A;  3KV5 A;  3FL2 A;  4TZ2 A;  4KV1 A;  4QR4 A;  1WE9 A;  5DFC A;  1LDJ B;  5KH3 A;  4O7B A;  2YHO A;  2YQL A;  4QSW A;  1CHC A;  5TDR A;  4A4C A;  4X3G A;  4CCG X;  2K1J A;  4FIP A;  5CUD A;  2YSM A;  3SOU A;  2E7O A;  3C6W A;  4NRA A;  4R7E A;  4O74 A;  4UIX A;  5DFD A;  5CQ4 A;  5EGU A;  4LYW A;  5D3L A;  4QST A;  3P1F A;  5FG6 A;  2I8N A;  4OGI A;  4BBQ A;  4IR4 A;  2L85 A;  3G0J A;  5CUE A;  5KU3 A;  5HQ5 A;  2LQ6 A;  2RO1 A;  3DWY A;  4QR5 A;  4IOQ A;  5FE2 A;  2WP2 A;  2OXQ C;  5E73 A;  3T7L A;  3VK6 A;  4BW4 A;  2ZET C;  3UV4 A;  5CQ3 A;  2JMI A;  4NYX A;  2YYR A;  3HCT A;  2RNX A;  3M62 A;  3HME A;  4YAT A;  1N87 A;  2ECW A;  4LZ2 A;  5DLZ A;  5TAB A;  2OSS A;  5DW1 A;  4Z1S A;  5EPR A;  2KE1 A;  5JI8 A;  4QNS A;  5LKZ A;  5H1V A;  2LSP B;  5HFR A;  4WIV A;  5HEL A;  3MB3 A;  2KWJ A;  4AKN A;  5L99 A;  2QJ0 A;  5KTX A;  5L97 A;  2G45 A;  4A9E A;  2LN0 A;  4LZS A;  4NUE A;  4O7C A;  4PKL A;  5EWC A;  2D8S A;  5F62 A;  4Q0N A;  5FE1 A;  5D3J A;  5EIC A;  5FH7 A;  5FFV A;  1G25 A;  2LGV A;  4A9J A;  5DYC A;  5G4R A;  3Q2F A;  5CQ6 A;  5FDZ A;  2M3H A;  4BW3 A;  3SHB A;  2MNZ A;  3ZVY A;  4QUT A;  2VJF A;  4TTE A;  1WIL A;  5CQ8 A;  5A5S A;  4I7B A;  5C4Q A;  4AP4 A;  4I7D A;  2DAT A;  4NYW A;  2PNX A;  1V87 A;  4LK9 A;  5CY9 A;  5E9Y A;  4Z6I A;  3L11 A;  1WIM A;  2VP7 A;  4MEO A;  2YEK A;  1MM3 A;  2FUI A;  2JMD A;  1X4I A;  2Y1M A;  5CZG A;  5EU1 A;  2CSZ A;  5F61 A;  1LDK C;  4RVR A;  4CUP A;  2DVQ A;  2RS9 B;  4QYD A;  3P1E A;  5ENC A;  3N9Q A;  5H9M A;  2DVV A;  2LDR A;  2YW5 A;  4HXR A;  5LVQ A;  1FP0 A;  4WZ3 B;  4A9F A;  3LRQ A;  3LQH A;  4NQM A;  2LGG A;  3RTR B;  5CUG A;  3TLP A;  4AYC A;  1K2F A;  1WEP A;  5LJ2 A;  5CQ7 A; 
#chains in the Genus database with same CATH topology
 2YUR A;  5D1K B;  5HEN A;  4V3K C;  2R10 A;  5FG5 A;  4YY4 A;  5EWD A;  4AKH A;  2CT2 A;  4Z0O A;  4GPJ A;  4UIV A;  3H7H A;  5A5P A;  2ECT A;  5L8U A;  5ACY A;  3HCU A;  4QUU A;  3N9N A;  5CQA A;  4O62 A;  2NAA A;  1E6I A;  4BW1 A;  3U5K A;  5CRZ A;  5CTL A;  5KH9 A;  5BT5 A;  4UIW A;  2K17 A;  2R0Y A;  4LYS A;  4TT4 A;  5CGP A;  3MDB C;  4J1P A;  3U5P A;  5E9I A;  2F6N A;  2YU4 A;  4CUU A;  3AAD A;  1WEO A;  2LXH C;  3JVM A;  3ONI A;  5J0D A;  4YAB A;  4B7Y C;  2R0V A;  5EPB A;  5A5R A;  4YBT A;  2LAU A;  4H9D A;  2JRJ A;  4NQN A;  4Z1Q A;  4L58 A;  3GG3 A;  1WEE A;  4UYF B;  4QSR A;  5A81 A;  2MD7 B;  1VYX A;  5L98 A;  3UVW