3O35A

Crystal structure of trim24 phd-bromo complexed with h3(23-31)k27ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
178
Chain Sequence
b'PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 53
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o35A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o35A01
1WUMA 5CGPA 3NG2A 1CHCA 2YREA 5DYCA 3GG3A 5A81A 2LDRA 3RPGB 5FE5A 5LVRA 2LRIC 4QUUA 2QJ0A 2VPGA 4V3KC 4C66A 4NR5A 2DATA 2FUUA 4NYVA 5CP5A 2LGVA 4YAXA 5L99A 4QYDA 5F60A 5LVQA 2F42A 4YH4A 3MULA 2RS9B 3LXJA 5FH6A 2ECWA 2RNWA 5ENIA 2RFJA 1Z60A 3U5PA 4CUSA 3GV4A 4W4UA 3UV4A 2VNFA 2F6NA 3SVHA 5FE9A 3HCSA 4UIXA 3MHHA 5DFBA 3RPGC 3ZVZB 2KWKA 5C87A 4UYEA 3DPLR 4L7XA 3NXBA 2N9GA 4NUCA 4E96A 5DBMA 4QF3A 5FERA 5KU3A 4I7DA 4A0CD 4Q0NA 5KH9A 4MR5A 3AQAA 2PNXA 5L97A 2LXHC 4I7CA 5IIDA 4LYWA 4LRGA 5I3LA 2RI7A 3LQHA 4YYDA 1ZS5A 1WEQA 2QIZA 5K29A 2ECGA 5FB0A 4UYHA 5BT5A 4BW1A 4WZ0A 2VJFB 2MUMA 4GNEA 1E4UA 4NQNA 4QSVA 4LR6A 5EWWA 5HEMA 4IC2A 5FBXA 3D7CA 2G45A 4AKNA 2MJVB 4UI9B 5D3SA 2LV9A 5EM3A 2DWWA 2ZETC 5CQ6A 4B7YC 4Z6IA 5G4SA 5FE8A 4NR7A 4O64A 5HQ6A 4A9LA 4YY6A 1RMDA 1N87A 4CUTA 2YQLA 2YHNA 5CUGA 4IR4A 4IORA 4TT4A 1JOCA 3IU6A 5A5RA 2K1JA 2YQMA 3QZTA 3FKMX 4O7BA 4YH3A 2KR4A 5AITA 4UP5A 3LRQA 4NRBA 5CQ7A 5COIA 5F63A 2G6QA 5EU1A 3PUQA 4WZ2A 4HXLA 4O7FA 2EA6A 2QICA 5EICA 5HCLA 4BW2A 2IDAA 1MM3A 5CQ4A 2L5UA 4O78A 5EISA 5E73A 5DW1A 4QEUA 5CY9A 2R0YA 2LN0A 2NAAA 5F2PA 2Y43A 5ENJA 2EGPA 1G25A 4A9KA 4CUQA 1JM4B 4YBTA 5ENFA 5C8GA 2CSZA 3MHSA 4A4BA 5D7XA 1WIMA 2YSJA 3MXFA 3SHBA 3U5MA 5CU8A 2E6RA 3QZVA 2M85A 4QB3A 3PHDA 5KTXA 4A9EA 4PPEA 2D9EA 4NR4A 2C2VS 4OUFA 4YYKA 3G0JA 3L1XA 2YSMA 4ZC9A 1WESA 4XUBA 5CQ5A 5CUDA 4QF2A 1Z2QA 5FG4A 5BT4A 4L58A 4TZ8A 4AYCB 2DVSA 1FP0A 4BHWA 5B76A 5HFRA 2L75A 5FE7A 2C2LA 4LLBA 5F3AA 2MNYA 5F61A 2VP7A 5A5SA 2JRJA 5DYXA 4KV1A 4ALGA 4IR5A 2CT2A 5E9YA 4N4HA 3ZVYA 4IR3A 2DVVA 4UIUA 2KFTA 1WILA 2LXPC 3HMHA 3L1ZB 2WP1A 4KCXA 4BW3A 1VD4A 3PURA 5J3XA 3G0LA 5CUEA 5FG5A 5AD2A 4PTBA 3LQJA 5FEYA 2YW8A 4Z1SA 4NS5A 5HQ5A 3SVFA 4WIVA 1F68A 2JMJA 4QR5A 5L96A 4YBMA 3VK6A 4HBYA 1WENA 4TU4A 2G43A 2L43A 4GNFA 5D1LB 5TCMA 5DINA 5DY7A 4QEWA 4CL9A 2JMDA 5L8UA 2L84A 1EQFA 3L11A 1WEWA 3GL6A 5G05B 3JVKA 3KQIA 4GNGA 5LKXA 3DWYA 4HXOA 5DW2A 4B86C 4A9IA 5E9IA 3O7AA 3N9PA 2DVQA 4C9ZA 4CCGX 4MENA 2ECTA 5E7DA 1X0JA 5AIUA 5KH3A 3ZPVE 2RNYA 5ACYA 5F1LA 4RVRA 5AMEA 4LZSA 3T7LA 5IGNA 3ZTGA 5C11A 2KYUA 4O75A 2K4DA 1LDJB 3UVXA 1VFYA 4MVTA 4LC2A 3MB4A 1V87A 2YURA 1MM2A 4MEOA 4X2IA 5F1HA 5A85A 4P5OB 2DVRA 4TQNA 4NRCA 2KWOA 4Z93A 2E7NA 4UYDA 5A7CA 2YUCA 3T6RA 4MEPA 5CQ3A 4O74A 2KREA 5LKTA 4A9FA 4LK9A 4Z6HA 5AD3A 3N9LA 1X4IA 2YHOA 3ZYQA 3SVGA 4CFLA 4QSWA 4XY8A 5I83A 2MD8C 2KU3A 4YYJA 3I3JA 5CQTA 1FBVA 3IHPA 4QR3A 3RTRB 3ZPV1 5B78A 5TDRA 2YQDA 4TKPB 5DKAA 5E9VA 4IOQA 4QSPA 5LKUA 3ONIA 4QSSA 2Y1NA 4A4CA 2VJEA 4UIYA 2FSAA 3TLPA 3EB5A 4QSUA 4QR4A 3I2DA 2YW5A 4NRAA 4GNDA 4LJNA 3MB3A 2NXBA 4YYGA 5CRZA 2YU4A 1N72A 5I7YA 3P1EA 2KGGA 1Z6UA 3HCUA 4O70A 5HRWA 2KE1A 5HENA 5A5PA 4J1PA 4NUEA 4MSXA 2ECNA 1HYIA 3K2JA 5I88A 5EPBA 5CZGA 2OUOA 4PS5A 2H0DB 5IG6A 3P5OA 3O36A 4QY4A 1JSPB 1WEPA 2PUYA 3M63A 4HXSA 4TYLA 2LGLA 1T1HA 5FH8A 2DKWA 2BAYA 5I1QA 5A83A 5EWHA 5H1VA 4HXKA 2LGKA 4OGIA 4IC3A 3MQMA 5EWVA 4YATA 4LDFA 4TTEA 5D3HA 4PCEA 4WHUA 1WUGA 1HYJA 1X4JA 2YT5A 2YELA 4Q6FA 5ETBA 4UYGA 4HBVA 4A9NA 4FIPA 5B79A 5EWCA 2L5EA 1WEMA 4HBWA 3ZYUA 5HRXA 2FUIA 3O33A 2GRCA 5H85A 4PKLA 2LQ6A 4AUQB 5I80A 4F52B 4IOOA 5CUCA 4NR9A 3RCWA 5CQ8A 3Q2EA 2MNZA 4N4FA 4YBSA 4QSQA 4UITA 5A82A 2EODA 2RSDA 5DLXA 2KWJA 2KGIA 5FE2A 5FDZA 5EQ1A 5FE4A 3U5JA 3AADA 5LJ1A 3KV5A 5FG6A 2MA5A 3JVJA 4O76A 4PCIA 5FFYA 4O77A 4NUDA 2YEKA 5D1MB 4YYHA 5FE3A 2R0VA 5HELA 5G04B 5DKDA 5CQAA 1X4UA 5FE0A 1K2FA 4HXNA 4DONA 4O71A 4YYIA 5IGKA 4A9HA 5KTUA 5H9MA 3UVYA 5EK9A 3HMEA 5I7XA 5HFQA 4YADA 3UVDA 2DX8A 5E9KA 5DKCA 5KO4A 4V3LC 5EA1A 4LZ2A 3HCTA 5E3DA 2CSYA 5CUAA 4XI1A 4LZRA 5D26A 3P1DA 5C7NA 2XEUA 4LKAA 5LCWB 3S92A 4A9OA 4C67A 5I89A 3S91A 2VJFA 4XUAA 5B77A 4NN2A 4CUUA 2OSSA 5F25A 4YABA 5HLSA 5IGMA 4MR3A 