A;  5L8T A;  5F2P A;  5IGN A;  3O70 A;  5D1M B;  5ENF A;  5D3S A;  1ZKR A;  3IU5 A;  2F6J A;  5HLS A;  1Z60 A;  5AIU A;  3ZPV 1;  2VJE A;  2BAY A;  5EI4 A;  4OGJ A;  4QZS A;  4QSU A;  5IGK A;  2MA6 A;  4AUQ B;  4OGC A;  1MM2 A;  5I83 A;  4C9Z A;  4YYK A;  4QY4 A;  5EPS A;  5HFQ A;  3C5K A;  5LCW B;  4HBV A;  4AKG A;  1HYJ A;  2LXP C;  4MR4 A;  2EGM A;  5CQ5 A;  2VPE A;  4WHU A;  5CRM A;  3FJU B;  3O34 A;  4N4F A;  4UP5 A;  5TCM A;  2DX8 A;  3DDT A;  5FE7 A;  1FBV A;  5DY7 A;  3IU6 A;  5AD3 A;  3P1C A;  4NR7 A;  5D3P A;  5CPE A;  2DVR A;  2RNW A;  2M1R A;  4XY8 A;  4Z6H A;  3U5L A;  4UP0 A;  5D25 A;  2RI7 A;  3DWD A;  3ERR A;  2ECG A;  2KGI A;  3QZT A;  4O76 A;  4GNF A;  4QQ4 A;  4YYM A;  5DW2 A;  5A82 A;  5B75 A;  4QSP A;  5EWH A;  2E6S A;  1RMD A;  4NRC A;  2IDA A;  5D0C A;  1U6G B;  4Q0O A;  3LJW A;  1WEW A;  4F3I A;  5HJC A;  4PPE A;  5CU8 A;  4IR3 A;  4QYL A;  2XOC A;  4MEN A;  5EWW A;  5TDW A;  4NS5 A;  5B79 A;  4Q6F A;  2E3K A;  4NR4 A;  3PUQ A;  4CUS A;  1JM4 B;  2FFW A;  3MUL A;  5ETB A;  3HCS A;  4OGE A;  3RPG B;  5F5Z A;  2DVS A;  5I89 A;  3O7A A;  5HQ7 A;  3I3J A;  5E9L A;  3HMH A;  5HEM A;  2B0O E;  4UIZ A;  4MR3 A;  4QC1 A;  3DQV R;  5KO4 A;  5EK9 A;  2KR4 A;  2NXB A;  2CON A;  2Y1N A;  3KV6 A;  5HRW A;  3MUK A;  3N9L A;  5F1L A;  5AMF A;  5F60 A;  4UIU A;  2YRE A;  4A49 A;  5TB6 A;  4XUA A;  4A9I A;  4NYV A;  5C8G A;  1WEU A;  3MHH A;  2EXU A;  3JVJ A;  4TYL A;  4YBS A;  3GV4 A;  5AD2 A;  3O47 A;  4DON A;  4HBW A;  4YYJ A;  5F25 A;  2YVR A;  5FH6 A;  2YEL A;  4YY6 A;  4GNG A;  4PTB A;  4WZ0 A;  1JM7 B;  5KTW A;  2KRE A;  4N4H A;  3E2D A;  3LDY A;  2MT5 A;  5EV9 A;  2QIC A;  3L1X A;  2MD8 C;  5A5O A;  2KWO A;  4MR5 A;  1X4U A;  4A9M A;  5D3R A;  5CUA A;  5H1T A;  5E9M A;  2FSA A;  5C7N A;  3QZS A;  4YYH A;  2XOY A;  4HXM A;  2VPB A;  3N9M A;  4LKA A;  3ZTG A;  4J0S A;  3D1D A;  5DLX A;  3PHD A;  2G6Q A;  4LC2 A;  2VNF A;  3Q1D A;  5SVI B;  5I1Q A;  4LZR A;  5HM0 A;  3DAI A;  2KWK A;  5AME A;  5HCL A;  2R0S A;  2E61 A;  2LGL A;  3P5O A;  4NR5 A;  4MEQ A;  4Z0R A;  2KFT A;  3MHS A;  3NG2 A;  3D1B A;  4QEW A;  2E7N A;  3K2J A;  5EA1 A;  4A9K A;  2KU3 A;  5D1L B;  4N3W A;  3O37 A;  2F42 A;  4NN2 A;  3D7C A;  4TQN A;  5DYU A;  2MIQ A;  3VKH A;  2XP0 A;  5I86 A;  5LKX A;  4ZDT A;  4ZUX U;  2ECI A;  4HXL A;  2G43 A;  4HXN A;  1JM7 A;  4HXK A;  3SOX A;  2E6R A;  5CP5 A;  5II1 A;  2CSV A;  1Z6U A;  5E9V A;  4A4B