4Q0OA 5TB6A 5EV9A 4TU6A 4UIZA 5KTWA 5C89A 4HXPA 2R0SA 5D3PA 4ALHA 4R7EA 4ZW1A 5L98A 4TT2A 5JI8A 4KV4A 4YYMA 4UIWA 5I40A 2R10A 5TDWA 4UP0A 4TS8A 4QC1A 4O7AA 4QSRA 4QBMA 4A49A 3JVMA 5EGUA 4O72A 3P1CA 4QYLA 4YY4A 1E6IA 2I7KA 2H0DA 1WEOA 3JVLA 4ZUXU 4AP4A 2RO1A 5HJCA 3C6WA 4XY9A 5B8DA 4YC9A 3HTKC 3HMFA 5CRMA 4MR4A 4HXMA 5E74A 4QZSA 2CKLB 2HDPA 2YYRA 2ECVA 4TZ2A 4LYSA 4HXRA 4XYAA 3LQIA 3KV6A 2OXQC 2VPEA 5JG6A 5E9MA 5HQ7A 4UYFB 2M6MA 2VPBA 4ZDTA 5EI4A 5DLZA 4R2YA 4GPJA 4QNSA 4NQMA 4IR6A 5DKHA 5E9LA 5D25A 5DYUA 4O7EA 5C13A 1IYMA 3U5KA 4I7BA 4YYNA 1JM7B 5D3NA 4QC3A 2JMIA 4AYCA 5EP7A 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 5CUBA 5EVAA 2HYED 4CLBA 5LJ2A 2E6SA 2YDWA 3U5NA 4QUTA 5KH7A 4NR6A 5H1TA 1DVPA 5DYAA 5A5QA 4R8PK 4ZQLA 2OO1A 2VPDA 2YYNA 4NR8A 5DX4A 5D0CA 5C85A 2M3HA 4FLPA 5G4RA 5FB1A 5ENEA 3LJWA 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 5CTLA 5HRVA 1WE9A 4FO9A 5E3GA 5A5OA 3N9OA 4FK5A 5KHMA 5CS8A 2KWNA 1WEVA 2RNXA 2L85A 4J0SA 3UV5A 1LDKC 2UZGA 5II1A 4CUPA 5EPSA 3SOXA 4CFKA 2G4AA 5CFWA 2ECJA 5ENGA 3QZSA 1WEUA 5D24A 4CURA 2MIQA 4MEQA 5EYAF 4NYXA 4OGJA 4WZ3B 5FFWA 4Y03A 5F62A 5A5NA 4MR6A 4BJXA 4LADB 3M99A 5L8TA 5EWDA 5JWMA 5DFDA 4A9JA 5FH7A 5II2A 2L80A 4FJCA 3P1FA 4N4GA 5D3TA 4TT6A 4N4IA 4J0RA 1U6GB 3FL2A 5LJ0A 4QSXA 1F62A 4YK0A 1VYXA 2VJEB 3N9QA 3DQVR 3DAIA 5ENBA 5H1UA 5FFVA 1WFKA 5B75A 3UV2A 3O34A 5AMFA 5E0RA 3O35A 4WHWA 5FE1A 3UVWA 3UW9A 5D3RA 3O70A 4GB0A 5D3LA 4Z1QA 1WEEA 2M1RA 2ECIA 3C5KA 5ETDA 5C4QA 5I86A 5LUUA 2D82A 4S3OB 3U5OA 4QSTA 5D3JA 2I50A 5D1KB 4QEVA 3ZNIA 5G0FA 5F36A 5TRBA 5IBNA 2D8SA 5CPEA 3MUKA 5I29A 2K17A 2LGGA 3KNVA 4WA6A 5TABA 3IU5A 2L0BA 2CKLA 2YEMA 2E3KA 5J0DA 4N3WA 2XB1A 5IGLA 5BT3A 4NXJA 2Y1MA 4PY6A 3N9MA 5ENHA 4BW4A 4O7CA 5F5ZA 4UYFA 2KIZA 5HM0A 3Q2FA 4F3IA 2H60A 4S3OC 2WP2A 2I8NA 3U5LA 4A9MA 1XWHA 5ENCA 1JM7A 1ZBDB 1WGMA 3M62A 4J3IA 5LKZA 2MA6A 2KTBB 3N9NA 5DFCA 4X3GA 2LSPB 5FE6A 4HBXA 3EB6A 4LYIA 3SOWA 5EPRA 4NYWA 4UIVA 2E7OA 1BORA 2AN6A
chains in the Genus database with same CATH superfamily
1WUMA 5CGPA 3NG2A 1CHCA 2YREA 5DYCA 3GG3A 5A81A 2E61A 2LDRA 5FE5A 3RPGB 5LVRA 2LRIC 4QUUA 2QJ0A 2VPGA 4V3KC 3MDBC 4C66A 4NR5A 2DATA 2FUUA 4NYVA 5CP5A 2LGVA 4YAXA 5L99A 4QYDA 5F60A 5LVQA 2F42A 4YH4A 3MULA 2RS9B 3LXJA 5FH6A 2ECWA 2RNWA 5ENIA 2RFJA 3VKHA 1Z60A 3U5PA 4CUSA 2MKEA 3GV4A 4W4UA 3UV4A 2VNFA 2F6NA 3SVHA 5FE9A 3HCSA 3KDEC 4UIXA 3MHHA 5DFBA 3RPGC 3ZVZB 2KWKA 5C87A 4UYEA 3DPLR 4L7XA 3NXBA 2N9GA 4NUCA 4E96A 5DBMA 4QF3A 5FERA 5KU3A 4I7DA 4A0CD 4Q0NA 5KH9A 4MR5A 3T9KA 3AQAA 2PNXA 5L97A 2LXHC 4I7CA 5IIDA 4LYWA 4LRGA 5I3LA 2RI7A 3LQHA 4YYDA 1ZS5A 1WEQA 2QIZA 5K29A 2ECGA 5FB0A 4UYHA 5BT5A 4BW1A 4OGEA 4WZ0A 2VJFB 2MUMA 4GNEA 1E4UA 4NQNA 4QSVA 4LR6A 5EWWA 5HEMA 4IC2A 5FBXA 3D7CA 2G45A 4AKNA 2MJVB 4UI9B 5D3SA 2LV9A 5EM3A 2DWWA 2ZETC 5CQ6A 4B7YC 4Z6IA 5G4SA 5FE8A 4NR7A 3FEHA 4O64A 5HQ6A 4A9LA 4YY6A 1RMDA 1N87A 4CUTA 2YQLA 2YHNA 5CUGA 4IR4A 4IORA 4TT4A 1JOCA 3IU6A 5A5RA 2K1JA 2YQMA 3QZTA 3FKMX 4O7BA 4YH3A 2KR4A 3E2DA 5AITA 4UP5A 3LRQA 4NRBA 5CQ7A 5COIA 5F63A 2G6QA 5EU1A 3PUQA 4WZ2A 2OWAA 4HXLA 4O7FA 2EA6A 2QICA 2JM3A 5EICA 5HCLA 4BW2A 2IDAA 1MM3A 5CQ4A 2L5UA 4O78A 4F1PA 5EISA 5E73A 5DW1A 4QEUA 5CY9A 2R0YA 2LN0A 2NAAA 5F2PA 2CSVA 2Y43A 5ENJA 2EGPA 1G25A 4A9KA 4CUQA 1JM4B 4YBTA 5ENFA 5C8GA 2CSZA 3MHSA 4A4BA 2D8UA 5D7XA 1WIMA 2YSJA 3MXFA 3SHBA 3U5MA 5CU8A 2E6RA 3QZVA 2M85A 4QB3A 3PHDA 5KTXA 4A9EA 4PPEA 2D9EA 4NR4A 2C2VS 4OUFA 4YYKA 3G0JA 3L1XA 2YSMA 4ZC9A 3D1BA 1WESA 4XUBA 5CQ5A 5CUDA 2FFWA 4QF2A 1Z2QA 5FG4A 5BT4A 4L58A 4TZ8A 4AYCB 2DVSA 1FP0A 4BHWA 5B76A 5HFRA 2L75A 5FE7A 2C2LA 4LLBA 5F3AA 2MNYA 5F61A 2VP7A 5A5SA 2JRJA 5DYXA 4KV1A 4ALGA 4IR5A 2CT2A 5E9YA 4N4HA 3ZVYA 4IR3A 2DVVA 3LDYA 4UIUA 2KFTA 1WILA 2LXPC 3HMHA 3L1ZB 2WP1A 4KCXA 4BW3A 1VD4A 3PURA 5J3XA 3G0LA 5CUEA 5FG5A 5AD2A 4PTBA 3LQJA 5FEYA 2YW8A 4Z1SA 4NS5A 5HQ5A 3SVFA 4WIVA 1F68A 2JMJA 4QR5A 5L96A 4YBMA 3VK6A 4HBYA 1WENA 4TU4A 2G43A 2L43A 4GNFA 5D1LB 2YVRA 5TCMA 5DINA 5DY7A 4QEWA 4CL9A 2JMDA 5L8UA 2L7PA 3FANA 2L84A 1EQFA 3L11A 1WEWA 