A;  2L75 A;  2H0D B;  2LGK A;  3L1Z B;  5I80 A;  3SVG A;  4ALH A;  4E96 A;  4CUQ A;  4YH3 A;  4YC9 A;  5FG4 A;  2L80 A;  5FB0 A;  4CFL A;  4CUR A;  3RPG C;  2L0B A;  5KH7 A;  2LRI C;  3FKM X;  5DYA A;  3SVF A;  5KTU A;  5I88 A;  2YQM A;  5H85 A;  2L5E A;  4LRG A;  2YW8 A;  2FD4 A;  2C2V S;  4IOR A;  3QZV A;  4YAX A;  5C85 A;  2CRW A;  4PY6 A;  5FE4 A;  5KHM A;  3KNV A;  5LUU A;  4O64 A;  4O72 A;  4GB0 A;  5G04 B;  5K3Q A;  3RCW A;  2L7P A;  5A7C A;  5FE3 A;  1XWH A;  4FLP A;  5FE0 A;  3LJU X;  2OUO A;  2JUN A;  5ENI A;  4YYD A;  5EYA F;  2H0D A;  5EM3 A;  4NUC A;  4LR6 A;  4CA1 A;  4KV4 A;  5EIS A;  4O7F A;  5CUB A;  4YYN A;  4NUD A;  2QIZ A;  4TT2 A;  3ZNI A;  4R8P K;  4GNE A;  4TU4 A;  1PUO A;  4WZ2 A;  3T6R A;  3O36 A;  4O71 A;  1WGM A;  4V3L C;  2JM3 A;  5IG6 A;  2YHN A;  4LAD B;  4PCI A;  2YQD A;  4YYI A;  5B78 A;  2M85 A;  5FFW A;  1EQF A;  3S91 A;  4AKI A;  5IBN A;  2FUU A;  4QF2 A;  4UYF A;  5HQ6 A;  3SVH A;  3T9K A;  5A83 A;  4MEP A;  2RFJ A;  2KIZ A;  4TZ8 A;  5EWV A;  5JWM A;  4QSV A;  5D3H A;  3GL6 A;  5I3L A;  4PCE A;  4TS8 A;  5ENB A;  4QEV A;  4A9L A;  5COI A;  4YH4 A;  2DSM A;  2ECJ A;  4L7X A;  4IR5 A;  5HRV A;  4XI1 A;  5ENH A;  5BT4 A;  3ZYU A;  1DCQ A;  2EGP A;  4CLB A;  1ZBD B;  1WUM A;  5A5N A;  1HYI A;  5A85 A;  3DPL R;  5E7D A;  4ZW1 A;  1JSP B;  3FAN A;  5DKA A;  4A0C D;  4UIT A;  5EVA A;  1BOR A;  3N9O A;  4FK5 A;  5I7X A;  2DKW A;  2JMJ A;  5FEY A;  2P57 A;  4J0R A;  5HRX A;  1WEQ A;  2KWN A;  2MA5 A;  2KKY A;  5E3G A;  4LJN A;  4CFK A;  4QEU A;  3HMF A;  3U5O A;  4MSX A;  5ENG A;  4CL9 A;  4IR6 A;  2L5U A;  4WA6 A;  5FER A;  4R2Y A;  2G4A A;  2L84 A;  3U5J A;  4I7C A;  4UIY A;  1X0J A;  4QB3 A;  4QR3 A;  4YAD A;  3ASL A;  5DIN A;  2GRC A;  1WES A;  4A9H A;  4QSQ A;  4LDF A;  5DFB A;  5L96 A;  5IID A;  3Q2E A;  5IGL A;  2VJF B;  5D3N A;  4UI9 B;  4HXO A;  4W4U A;  5D26 A;  2WP1 A;  1ZS5 A;  4TKP B;  4O7A A;  5ENE A;  3UV2 A;  3KQI A;  4IOO A;  5EP7 A;  5II2 A;  4YBM A;  5I7Y A;  2HYE D;  3EB5 A;  3KDE C;  1IYM A;  5D3T A;  2KKX A;  2D9E A;  2UZG A;  5DKH A;  1F62 A;  5C87 A;  5SVY A;  3SUB A;  3G0L A;  1X4J A;  3NXB A;  5E74 A;  4ALG A;  5K29 A;  4NR9 A;  2I7K A;  2M6M A;  4FJC A;  5TRB A;  4LLB A;  5FBX A;  4O77 A;  4WHW A;  2EJN A;  2DJA A;  3PUR A;  3EB6 A;  5TBN A;  2VPG A;  3O33 A;  3N9P A;  1E4U A;  2YT5 A;  4C66 A;  3JUE A;  2H60 A;  3S92 A;  5B76 A;  4HBY A;  5DKC A;  2VPD A;  5D24 