3GL6A 5G05B 3JVKA 3KQIA 4GNGA 5LKXA 3DWYA 4HXOA 5DW2A 2P57A 4B86C 4A9IA 5E9IA 3O7AA 3N9PA 2DVQA 4C9ZA 3DWDA 4CCGX 4MENA 2ECTA 5E7DA 1X0JA 5AIUA 5KH3A 3ZPVE 2RNYA 5ACYA 5F1LA 4RVRA 5AMEA 4LZSA 3T7LA 5IGNA 3ZTGA 5C11A 2KYUA 4O75A 2KKXA 2K4DA 1LDJB 3UVXA 1VFYA 4MVTA 4LC2A 3MB4A 1V87A 2YURA 1MM2A 4MEOA 4X2IA 5F1HA 5A85A 4AKGA 2DVRA 4P5OB 4TQNA 4NRCA 2KWOA 4Z93A 2E7NA 4UYDA 5A7CA 2YUCA 5SVIB 3T6RA 4MEPA 5CQ3A 4O74A 2KREA 5LKTA 4A9FA 4LK9A 4Z6HA 5AD3A 3N9LA 1X4IA 2YHOA 3ZYQA 3SVGA 4CFLA 4QSWA 4XY8A 5I83A 2MD8C 2KU3A 4YYJA 3I3JA 5CQTA 1FBVA 3IHPA 4QR3A 3RTRB 3ZPV1 5B78A 5TDRA 2YQDA 4TKPB 5DKAA 5E9VA 4IOQA 2XP0A 4AKIA 4QSPA 5LKUA 3LVQE 3ONIA 4QSSA 2Y1NA 4A4CA 2VJEA 4UIYA 2FSAA 3TLPA 3EB5A 2CRRA 4QSUA 4QR4A 3I2DA 2YW5A 4NRAA 4GNDA 4LJNA 3MB3A 2NXBA 4YYGA 5CRZA 2YU4A 1N72A 5I7YA 3P1EA 2KGGA 1Z6UA 3HCUA 4O70A 2XOYA 5HRWA 2KE1A 5HENA 5A5PA 4J1PA 4NUEA 4MSXA 2ECNA 1HYIA 3K2JA 5I88A 5EPBA 5CZGA 2OUOA 4PS5A 2H0DB 5IG6A 3P5OA 3O36A 4QY4A 1JSPB 1WEPA 2PUYA 3M63A 4HXSA 4TYLA 2LGLA 1T1HA 5FH8A 2DKWA 2BAYA 5I1QA 5A83A 5EWHA 5H1VA 4HXKA 2LGKA 4OGIA 3M7KA 4IC3A 3MQMA 5EWVA 4YATA 4LDFA 4TTEA 5D3HA 4PCEA 4AI6A 4WHUA 1WUGA 5SVXA 1HYJA 1X4JA 2YT5A 2YELA 4Q6FA 5ETBA 4UYGA 4HBVA 4A9NA 4FIPA 5B79A 5EWCA 2L5EA 4OGCA 1WEMA 4HBWA 3ZYUA 5HRXA 3DDTA 2FUIA 3O33A 2GRCA 5H85A 4PKLA 2LQ6A 4AUQB 5I80A 4F52B 3FAOA 4IOOA 5CUCA 4NR9A 3RCWA 5CQ8A 3Q2EA 2MNZA 4QQ4A 2LAUA 4N4FA 4YBSA 4QSQA 4UITA 5A82A 2EODA 2RSDA 2CONA 5DLXA 2KWJA 2KGIA 5FE2A 5FDZA 5EQ1A 2JUNA 5FE4A 3U5JA 3AADA 5LJ1A 3KV5A 5FG6A 2MA5A 3JVJA 4O76A 4PCIA 5FFYA 4O77A 4NUDA 2YEKA 5D1MB 4YYHA 5FE3A 4O62A 2R0VA 5HELA 5G04B 5DKDA 5SVIA 5CQAA 1X4UA 5FE0A 1K2FA 4HXNA 4DONA 4O71A 4YYIA 5IGKA 3SUBA 4A9HA 5KTUA 5H9MA 3UVYA 5EK9A 3HMEA 5I7XA 5HFQA 4YADA 3UVDA 2DX8A 5E9KA 5DKCA 5KO4A 4V3LC 5EA1A 4LZ2A 3HCTA 5E3DA 2CSYA 5CUAA 4XI1A 4LZRA 5D26A 3P1DA 5C7NA 2XEUA 4LKAA 5LCWB 3S92A 2CRWA 4A9OA 4C67A 5I89A 3S91A 2VJFA 4XUAA 5B77A 2XOZA 3LVRE 4NN2A 3D1DA 4CUUA 2OSSA 5F25A 4YABA 5HLSA 5IGMA 4MR3A 4Q0OA 5TB6A 2EJNA 5EV9A 1MBMA 3FM8C 4TU6A 4UIZA 5KTWA 5C89A 4HXPA 2R0SA 5D3PA 4ALHA 1ZKRA 4ZW1A 5L98A 4R7EA 4TT2A 5JI8A 4KV4A 3FJUB 3O47A 4YYMA 4UIWA 5I40A 2R10A 5TDWA 4UP0A 4TS8A 5K3QA 4QC1A 4O7AA 4QSRA 4QBMA 4A49A 3JVMA 5EGUA 4O72A 2B0OE 3P1CA 4QYLA 4YY4A 1E6IA 2I7KA 2EXUA 2H0DA 1WEOA 2KKYA 3JVLA 4ZUXU 4AP4A 2RO1A 5HJCA 3C6WA 4XY9A 5B8DA 4YC9A 3HTKC 3HMFA 5CRMA 4MR4A 4HXMA 4H9DA 5E74A 4QZSA 2CKLB 2HDPA 2YYRA 2ECVA 4TZ2A 4LYSA 4HXRA 4XYAA 3LQIA 3KV6A 2OXQC 2VPEA 5JG6A 5E9MA 5HQ7A 4UYFB 2M6MA 2VPBA 4ZDTA 5EI4A 5DLZA 4R2YA 4GPJA 4QNSA 4NQMA 4IR6A 5DKHA 5E9LA 5D25A 5DYUA 4O7EA 5C13A 1IYMA 3U5KA 2XOCA 4I7BA 4YYNA 1JM7B 5D3NA 4QC3A 2JMIA 4AYCA 5EP7A 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 5CUBA 5EVAA 2HYED 4CLBA 5LJ2A 2E6SA 2YDWA 3U5NA 4QUTA 5KH7A 4NR6A 5H1TA 1DVPA 5DYAA 5A5QA 4R8PK 4ZQLA 2OO1A 2VPDA 2YYNA 4NR8A 5DX4A 5D0CA 5C85A 2M3HA 1PUOA 4FLPA 5G4RA 5FB1A 4AKHA 2DJAA 2RR4A 5ENEA 3LJWA 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 5CTLA 5HRVA 3ERRA 1WE9A 5E3GA 5A5OA 4FO9A 3N9OA 4FK5A 3H7HA 5KHMA 5CS8A 2KWNA 1WEVA 1DCQA 2RNXA 2L85A 4J0SA 3UV5A 1LDKC 2UZGA 5II1A 4CUPA 5EPSA 3SOXA 4CFKA 2G4AA 5CFWA 2ECJA 5ENGA 3QZSA 1WEUA 5D24A 4CURA 2MIQA 4MEQA 2FD4A 5EYAF 4NYXA 4OGJA 4WZ3B 5FFWA 4Y03A 5F62A 5A5NA 4Z0OA 4MR6A 4BJXA 4LADB 3M99A 5L8TA 5EWDA 5JWMA 3Q1DA 5DFDA 4A9JA 5FH7A 5II2A 2L80A 4FJCA 3P1FA 4N4GA 5D3TA 4TT6A 4N4IA 4J0RA 5SVYA 1U6GB 3FL2A 5LJ0A 4QSXA 1F62A 4YK0A 1VYXA 2VJEB 3N9QA 3DQVR 3DAIA 5ENBA 5H1UA 5FFVA 1WFKA 5B75A 3UV2A 3O34A 5AMFA 5E0RA 3O35A 4WHWA 5FE1A 3UVWA 3UW9A 5D3RA 3VKGA 3O70A 4GB0A 5D3LA 4Z1QA 1WEEA 2M1RA 2ECIA 3C5KA 5ETDA 5C4QA 5I86A 5LUUA 2D82A 4Z0RA 4S3OB 3U5OA 4QSTA 5D3JA 2I50A 5D1KB 4QEVA 3ZNIA 5G0FA 3JUEA 5F36A 5TRBA 5IBNA 2D8SA 5CPEA 3MUKA 5I29A 2K17A 2LGGA 3KNVA 4WA6A 5TABA 3IU5A 2L0BA 2CKLA 2YEMA 2E3KA 5J0DA 4N3WA 2XB1A 5IGLA 5BT3A 4NXJA 2Y1MA 4PY6A 3N9MA 5ENHA 4BW4A 4O7CA 5F5ZA 4UYFA 2KIZA 5HM0A 2DSMA 3Q2FA 4F3IA 2H60A 3LJUX 4S3OC 3PLWA 2WP2A 2I8NA 3U5LA 4A9MA 1XWHA 5ENCA 2EGMA 1JM7A 1ZBDB 1WGMA 3M62A 4J3IA 5LKZA 2MA6A 2KTBB 3N9NA 5DFCA 2IQJA 2LSPB 5FE6A 4HBXA 3EB6A 4LYIA 4X3GA 3SOWA 5EPRA 2M13A 4NYWA 4UIVA 2E7OA 1BORA 2AN6A