A;  3M99 A;  5H1U A;  4GND A;  5D7X A;  4J3I A;  4HXP A;  3UW9 A;  4NR6 A;  2N9G A;  5G05 B;  4AYC B;  5DYX A;  1WEM A;  4MVT A;  2XB1 A;  4B86 C;  3P1D A;  2MNY A;  5SVX A;  3SOW A;  1DVP A;  2PUY A;  5LKU A;  2AN6 A;  2YYN A;  3UVX A;  4Y03 A;  5FB1 A;  2I50 A;  4S3O B;  5FE8 A;  5IGM A;  5G0F A;  4MR6 A;  5DKD A;  2YEM A;  5FFY A;  4XY9 A;  4O75 A;  5F63 A;  4QC3 A;  4F52 B;  2MUM A;  4HBX A;  3ZYQ A;  3O35 A;  2HDP A;  2DWW A;  1MBM A;  4N4I A;  5E3D A;  3M63 A;  2D8U A;  2KTB B;  5A5Q A;  2CRR A;  3U5M A;  2M13 A;  4HXS A;  2CKL B;  2CSY A;  4IC3 A;  3AQA A;  5I40 A;  1F68 A;  4QF3 A;  3ZVZ B;  2MJV B;  5DX4 A;  3PLW A;  4X2I A;  2K4D A;  4BJX A;  4QSS A;  4UYE A;  4CUT A;  3UVD A;  3LVQ E;  5SVI A;  5CQT A;  1WUG A;  1WFK A;  3UVY A;  3LQJ A;  5C11 A;  5LKT A;  4YK0 A;  5CUC A;  4O7E A;  5G4S A;  2ECN A;  5FE5 A;  2VJE B;  4IC2 A;  4NR8 A;  3M7K A;  2LV9 A;  2MKE A;  5BT3 A;  4OUF A;  5ETD A;  5I29 A;  4ZC9 A;  1WEN A;  4UYD A;  4KCX A;  3U5N A;  3ZPV E;  2YDW A;  3LXJ A;  5F3A A;  3MXF A;  2XEU A;  5C13 A;  5FE6 A;  3LQI A;  3UV5 A;  5E0R A;  4TU6 A;  5LVR A;  5DBM A;  5EQ1 A;  2RNY A;  2C2L A;  4FO9 A;  5LJ0 A;  5ENJ A;  5B77 A;  4YYG A;  3MQM A;  2CKL A;  3JVK A;  4O78 A;  4UYH A;  2D82 A;  4TT6 A;  5F1H A;  2EOD A;  4A9N A;  4P5O B;  5JG6 A;  4C67 A;  4Z93 A;  4N4G A;  2KYU A;  2EA6 A;  2KGG A;  1WEV A;  4UYG A;  4O70 A;  1N72 A;  4PS5 A;  4A9O A;  3HTK C;  3MB4 A;  3I2D A;  1VFY A;  5LJ1 A;  4NXJ A;  2RR4 A;  2OO1 A;  3IHP A;  4NRB A;  4QBM A;  3JVL A;  4XYA A;  5C89 A;  5J3X A;  5B8D A;  5CS8 A;  5FH8 A;  4BHW A;  2K16 A;  2Y43 A;  5CFW A;  5FE9 A;  2ECV A;  5E9K A;  2L43 A;  1T1H A;  3V43 A;  4LYI A;  2RSD A;  1Z2Q A;  4ZQL A;  5F36 A;  2YSJ A;  2IQJ A;  2YUC A;  4S3O C;  4XUB A;  4BW2 A;  1VD4 A;  5AIT A;  1JOC A;  4AVX A;  4QSX A;  4AI6 A;  3KV5 A;  3FL2 A;  4TZ2 A;  4KV1 A;  4QR4 A;  1WE9 A;  5DFC A;  1LDJ B;  5KH3 A;  4O7B A;  2YHO A;  2YQL A;  4QSW A;  1CHC A;  5TDR A;  4A4C A;  4X3G A;  4CCG X;  2K1J A;  4FIP A;  5CUD A;  2YSM A;  3SOU A;  2E7O A;  3C6W A;  4NRA A;  3FAO A;  4O74 A;  4UIX A;  5DFD A;  4R7E A;  2OWA A;  5CQ4 A;  5EGU A;  4LYW A;  5D3L A;  4QST A;  3P1F A;  5FG6 A;  2I8N A;  4OGI A;  4BBQ A;  4IR4 A;  2L85 A;  3G0J A;  5CUE A;  5KU3 A;  5HQ5 A;  2LQ6 A;  2RO1 A;  3DWY A;  4QR5 A;  4IOQ A;  5FE2 A;  2WP2 A;  2OXQ C;  5E73 A;  3T7L A;  3VK6 A;  4BW4 A;  2ZET C;  3UV4 A;  5CQ3 A;  2JMI A;  4NYX A;  2YYR A;  3HCT A;  2RNX A;  3M62 A;  3HME A;  4YAT A;  1N87 A;  3LVR E;  2ECW A;  4LZ2 A;  5DLZ A;  5TAB A;  2OSS A;  5DW1 A;  4Z1S A;  5EPR A;  2KE1 A;  5JI8 A;  4QNS A;  5LKZ A;  5H1V A;  2LSP B;  5HFR A;  4WIV A;  5HEL A;  3MB3 A;  2KWJ A;  4AKN A;  5L99 A;  2QJ0 A;  5KTX A;  5L97 A;  2G45 A;  4A9E A;  3FEH A;  2LN0 A;  4LZS A;  4NUE A;  4O7C A;  4PKL A;  5EWC A;  2D8S A;  5F62 A;  4Q0N A;  5FE1 A;  5D3J A;  5EIC A;  5FH7 A;  5FFV A;  1G25 A;  2LGV A;  4A9J A;  4F1P A;  5DYC A;  5G4R A;  3Q2F A;  5CQ6 A;  5FDZ A;  2M3H A;  4BW3 A;  3SHB A;  2MNZ A;  3ZVY A;  4QUT A;  2VJF A;  4TTE A;  1WIL A;  2XOZ A;  5CQ8 A;  5A5S A;  4I7B A;  5C4Q A;  4AP4 A;  4I7D A;  2DAT A;  4NYW A;  3FM8 C;  2PNX A;  1V87 A;  4LK9 A;  5CY9 A;  5E9Y A;  4Z6I A;  3L11 A;  1WIM A;  2VP7 A;  4MEO A;  2YEK A;  1MM3 A;  2FUI A;  2JMD A;  1X4I A;  2Y1M A;  5CZG A;  5EU1 A;  2CSZ A;  5F61 A;  1LDK C;  4RVR A;  4CUP A;  2DVQ A;  2RS9 B;  4QYD A;  3P1E A;  5ENC A;  3N9Q A;  5H9M A;  2DVV A;  2LDR A;  2YW5 A;  4HXR A;  5LVQ A;  1FP0 A;  4WZ3 B;  4A9F A;  3LRQ A;  3LQH A;  4NQM A;  2LGG A;  3RTR B;  5CUG A;  3TLP A;  3VKG A;  4AYC A;  1K2F A;  1WEP A;  5LJ2 A;  5CQ7 A; 
#chains in the Genus database with same CATH homology
 2YUR A;  5D1K B;  5HEN A;  4V3K C;  2R10 A;  5FG5 A;  4YY4 A;  5EWD A;  2CT2 A;  4GPJ A;  4UIV A;  5A5P A;  2ECT A;  5L8U A;  5ACY A;  3HCU A;  4QUU A;  3N9N A;  5CQA A;  2NAA A;  1E6I A;  4BW1 A;  3U5K A;  5CRZ A;  5CTL A;  5KH9 A;  5BT5 A;  4UIW A;  2K17 A;  2R0Y A;  4LYS A;  4TT4 A;  5CGP A;  4J1P A;  3U5P A;  5E9I A;  2F6N A;  2YU4 A;  4CUU A;  3AAD A;  1WEO A;  2LXH C;  3JVM A;  3ONI A;  5J0D A;  4YAB A;  4B7Y C;  2R0V A;  5EPB A;  5A5R A;  4YBT A;  2JRJ A;  4NQN A;  4Z1Q A;  4L58 A;  3GG3 A;  1WEE A;  4UYF B;  4QSR A;  5A81 A;  2MD7 B;  1VYX A;  5L98 A;  3UVW A;  5L8T A;  5F2P A;  5IGN A;  3O70 A;  5D1M B;  5ENF A;  3IU5 A;  5D3S A;  2F6J A;  5HLS A;  1Z60 A;  5AIU A;  3ZPV 1;  2VJE A;  2BAY A;  5EI4 A;  4OGJ A;  4QZS A;  4QSU A;  5IGK A;  2MA6 A;  4AUQ B;  4C9Z A;  1MM2 A;  5I83 A;  4YYK A;  4QY4 A;  5EPS A;  5HFQ A;  3C5K A;  5LCW B;  4HBV A;  1HYJ A;  2LXP C;  4MR4 A;  5CQ5 A;  2VPE A;  4WHU A;  5CRM A;  3O34 A;  4N4F A;  4UP5 A;  5TCM A;  2DX8 A;  5FE7 A;  1FBV A;  5DY7 A;  3IU6 A;  5AD3 A;  3P1C A;  4NR7 A;  5D3P A;  5CPE A;  2DVR A;  2RNW A;  2M1R A;  4XY8 A;  4Z6H A;  3U5L A;  4UP0 A;  5D25 A;  2RI7 A;  2ECG