chains in the Genus database with same CATH topology
1WUMA 5CGPA 3NG2A 1CHCA 2YREA 5DYCA 3GG3A 5A81A 2LDRA 3RPGB 5FE5A 5LVRA 2LRIC 4QUUA 2QJ0A 2VPGA 4V3KC 4C66A 4NR5A 2DATA 2FUUA 4NYVA 5CP5A 2LGVA 4YAXA 5L99A 4QYDA 5F60A 5LVQA 2F42A 4YH4A 3MULA 2RS9B 3LXJA 5FH6A 2ECWA 2RNWA 5ENIA 2RFJA 1Z60A 3U5PA 4CUSA 3GV4A 4W4UA 3UV4A 2VNFA 2F6NA 3SVHA 5FE9A 3HCSA 4UIXA 3MHHA 5DFBA 3RPGC 3ZVZB 2KWKA 5C87A 4UYEA 3DPLR 4L7XA 3NXBA 2N9GA 4NUCA 4E96A 5DBMA 4QF3A 5FERA 5KU3A 4I7DA 4A0CD 4Q0NA 5KH9A 4MR5A 3AQAA 2PNXA 5L97A 2LXHC 4I7CA 5IIDA 4LYWA 4LRGA 5I3LA 2RI7A 3LQHA 4YYDA 1ZS5A 1WEQA 2QIZA 5K29A 2ECGA 5FB0A 4UYHA 5BT5A 4BW1A 4WZ0A 2VJFB 2MUMA 4GNEA 1E4UA 4NQNA 4QSVA 4LR6A 5EWWA 5HEMA 4IC2A 5FBXA 3D7CA 2G45A 4AKNA 2MJVB 4UI9B 5D3SA 2LV9A 5EM3A 2DWWA 2ZETC 5CQ6A 4B7YC 4Z6IA 5G4SA 5FE8A 4NR7A 4O64A 5HQ6A 4A9LA 4YY6A 1RMDA 1N87A 4CUTA 2YQLA 2YHNA 5CUGA 4IR4A 4IORA 4TT4A 1JOCA 3IU6A 5A5RA 2K1JA 2YQMA 3QZTA 3FKMX 4O7BA 4YH3A 2KR4A 5AITA 4UP5A 3LRQA 4NRBA 5CQ7A 5COIA 5F63A 2G6QA 5EU1A 3PUQA 4WZ2A 4HXLA 4O7FA 2EA6A 2QICA 5EICA 5HCLA 4BW2A 2IDAA 1MM3A 5CQ4A 2L5UA 4O78A 5EISA 5E73A 5DW1A 4QEUA 5CY9A 2R0YA 2LN0A 2NAAA 5F2PA 2Y43A 5ENJA 2EGPA 1G25A 4A9KA 4CUQA 1JM4B 4YBTA 5ENFA 5C8GA 2CSZA 3MHSA 4A4BA 5D7XA 1WIMA 2YSJA 3MXFA 3SHBA 3U5MA 5CU8A 2E6RA 3QZVA 2M85A 4QB3A 3PHDA 5KTXA 4A9EA 4PPEA 2D9EA 4NR4A 2C2VS 4OUFA 4YYKA 3G0JA 3L1XA 2YSMA 4ZC9A 1WESA 4XUBA 5CQ5A 5CUDA 4QF2A 1Z2QA 5FG4A 5BT4A 4L58A 4TZ8A 4AYCB 2DVSA 1FP0A 4BHWA 5B76A 5HFRA 2L75A 5FE7A 2C2LA 4LLBA 5F3AA 2MNYA 5F61A 2VP7A 5A5SA 2JRJA 5DYXA 4KV1A 4ALGA 4IR5A 2CT2A 5E9YA 4N4HA 3ZVYA 4IR3A 2DVVA 4UIUA 2KFTA 1WILA 2LXPC 3HMHA 3L1ZB 2WP1A 4KCXA 4BW3A 1VD4A 3PURA 5J3XA 3G0LA 5CUEA 5FG5A 5AD2A 4PTBA 3LQJA 5FEYA 2YW8A 4Z1SA 4NS5A 5HQ5A 3SVFA 4WIVA 1F68A 2JMJA 4QR5A 5L96A 4YBMA 3VK6A 4HBYA 1WENA 4TU4A 2G43A 2L43A 4GNFA 5D1LB 5TCMA 5DINA 5DY7A 4QEWA 4CL9A 2JMDA 5L8UA 2L84A 1EQFA 3L11A 1WEWA 3GL6A 5G05B 3JVKA 3KQIA 4GNGA 5LKXA 3DWYA 4HXOA 5DW2A 4B86C 4A9IA 5E9IA 3O7AA 3N9PA 2DVQA 4C9ZA 4CCGX 4MENA 2ECTA 5E7DA 1X0JA 5AIUA 5KH3A 3ZPVE 2RNYA 5ACYA 5F1LA 4RVRA 5AMEA 4LZSA 3T7LA 5IGNA 3ZTGA 5C11A 2KYUA 4O75A 2K4DA 1LDJB 3UVXA 1VFYA 4MVTA 4LC2A 3MB4A 1V87A 2YURA 1MM2A 4MEOA 4X2IA 5F1HA 5A85A 4P5OB 2DVRA 4TQNA 4NRCA 2KWOA 4Z93A 2E7NA 4UYDA 5A7CA 2YUCA 3T6RA 4MEPA 5CQ3A 4O74A 2KREA 5LKTA 4A9FA 4LK9A 4Z6HA 5AD3A 3N9LA 1X4IA 2YHOA 3ZYQA 3SVGA 4CFLA 4QSWA 4XY8A 5I83A 2MD8C 2KU3A 4YYJA 3I3JA 5CQTA 1FBVA 3IHPA 4QR3A 3RTRB 3ZPV1 5B78A 5TDRA 2YQDA 4TKPB 5DKAA 5E9VA 4IOQA 4QSPA 5LKUA 3ONIA 4QSSA 2Y1NA 4A4CA 2VJEA 4UIYA 2FSAA 3TLPA 3EB5A 4QSUA 4QR4A 3I2DA 2YW5A 4NRAA 4GNDA 4LJNA 3MB3A 2NXBA 4YYGA 5CRZA 2YU4A 1N72A 5I7YA 3P1EA 2KGGA 1Z6UA 3HCUA 4O70A 5HRWA 2KE1A 5HENA 5A5PA 4J1PA 4NUEA 4MSXA 2ECNA 1HYIA 3K2JA 5I88A 5EPBA 5CZGA 2OUOA 4PS5A 2H0DB 5IG6A 3P5OA 3O36A 4QY4A 1JSPB 1WEPA 2PUYA 3M63A 4HXSA 4TYLA 2LGLA 1T1HA 5FH8A 2DKWA 2BAYA 5I1QA 5A83A 5EWHA 5H1VA 4HXKA 2LGKA 4OGIA 4IC3A 3MQMA 5EWVA 4YATA 4LDFA 4TTEA 5D3HA 4PCEA 4WHUA 1WUGA 1HYJA 1X4JA 2YT5A 2YELA 4Q6FA 5ETBA 4UYGA 4HBVA 4A9NA 4FIPA 5B79A 5EWCA 2L5EA 1WEMA 4HBWA 3ZYUA 5HRXA 2FUIA 3O33A 2GRCA 5H85A 4PKLA 2LQ6A 4AUQB 5I80A 4F52B 4IOOA 5CUCA 4NR9A 3RCWA 5CQ8A 3Q2EA 2MNZA 4N4FA 4YBSA 4QSQA 4UITA 5A82A 2EODA 2RSDA 5DLXA 2KWJA 2KGIA 5FE2A 5FDZA 5EQ1A 5FE4A 3U5JA 3AADA 5LJ1A 3KV5A 5FG6A 2MA5A 3JVJA 4O76A 4PCIA 5FFYA 4O77A 4NUDA 2YEKA 5D1MB 4YYHA 5FE3A 2R0VA 5HELA 5G04B 5DKDA 5CQAA 1X4UA 5FE0A 1K2FA 4HXNA 4DONA 4O71A 4YYIA 5IGKA 4A9HA 5KTUA 5H9MA 3UVYA 5EK9A 3HMEA 5I7XA 5HFQA 4YADA 3UVDA 2DX8A 5E9KA 5DKCA 5KO4A 4V3LC 5EA1A 4LZ2A 3HCTA 5E3DA 2CSYA 5CUAA 4XI1A 4LZRA 5D26A 3P1DA 5C7NA 2XEUA 4LKAA 5LCWB 3S92A 4A9OA 4C67A 5I89A 3S91A 2VJFA 4XUAA 5B77A 4NN2A 4CUUA 2OSSA 5F25A 4YABA 5HLSA 5IGMA 4MR3A 4Q0OA 5TB6A 5EV9A 4TU6A 4UIZA 5KTWA 5C89A 4HXPA 2R0SA 5D3PA 4ALHA 4R7EA 4ZW1A 5L98A 4TT2A 5JI8A 4KV4A 4YYMA 4UIWA 