A;  2KGI A;  3QZT A;  4O76 A;  4GNF A;  4YYM A;  5DW2 A;  5A82 A;  5B75 A;  4QSP A;  5EWH A;  2E6S A;  1RMD A;  4NRC A;  2IDA A;  5D0C A;  1U6G B;  4Q0O A;  3LJW A;  1WEW A;  4F3I A;  5HJC A;  4PPE A;  5CU8 A;  4IR3 A;  4QYL A;  4MEN A;  5EWW A;  5TDW A;  4NS5 A;  5B79 A;  4Q6F A;  2E3K A;  4NR4 A;  3PUQ A;  4CUS A;  1JM4 B;  3MUL A;  5ETB A;  3HCS A;  3RPG B;  5F5Z A;  2DVS A;  5I89 A;  3O7A A;  5HQ7 A;  3I3J A;  5E9L A;  3HMH A;  5HEM A;  4UIZ A;  4MR3 A;  4QC1 A;  3DQV R;  5KO4 A;  5EK9 A;  2KR4 A;  2NXB A;  2Y1N A;  3KV6 A;  5HRW A;  3MUK A;  3N9L A;  5F1L A;  5AMF A;  5F60 A;  4UIU A;  2YRE A;  4A49 A;  5TB6 A;  4XUA A;  4A9I A;  4NYV A;  5C8G A;  1WEU A;  3MHH A;  3JVJ A;  4TYL A;  4YBS A;  3GV4 A;  5AD2 A;  4DON A;  4HBW A;  4YYJ A;  5F25 A;  5FH6 A;  2YEL A;  4YY6 A;  4GNG A;  4PTB A;  4WZ0 A;  1JM7 B;  5KTW A;  2KRE A;  4N4H A;  2MT5 A;  5EV9 A;  2QIC A;  3L1X A;  2MD8 C;  5A5O A;  2KWO A;  4MR5 A;  1X4U A;  4A9M A;  5D3R A;  5CUA A;  5H1T A;  5E9M A;  2FSA A;  5C7N A;  3QZS A;  4YYH A;  4HXM A;  2VPB A;  3N9M A;  4LKA A;  3ZTG A;  4J0S A;  5DLX A;  3PHD A;  2G6Q A;  4LC2 A;  2VNF A;  5I1Q A;  4LZR A;  5HM0 A;  3DAI A;  2KWK A;  5AME A;  5HCL A;  2R0S A;  2LGL A;  3P5O A;  4NR5 A;  4MEQ A;  2KFT A;  3MHS A;  3NG2 A;  4QEW A;  2KU3 A;  2E7N A;  3K2J A;  5EA1 A;  4A9K A;  5D1L B;  4N3W A;  3O37 A;  2F42 A;  4NN2 A;  3D7C A;  4TQN A;  5DYU A;  2MIQ A;  4ZDT A;  5I86 A;  5LKX A;  4ZUX U;  2ECI A;  4HXL A;  2G43 A;  4HXN A;  1JM7 A;  4HXK A;  3SOX A;  2E6R A;  5CP5 A;  5II1 A;  1Z6U A;  5E9V A;  4A4B A;  2L75 A;  2H0D B;  2LGK A;  3L1Z B;  5I80 A;  3SVG A;  4ALH A;  4E96 A;  4CUQ A;  4YH3 A;  4YC9 A;  5FG4 A;  2L80 A;  5FB0 A;  4CFL A;  4CUR A;  3RPG C;  2L0B A;  5KH7 A;  2LRI C;  3FKM X;  5DYA A;  3SVF A;  5KTU A;  5I88 A;  2YQM A;  5H85 A;  2L5E A;  4LRG A;  2YW8 A;  2C2V S;  4IOR A;  3QZV A;  4YAX A;  5C85 A;  4PY6 A;  5FE4 A;  5KHM A;  3KNV A;  5LUU A;  4O64 A;  4O72 A;  4GB0 A;  5G04 B;  3RCW A;  5A7C A;  5FE3 A;  1XWH A;  4FLP A;  5FE0 A;  2OUO A;  5ENI A;  4YYD A;  5EYA F;  2H0D A;  5EM3 A;  4NUC A;  4LR6 A;  4CA1 A;  4KV4 A;  5EIS A;  4O7F A;  5CUB A;  4YYN A;  4NUD A;  2QIZ A;  4TT2 A;  3ZNI A;  4R8P K;  4GNE A;  4TU4 A;  4WZ2 A;  3T6R A;  3O36 A;  4O71 A;  1WGM A;  4V3L C;  5IG6 A;  2YHN A;  4LAD B;  4PCI A;  2YQD A;  4YYI A;  5B78 A;  2M85 A;  5FFW A;  1EQF A;  3S91 A;  2FUU A;  5IBN A;  4QF2 A;  4UYF