5I40A 2R10A 5TDWA 4UP0A 4TS8A 4QC1A 4O7AA 4QSRA 4QBMA 4A49A 3JVMA 5EGUA 4O72A 3P1CA 4QYLA 4YY4A 1E6IA 2I7KA 2H0DA 1WEOA 3JVLA 4ZUXU 4AP4A 2RO1A 5HJCA 3C6WA 4XY9A 5B8DA 4YC9A 3HTKC 3HMFA 5CRMA 4MR4A 4HXMA 5E74A 4QZSA 2CKLB 2HDPA 2YYRA 2ECVA 4TZ2A 4LYSA 4HXRA 4XYAA 3LQIA 3KV6A 2OXQC 2VPEA 5JG6A 5E9MA 5HQ7A 4UYFB 2M6MA 2VPBA 4ZDTA 5EI4A 5DLZA 4R2YA 4GPJA 4QNSA 4NQMA 4IR6A 5DKHA 5E9LA 5D25A 5DYUA 4O7EA 5C13A 1IYMA 3U5KA 4I7BA 4YYNA 1JM7B 5D3NA 4QC3A 2JMIA 4AYCA 5EP7A 2K16A 3V43A 4BBQA 5TBNA 4AVXA 2MT5A 2MD7B 5CUBA 5EVAA 2HYED 4CLBA 5LJ2A 2E6SA 2YDWA 3U5NA 4QUTA 5KH7A 4NR6A 5H1TA 1DVPA 5DYAA 5A5QA 4R8PK 4ZQLA 2OO1A 2VPDA 2YYNA 4NR8A 5DX4A 5D0CA 5C85A 2M3HA 4FLPA 5G4RA 5FB1A 5ENEA 3LJWA 3SOUA 2F6JA 3ASLA 3O37A 4CA1A 5CTLA 5HRVA 1WE9A 4FO9A 5E3GA 5A5OA 3N9OA 4FK5A 5KHMA 5CS8A 2KWNA 1WEVA 2RNXA 2L85A 4J0SA 3UV5A 1LDKC 2UZGA 5II1A 4CUPA 5EPSA 3SOXA 4CFKA 2G4AA 5CFWA 2ECJA 5ENGA 3QZSA 1WEUA 5D24A 4CURA 2MIQA 4MEQA 5EYAF 4NYXA 4OGJA 4WZ3B 5FFWA 4Y03A 5F62A 5A5NA 4MR6A 4BJXA 4LADB 3M99A 5L8TA 5EWDA 5JWMA 5DFDA 4A9JA 5FH7A 5II2A 2L80A 4FJCA 3P1FA 4N4GA 5D3TA 4TT6A 4N4IA 4J0RA 1U6GB 3FL2A 5LJ0A 4QSXA 1F62A 4YK0A 1VYXA 2VJEB 3N9QA 3DQVR 3DAIA 5ENBA 5H1UA 5FFVA 1WFKA 5B75A 3UV2A 3O34A 5AMFA 5E0RA 3O35A 4WHWA 5FE1A 3UVWA 3UW9A 5D3RA 3O70A 4GB0A 5D3LA 4Z1QA 1WEEA 2M1RA 2ECIA 3C5KA 5ETDA 5C4QA 5I86A 5LUUA 2D82A 4S3OB 3U5OA 4QSTA 5D3JA 2I50A 5D1KB 4QEVA 3ZNIA 5G0FA 5F36A 5TRBA 5IBNA 2D8SA 5CPEA 3MUKA 5I29A 2K17A 2LGGA 3KNVA 4WA6A 5TABA 3IU5A 2L0BA 2CKLA 2YEMA 2E3KA 5J0DA 4N3WA 2XB1A 5IGLA 5BT3A 4NXJA 2Y1MA 4PY6A 3N9MA 5ENHA 4BW4A 4O7CA 5F5ZA 4UYFA 2KIZA 5HM0A 3Q2FA 4F3IA 2H60A 4S3OC 2WP2A 2I8NA 3U5LA 4A9MA 1XWHA 5ENCA 1JM7A 1ZBDB 1WGMA 3M62A 4J3IA 5LKZA 2MA6A 2KTBB 3N9NA 5DFCA 4X3GA 2LSPB 5FE6A 4HBXA 3EB6A 4LYIA 3SOWA 5EPRA 4NYWA 4UIVA 2E7OA 1BORA 2AN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUM A;  5CGP A;  3NG2 A;  1CHC A;  2YRE A;  5DYC A;  3GG3 A;  5A81 A;  2LDR A;  3RPG B;  5FE5 A;  5LVR A;  2LRI C;  4QUU A;  2QJ0 A;  2VPG A;  4V3K C;  4C66 A;  4NR5 A;  2DAT A;  2FUU A;  4NYV A;  5CP5 A;  2LGV A;  4YAX A;  5L99 A;  4QYD A;  5F60 A;  5LVQ A;  2F42 A;  4YH4 A;  3MUL A;  2RS9 B;  3LXJ A;  5FH6 A;  2ECW A;  2RNW A;  5ENI A;  2RFJ A;  1Z60 A;  3U5P A;  4CUS A;  3GV4 A;  4W4U A;  3UV4 A;  2VNF A;  2F6N A;  3SVH A;  5FE9 A;  3HCS A;  4UIX A;  3MHH A;  5DFB A;  3RPG C;  3ZVZ B;  2KWK A;  5C87 A;  4UYE A;  3DPL R;  4L7X A;  3NXB A;  2N9G A;  4NUC A;  4E96 A;  5DBM A;  4QF3 A;  5FER A;  5KU3 A;  4I7D A;  4A0C D;  4Q0N A;  5KH9 A;  4MR5 A;  3AQA A;  2PNX A;  5L97 A;  2LXH C;  4I7C A;  5IID A;  4LYW A;  4LRG A;  5I3L A;  2RI7 A;  3LQH A;  4YYD A;  1ZS5 A;  1WEQ A;  2QIZ A;  5K29 A;  2ECG A;  5FB0 A;  4UYH A;  5BT5 A;  4BW1 A;  4WZ0 A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4NQN A;  4QSV A;  4LR6 A;  5EWW A;  5HEM A;  4IC2 A;  5FBX A;  3D7C A;  2G45 A;  4AKN A;  2MJV B;  4UI9 B;  5D3S A;  2LV9 A;  5EM3 A;  2DWW A;  2ZET C;  5CQ6 A;  4B7Y C;  4Z6I A;  5G4S A;  5FE8 A;  4NR7 A;  4O64 A;  5HQ6 A;  4A9L A;  4YY6 A;  1RMD A;  1N87 A;  4CUT A;  2YQL A;  2YHN A;  5CUG A;  4IR4 A;  4IOR A;  4TT4 A;  1JOC A;  3IU6 A;  5A5R A;  2K1J A;  2YQM A;  3QZT A;  3FKM X;  4O7B A;  4YH3 A;  2KR4 A;  5AIT A;  4UP5 A;  3LRQ A;  4NRB A;  5CQ7 A;  5COI A;  5F63 A;  2G6Q A;  5EU1 A;  3PUQ A;  4WZ2 A;  4HXL A;  4O7F A;  2EA6 A;  2QIC A;  5EIC A;  5HCL A;  4BW2 A;  2IDA A;  1MM3 A;  5CQ4 A;  2L5U A;  4O78 A;  5EIS A;  5E73 A;  5DW1 A;  4QEU A;  5CY9 A;  2R0Y A;  2LN0 A;  2NAA A;  5F2P A;  2Y43 A;  5ENJ A;  2EGP A;  1G25 A;  4A9K A;  4CUQ A;  1JM4 B;  4YBT A;  5ENF A;  5C8G A;  2CSZ A;  3MHS A;  4A4B A;  5D7X A;  1WIM A;  2YSJ A;  3MXF A;  3SHB A;  3U5M A;  5CU8 A;  2E6R A;  3QZV A;  2M85 A;  4QB3 A;  3PHD A;  5KTX A;  4A9E A;  4PPE A;  2D9E A;  4NR4 A;  2C2V S;  4OUF A;  4YYK A;  3G0J A;  3L1X A;  2YSM A;  4ZC9 A;  1WES A;  4XUB A;  5CQ5 A;  5CUD A;  4QF2 A;  1Z2Q A;  5FG4 A;  5BT4 A;  4L58 A;  4TZ8 A;  4AYC B;  2DVS A;  1FP0 A;  4BHW A;  5B76 A;  5HFR A;  2L75 A;  5FE7 A;  2C2L A;  4LLB A;  5F3A A;  2MNY A;  5F61 A;  2VP7 A;  5A5S A;  2JRJ A;  5DYX A;  4KV1 A;  4ALG A;  4IR5 A;  2CT2 A;  5E9Y A;  4N4H A;  3ZVY A;  4IR3 A;  2DVV A;  4UIU A;  2KFT A;  1WIL A;  2LXP C;  3HMH A;  3L1Z B;  2WP1 A;  4KCX A;  4BW3 A;  1VD4 A;  3PUR A;  5J3X A;  3G0L A;  5CUE A;  5FG5 A;  5AD2 A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  4Z1S A;  4NS5 A;  5HQ5 A;  3SVF A;  4WIV A;  1F68 A;  2JMJ A;  4QR5 A;  5L96 A;  4YBM A;  3VK6 A;  4HBY A;  1WEN A;  4TU4 A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  5TCM A;  5DIN A;  5DY7 A;  4QEW A;  4CL9 A;  2JMD A;  5L8U A;  2L84 A;  1EQF A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3JVK A;  3KQI A;  4GNG A;  5LKX A;  3DWY A;  4HXO A;  5DW2 A;  4B86 C;  4A9I A;  5E9I A;  3O7A A;  3N9P A;  2DVQ A;  4C9Z A;  4CCG X;  4MEN A;  2ECT A;  5E7D A;  1X0J A;  5AIU A;  5KH3 A;  3ZPV E;  2RNY A;  5ACY A;  5F1L A;  4RVR A;  5AME A;  4LZS A;  3T7L A;  5IGN A;  3ZTG A;  5C11 A;  2KYU A;  4O75 A;  2K4D A;  1LDJ B;  3UVX A;  1VFY A;  4MVT A;  4LC2 A;  3MB4 A;  1V87 A;  2YUR A;  1MM2 A;  4MEO A;  4X2I A;  5F1H A;  5A85 A;  4P5O B;  2DVR A;  4TQN A;  4NRC A;  2KWO A;  4Z93 A;  2E7N A;  4UYD A;  5A7C A;  2YUC A;  3T6R A;  4MEP A;  5CQ3 A;  4O74 A;  2KRE A;  5LKT A;  4A9F A;  4LK9 A;  4Z6H A;  5AD3 A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  3SVG A;  4CFL A;  4QSW A;  4XY8 A;  5I83 A;  2MD8 C;  2KU3 A;  4YYJ A;  3I3J A;  5CQT A;  1FBV A;  3IHP A;  4QR3 A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  2YQD A;  4TKP B;  5DKA A;  5E9V A;  4IOQ A;  4QSP A;  5LKU A;  3ONI A;  4QSS A;  2Y1N A;  4A4C A;  2VJE A;  4UIY A;  2FSA A;  3TLP A;  3EB5 A;  4QSU A;  4QR4 A;  3I2D A;  2YW5 A;  4NRA A;  4GND A;  4LJN A;  3MB3 A;  2NXB A;  4YYG A;  5CRZ A;  2YU4 A;  1N72 A;  5I7Y A;  3P1E A;  2KGG A;  1Z6U A;  3HCU A;  4O70 A;  5HRW A;  2KE1 A;  5HEN A;  5A5P A;  4J1P A;  4NUE A;  4MSX A;  2ECN A;  1HYI A;  3K2J A;  5I88 A;  5EPB A;  5CZG A;  2OUO A;  4PS5 A;  2H0D B;  5IG6 A;  3P5O A;  3O36 A;  4QY4 A;  1JSP B;  1WEP A;  2PUY A;  3M63 A;  4HXS A;  4TYL A;  2LGL A;  1T1H A;  5FH8 A;  2DKW A;  2BAY A;  5I1Q A;  5A83 A;  5EWH A;  5H1V A;  4HXK A;  2LGK A;  4OGI A;  4IC3 A;  3MQM A;  5EWV A;  4YAT A;  4LDF A;  4TTE A;  5D3H A;  4PCE A;  4WHU A;  1WUG A;  1HYJ A;  1X4J A;  2YT5 A;  2YEL A;  4Q6F A;  5ETB A;  4UYG A;  4HBV A;  4A9N A;  4FIP A;  5B79 A;  5EWC A;  2L5E A;  1WEM A;  4HBW A;  3ZYU A;  5HRX A;  2FUI A;  3O33 A;  2GRC A;  5H85 A;  4PKL A;  2LQ6 A;  4AUQ B;  5I80 A;  4F52 B;  4IOO A;  5CUC A;  4NR9 A;  3RCW A;  5CQ8 A;  3Q2E A;  2MNZ A;  4N4F A;  4YBS A;  4QSQ A;  4UIT A;  5A82 A;  2EOD A;  2RSD A;  5DLX A;  2KWJ A;  2KGI A;  5FE2 A;  5FDZ A;  5EQ1 A;  5FE4 A;  3U5J A;  3AAD A;  5LJ1 A;  3KV5 A;  5FG6 A;  2MA5 A;  3JVJ A;  4O76 A;  4PCI A;  5FFY A;  4O77 A;  4NUD A;  2YEK A;  5D1M B;  4YYH A;  5FE3 A;  2R0V A;  5HEL A;  5G04 B;  5DKD A;  5CQA A;  1X4U A;  5FE0 A;  1K2F A;  4HXN A;  4DON A;  4O71 A;  4YYI A;  5IGK A;  4A9H A;  5KTU A;  5H9M A;  3UVY A;  5EK9 A;  3HME A;  5I7X A;  5HFQ A;  4YAD A;  3UVD A;  2DX8 A;  5E9K A;  5DKC A;  5KO4 A;  4V3L C;  5EA1 A;  4LZ2 A;  3HCT A;  5E3D A;  2CSY A;  5CUA A;  4XI1 A;  4LZR A;  5D26 A;  3P1D A;  5C7N A;  2XEU A;  4LKA A;  5LCW B;  3S92 A;  4A9O A;  4C67 A;  5I89 A;  3S91 A;  2VJF A;  4XUA A;  5B77 A;  4NN2 A;  4CUU A;  2OSS A;  5F25 A;  4YAB A;  5HLS A;  5IGM A;  4MR3 A;  4Q0O A;  5TB6 A;  5EV9 A;  4TU6 A;  4UIZ A;  5KTW A;  5C89 A;  4HXP A;  2R0S A;  5D3P A;  4ALH A;  4R7E A;  4ZW1 A;  5L98 A;  4TT2 A;  5JI8 A;  4KV4 A;  4YYM A;  4UIW A;  5I40 A;  2R10 A;  5TDW A;  4UP0 A;  4TS8 A;  4QC1 A;  4O7A A;  4QSR A;  4QBM A;  4A49 A;  3JVM A;  5EGU A;  4O72 A;  3P1C A;  4QYL A;  4YY4 A;  1E6I A;  2I7K A;  2H0D A;  1WEO A;  3JVL A;  4ZUX U;  4AP4 A;  2RO1 A;  5HJC A;  3C6W A;  4XY9 A;  5B8D A;  4YC9 A;  3HTK C;  3HMF A;  5CRM A;  4MR4 A;  4HXM A;  5E74 A;  4QZS A;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  