A;  5HQ6 A;  3SVH A;  5A83 A;  4MEP A;  2RFJ A;  2KIZ A;  4TZ8 A;  5EWV A;  5JWM A;  4QSV A;  5D3H A;  3GL6 A;  5I3L A;  4PCE A;  4TS8 A;  5ENB A;  4QEV A;  4A9L A;  5COI A;  4YH4 A;  2ECJ A;  4L7X A;  4IR5 A;  5HRV A;  4XI1 A;  5ENH A;  5BT4 A;  3ZYU A;  2EGP A;  4CLB A;  1ZBD B;  1WUM A;  5A5N A;  1HYI A;  5A85 A;  3DPL R;  5E7D A;  4ZW1 A;  1JSP B;  5DKA A;  4A0C D;  4UIT A;  5EVA A;  1BOR A;  3N9O A;  4FK5 A;  5I7X A;  2DKW A;  2JMJ A;  5FEY A;  4J0R A;  5HRX A;  1WEQ A;  2KWN A;  2MA5 A;  4MSX A;  5E3G A;  4LJN A;  4CFK A;  4QEU A;  3HMF A;  3U5O A;  5ENG A;  4CL9 A;  4IR6 A;  2L5U A;  4WA6 A;  5FER A;  4R2Y A;  2G4A A;  2L84 A;  3U5J A;  4I7C A;  4UIY A;  1X0J A;  4QB3 A;  4QR3 A;  4YAD A;  3ASL A;  5DIN A;  2GRC A;  1WES A;  4A9H A;  4QSQ A;  4LDF A;  5DFB A;  5L96 A;  5IID A;  3Q2E A;  5IGL A;  2VJF B;  5D3N A;  4UI9 B;  4HXO A;  4W4U A;  5D26 A;  2WP1 A;  1ZS5 A;  4TKP B;  4O7A A;  5ENE A;  3UV2 A;  3KQI A;  4IOO A;  5EP7 A;  5II2 A;  4YBM A;  5I7Y A;  2HYE D;  3EB5 A;  1IYM A;  5D3T A;  2D9E A;  2UZG A;  5DKH A;  1F62 A;  5C87 A;  3G0L A;  1X4J A;  3NXB A;  5E74 A;  4ALG A;  5K29 A;  4NR9 A;  2I7K A;  2M6M A;  4FJC A;  5TRB A;  4LLB A;  5FBX A;  4O77 A;  4WHW A;  3PUR A;  3EB6 A;  5TBN A;  2VPG A;  3O33 A;  3N9P A;  1E4U A;  2YT5 A;  4C66 A;  5B76 A;  2H60 A;  3S92 A;  4HBY A;  5DKC A;  2VPD A;  5D24 A;  3M99 A;  5H1U A;  4GND A;  5D7X A;  4J3I A;  4HXP A;  3UW9 A;  4NR6 A;  2N9G A;  5G05 B;  4AYC B;  5DYX A;  1WEM A;  4MVT A;  2XB1 A;  4B86 C;  3P1D A;  2MNY A;  3SOW A;  1DVP A;  2PUY A;  5LKU A;  2AN6 A;  2YYN A;  3UVX A;  4Y03 A;  5FB1 A;  2I50 A;  4S3O B;  5FE8 A;  5IGM A;  5G0F A;  4MR6 A;  5DKD A;  2YEM A;  5FFY A;  4XY9 A;  4O75 A;  5F63 A;  4QC3 A;  4F52 B;  2MUM A;  4HBX A;  3ZYQ A;  3O35 A;  2HDP A;  2DWW A;  3M63 A;  4N4I A;  5E3D A;  2KTB B;  5A5Q A;  3U5M A;  4HXS A;  2CKL B;  2CSY A;  4IC3 A;  3AQA A;  5I40 A;  1F68 A;  4QF3 A;  3ZVZ B;  2MJV B;  5DX4 A;  4X2I A;  2K4D A;  4BJX A;  4QSS A;  4UYE A;  4CUT A;  3UVD A;  5CQT A;  1WUG A;  1WFK A;  3UVY A;  3LQJ A;  5C11 A;  5LKT A;  4YK0 A;  5CUC A;  4O7E A;  5G4S A;  2ECN A;  5FE5 A;  2VJE B;  4IC2 A;  4NR8 A;  2LV9 A;  5BT3 A;  4OUF A;  5ETD A;  5I29 A;  4ZC9 A;  1WEN A;  4UYD A;  4KCX A;  3U5N A;  3ZPV E;  2YDW A;  3LXJ A;  5F3A A;  3MXF A;  2XEU A;  5C13 A;  5FE6 A;  3LQI A;  3UV5 A;  5E0R A;  4TU6 A;  5LVR A;  5DBM A;  5EQ1 A;  2RNY A;  2C2L A;  4FO9 A;  5LJ0 A;  5ENJ A;  5B77 A;  4YYG A;  3MQM A;  2CKL A;  3JVK A;  4O78 A;  4UYH A;  2D82 A;  4TT6 A;  5F1H A;  2EOD A;  4A9N A;  4P5O B;  5JG6 A;  4C67 A;  4Z93 A;  4N4G A;  2KYU A;  2EA6 A;  2KGG A;  1WEV A;  4UYG A;  4O70 A;  1N72 A;  4PS5 A;  4A9O A;  3HTK C;  3MB4 A;  3I2D A;  1VFY A;  5LJ1 A;  4NXJ A;  3IHP A;  2OO1 A;  4NRB A;  4QBM A;  3JVL A;  4XYA A;  5C89 A;  5J3X A;  5B8D A;  5CS8 A;  5FH8 A;  4BHW A;  2K16 A;  2Y43 A;  5CFW A;  5FE9 A;  2ECV A;  5E9K A;  2L43 A;  1T1H A;  3V43 A;  4LYI A;  2RSD A;  1Z2Q A;  4ZQL A;  5F36 A;  2YSJ A;  2YUC A;  4S3O C;  4XUB A;  4BW2 A;  1VD4 A;  5AIT A;  1JOC A;  4AVX A;  4QSX A;  3KV5 A;  3FL2 A;  4TZ2 A;  4KV1 A;  4QR4 A;  1WE9 A;  5DFC A;  1LDJ B;  5KH3 A;  4O7B A;  2YHO A;  2YQL A;  4QSW A;  1CHC A;  5TDR A;  4A4C A;  4X3G A;  4CCG X;  2K1J A;  4FIP A;  5CUD A;  2YSM A;  3SOU A;  2E7O A;  3C6W A;  4NRA A;  4R7E A;  4O74 A;  4UIX A;  5DFD A;  5CQ4 A;  5EGU A;  4LYW A;  5D3L A;  4QST A;  3P1F A;  5FG6 A;  2I8N A;  4OGI A;  4BBQ A;  4IR4 A;  2L85 A;  3G0J A;  5CUE A;  5KU3 A;  5HQ5 A;  2LQ6 A;  2RO1 A;  3DWY A;  4QR5 A;  4IOQ A;  5FE2 A;  2WP2 A;  2OXQ C;  5E73 A;  3T7L A;  3VK6 A;  4BW4 A;  2ZET C;  3UV4 A;  5CQ3 A;  2JMI A;  4NYX A;  2YYR A;  3HCT A;  2RNX A;  3M62 A;  3HME A;  4YAT A;  1N87 A;  2ECW A;  4LZ2 A;  5DLZ A;  5TAB A;  2OSS A;  5DW1 A;  4Z1S A;  5EPR A;  2KE1 A;  5JI8 A;  4QNS A;  5LKZ A;  5H1V A;  2LSP B;  5HFR A;  4WIV A;  5HEL A;  3MB3 A;  2KWJ A;  4AKN A;  5L99 A;  2QJ0 A;  5KTX A;  5L97 A;  2G45 A;  4A9E A;  2LN0 A;  4LZS A;  4NUE A;  4O7C A;  4PKL A;  5EWC A;  2D8S A;  5F62 A;  4Q0N A;  5FE1 A;  5D3J A;  5EIC A;  5FH7 A;  5FFV A;  1G25 A;  2LGV A;  4A9J A;  5DYC A;  5G4R A;  3Q2F A;  5CQ6 A;  5FDZ A;  2M3H A;  4BW3 A;  3SHB A;  2MNZ A;  3ZVY A;  4QUT A;  2VJF A;  4TTE A;  1WIL A;  5CQ8 A;  5A5S A;  4I7B A;  5C4Q A;  4AP4 A;  4I7D A;  2DAT A;  4NYW A;  2PNX A;  1V87 A;  4LK9 A;  5CY9 A;  5E9Y A;  4Z6I A;  3L11 A;  1WIM A;  2VP7 A;  4MEO A;  2YEK A;  1MM3 A;  2FUI A;  2JMD A;  1X4I A;  2Y1M A;  5CZG A;  5EU1 A;  2CSZ A;  5F61 A;  1LDK C;  4RVR A;  4CUP A;  2DVQ A;  2RS9 B;  4QYD A;  3P1E A;  5ENC A;  3N9Q A;  5H9M A;  2DVV A;  2LDR A;  2YW5 A;  4HXR A;  5LVQ A;  1FP0 A;  4WZ3 B;  4A9F A;  3LRQ A;  3LQH A;  4NQM A;  2LGG A;  3RTR B;  5CUG A;  3TLP A;  4AYC A;  1K2F A;  1WEP A;  5LJ2 A;  5CQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...