4TZ2 A;  4LYS A;  4HXR A;  4XYA A;  3LQI A;  3KV6 A;  2OXQ C;  2VPE A;  5JG6 A;  5E9M A;  5HQ7 A;  4UYF B;  2M6M A;  2VPB A;  4ZDT A;  5EI4 A;  5DLZ A;  4R2Y A;  4GPJ A;  4QNS A;  4NQM A;  4IR6 A;  5DKH A;  5E9L A;  5D25 A;  5DYU A;  4O7E A;  5C13 A;  1IYM A;  3U5K A;  4I7B A;  4YYN A;  1JM7 B;  5D3N A;  4QC3 A;  2JMI A;  4AYC A;  5EP7 A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  5CUB A;  5EVA A;  2HYE D;  4CLB A;  5LJ2 A;  2E6S A;  2YDW A;  3U5N A;  4QUT A;  5KH7 A;  4NR6 A;  5H1T A;  1DVP A;  5DYA A;  5A5Q A;  4R8P K;  4ZQL A;  2OO1 A;  2VPD A;  2YYN A;  4NR8 A;  5DX4 A;  5D0C A;  5C85 A;  2M3H A;  4FLP A;  5G4R A;  5FB1 A;  5ENE A;  3LJW A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  5CTL A;  5HRV A;  1WE9 A;  4FO9 A;  5E3G A;  5A5O A;  3N9O A;  4FK5 A;  5KHM A;  5CS8 A;  2KWN A;  1WEV A;  2RNX A;  2L85 A;  4J0S A;  3UV5 A;  1LDK C;  2UZG A;  5II1 A;  4CUP A;  5EPS A;  3SOX A;  4CFK A;  2G4A A;  5CFW A;  2ECJ A;  5ENG A;  3QZS A;  1WEU A;  5D24 A;  4CUR A;  2MIQ A;  4MEQ A;  5EYA F;  4NYX A;  4OGJ A;  4WZ3 B;  5FFW A;  4Y03 A;  5F62 A;  5A5N A;  4MR6 A;  4BJX A;  4LAD B;  3M99 A;  5L8T A;  5EWD A;  5JWM A;  5DFD A;  4A9J A;  5FH7 A;  5II2 A;  2L80 A;  4FJC A;  3P1F A;  4N4G A;  5D3T A;  4TT6 A;  4N4I A;  4J0R A;  1U6G B;  3FL2 A;  5LJ0 A;  4QSX A;  1F62 A;  4YK0 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  3DAI A;  5ENB A;  5H1U A;  5FFV A;  1WFK A;  5B75 A;  3UV2 A;  3O34 A;  5AMF A;  5E0R A;  3O35 A;  4WHW A;  5FE1 A;  3UVW A;  3UW9 A;  5D3R A;  3O70 A;  4GB0 A;  5D3L A;  4Z1Q A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  5ETD A;  5C4Q A;  5I86 A;  5LUU A;  2D82 A;  4S3O B;  3U5O A;  4QST A;  5D3J A;  2I50 A;  5D1K B;  4QEV A;  3ZNI A;  5G0F A;  5F36 A;  5TRB A;  5IBN A;  2D8S A;  5CPE A;  3MUK A;  5I29 A;  2K17 A;  2LGG A;  3KNV A;  4WA6 A;  5TAB A;  3IU5 A;  2L0B A;  2CKL A;  2YEM A;  2E3K A;  5J0D A;  4N3W A;  2XB1 A;  5IGL A;  5BT3 A;  4NXJ A;  2Y1M A;  4PY6 A;  3N9M A;  5ENH A;  4BW4 A;  4O7C A;  5F5Z A;  4UYF A;  2KIZ A;  5HM0 A;  3Q2F A;  4F3I A;  2H60 A;  4S3O C;  2WP2 A;  2I8N A;  3U5L A;  4A9M A;  1XWH A;  5ENC A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  4J3I A;  5LKZ A;  2MA6 A;  2KTB B;  3N9N A;  5DFC A;  4X3G A;  2LSP B;  5FE6 A;  4HBX A;  3EB6 A;  4LYI A;  3SOW A;  5EPR A;  4NYW A;  4UIV A;  2E7O A;  1BOR A;  2AN6 A; 
#chains in the Genus database with same CATH topology
 1WUM A;  5CGP A;  3NG2 A;  1CHC A;  2YRE A;  5DYC A;  3GG3 A;  5A81 A;  2E61 A;  2LDR A;  5FE5 A;  3RPG B;  5LVR A;  2LRI C;  4QUU A;  2QJ0 A;  2VPG A;  4V3K C;  3MDB C;  4C66 A;  4NR5 A;  2DAT A;  2FUU A;  4NYV A;  5CP5 A;  2LGV A;  4YAX A;  5L99 A;  4QYD A;  5F60 A;  5LVQ A;  2F42 A;  4YH4 A;  3MUL A;  2RS9 B;  3LXJ A;  5FH6 A;  2ECW A;  2RNW A;  5ENI A;  2RFJ A;  3VKH A;  1Z60 A;  3U5P A;  4CUS A;  2MKE A;  3GV4 A;  4W4U A;  3UV4 A;  2VNF A;  2F6N A;  3SVH A;  5FE9 A;  3HCS A;  3KDE C;  4UIX A;  3MHH A;  5DFB A;  3RPG C;  3ZVZ B;  2KWK A;  5C87 A;  4UYE A;  3DPL R;  4L7X A;  3NXB A;  2N9G A;  4NUC A;  4E96 A;  5DBM A;  4QF3 A;  5FER A;  5KU3 A;  4I7D A;  4A0C D;  4Q0N A;  5KH9 A;  4MR5 A;  3T9K A;  3AQA A;  2PNX A;  5L97 A;  2LXH C;  4I7C A;  5IID A;  4LYW A;  4LRG A;  5I3L A;  2RI7 A;  3LQH A;  4YYD A;  1ZS5 A;  1WEQ A;  2QIZ A;  5K29 A;  2ECG A;  5FB0 A;  4UYH A;  5BT5 A;  4BW1 A;  4OGE A;  4WZ0 A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4NQN A;  4QSV A;  4LR6 A;  5EWW A;  5HEM A;  4IC2 A;  5FBX A;  3D7C A;  2G45 A;  4AKN A;  2MJV B;  4UI9 B;  5D3S A;  2LV9 A;  5EM3 A;  2DWW A;  2ZET C;  5CQ6 A;  4B7Y C;  4Z6I A;  5G4S A;  5FE8 A;  4NR7 A;  3FEH A;  4O64 A;  5HQ6 A;  4A9L A;  4YY6 A;  1RMD A;  1N87 A;  4CUT A;  2YQL A;  2YHN A;  5CUG A;  4IR4 A;  4IOR A;  4TT4 A;  1JOC A;  3IU6 A;  5A5R A;  2K1J A;  2YQM A;  3QZT A;  3FKM X;  4O7B A;  4YH3 A;  2KR4 A;  3E2D A;  5AIT A;  4UP5 A;  3LRQ A;  4NRB A;  5CQ7 A;  5COI A;  5F63 A;  2G6Q A;  5EU1 A;  3PUQ A;  4WZ2 A;  2OWA A;  4HXL A;  4O7F A;  2EA6 A;  2QIC A;  2JM3 A;  5EIC A;  5HCL A;  4BW2 A;  2IDA A;  1MM3 A;  5CQ4 A;  2L5U A;  4O78 A;  4F1P A;  5EIS A;  5E73 A;  5DW1 A;  4QEU A;  5CY9 A;  2R0Y A;  2LN0 A;  2NAA A;  5F2P A;  2CSV A;  2Y43 A;  5ENJ A;  2EGP A;  1G25 A;  4A9K A;  4CUQ A;  1JM4 B;  4YBT A;  5ENF A;  5C8G A;  2CSZ A;  3MHS A;  4A4B A;  2D8U A;  5D7X A;  1WIM A;  2YSJ A;  3MXF A;  3SHB A;  3U5M A;  5CU8 A;  2E6R A;  3QZV A;  2M85 A;  4QB3 A;  3PHD A;  5KTX A;  4A9E A;  4PPE A;  2D9E A;  4NR4 A;  2C2V S;  4OUF A;  4YYK A;  3G0J A;  3L1X A;  2YSM A;  4ZC9 A;  3D1B A;  1WES A;  4XUB A;  5CQ5 A;  5CUD A;  2FFW A;  4QF2 A;  1Z2Q A;  5FG4 A;  5BT4 A;  4L58 A;  4TZ8 A;  4AYC B;  2DVS A;  1FP0 A;  4BHW A;  5B76 A;  5HFR A;  2L75 A;  5FE7 A;  2C2L A;  4LLB A;  5F3A A;  2MNY A;  5F61 A;  2VP7 A;  5A5S A;  2JRJ A;  5DYX A;  4KV1 A;  4ALG A;  4IR5 A;  2CT2 A;  5E9Y A;  4N4H A;  3ZVY A;  4IR3 A;  2DVV A;  3LDY A;  4UIU A;  2KFT A;  1WIL A;  2LXP C;  3HMH A;  3L1Z B;  2WP1 A;  4KCX A;  4BW3 A;  1VD4 A;  3PUR A;  5J3X A;  3G0L A;  5CUE A;  5FG5 A;  5AD2 A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  4Z1S A;  4NS5 A;  5HQ5 A;  3SVF A;  4WIV A;  1F68 A;  2JMJ A;  4QR5 A;  5L96 A;  4YBM A;  3VK6 A;  4HBY A;  1WEN A;  4TU4 A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  2YVR A;  5TCM A;  5DIN A;  5DY7 A;  4QEW A;  4CL9 A;  2JMD A;  5L8U A;  2L7P A;  3FAN A;  2L84 A;  1EQF A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3JVK A;  3KQI A;  4GNG A;  5LKX A;  3DWY A;  4HXO A;  5DW2 A;  2P57 A;  4B86 C;  4A9I A;  5E9I A;  3O7A A;  3N9P A;  2DVQ A;  4C9Z A;  3DWD A;  4CCG X;  4MEN A;  2ECT A;  5E7D A;  1X0J A;  5AIU A;  5KH3 A;  3ZPV E;  2RNY A;  5ACY A;  5F1L A;  4RVR A;  5AME A;  4LZS A;  3T7L A;  5IGN A;  3ZTG A;  5C11 A;  2KYU A;  4O75 A;  2KKX A;  2K4D A;  1LDJ B;  3UVX A;  1VFY A;  4MVT A;  4LC2 A;  3MB4 A;  1V87 A;  2YUR A;  1MM2 A;  4MEO A;  4X2I A;  5F1H A;  5A85 A;  4AKG A;  2DVR A;  4P5O B;  4TQN A;  4NRC A;  2KWO A;  4Z93 A;  2E7N A;  4UYD A;  5A7C A;  2YUC A;  5SVI B;  3T6R A;  4MEP A;  5CQ3 A;  4O74 A;  2KRE A;  5LKT A;  4A9F A;  4LK9 A;  4Z6H A;  5AD3 A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  3SVG A;  4CFL A;  4QSW A;  4XY8 A;  5I83 A;  2MD8 C;  2KU3 A;  4YYJ A;  3I3J A;  5CQT A;  1FBV A;  3IHP A;  4QR3 A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  2YQD A;  4TKP B;  5DKA A;  5E9V A;  4IOQ A;  2XP0 A;  4AKI A;  4QSP A;  5LKU A;  3LVQ E;  3ONI A;  4QSS A;  2Y1N A;  4A4C A;  2VJE A;  4UIY A;  2FSA A;  3TLP A;  3EB5 A;  2CRR A;  4QSU A;  4QR4 A;  3I2D A;  2YW5 A;  4NRA A;  4GND A;  4LJN A;  3MB3 A;  2NXB A;  4YYG A;  5CRZ A;  2YU4 A;  1N72 A;  5I7Y A;  3P1E A;  2KGG A;  1Z6U A;  3HCU A;  4O70 A;  2XOY A;  5HRW A;  2KE1 A;  5HEN A;  5A5P A;  4J1P A;  4NUE A;  4MSX A;  2ECN A;  1HYI A;  3K2J A;  5I88 A;  5EPB A;  5CZG A;  2OUO A;  4PS5 A;  2H0D B;  5IG6 A;  3P5O A;  3O36 A;  4QY4 A;  1JSP B;  1WEP A;  2PUY A;  3M63 A;  4HXS A;  4TYL A;  2LGL A;  1T1H A;  5FH8 A;  2DKW A;  2BAY A;  5I1Q A;  5A83 A;  5EWH A;  5H1V A;  4HXK A;  2LGK A;  4OGI A;  3M7K A;  4IC3 A;  3MQM A;  5EWV A;  4YAT A;  4LDF A;  4TTE A;  5D3H A;  4PCE A;  4AI6 A;  4WHU A;  1WUG A;  5SVX A;  1HYJ A;  1X4J A;  2YT5 A;  2YEL A;  4Q6F A;  5ETB A;  4UYG A;  4HBV A;  4A9N A;  4FIP A;  5B79 A;  5EWC A;  2L5E A;  4OGC A;  1WEM A;  4HBW A;  3ZYU A;  5HRX A;  3DDT A;  2FUI A;  3O33 A;  2GRC A;  5H85 A;  4PKL A;  2LQ6 A;  4AUQ B;  5I80 A;  4F52 B;  3FAO A;  4IOO A;  5CUC A;  4NR9 A;  3RCW A;  5CQ8 A;  3Q2E A;  2MNZ A;  4QQ4 A;  2LAU A;  4N4F A;  4YBS A;  4QSQ A;  4UIT A;  5A82 A;  2EOD A;  2RSD A;  2CON A;  5DLX A;  2KWJ A;  2KGI A;  5FE2 A;  5FDZ A;  5EQ1 A;  2JUN A;  5FE4 A;  3U5J A;  3AAD A;  5LJ1 A;  3KV5 A;  5FG6 A;  2MA5 A;  3JVJ A;  4O76 A;  4PCI A;  5FFY A;  4O77 A;  4NUD A;  2YEK A;  5D1M B;  4YYH A;  5FE3 A;  4O62 A;  2R0V A;  5HEL A;  5G04 B;  5DKD A;  5SVI A;  5CQA A;  1X4U A;  5FE0 A;  1K2F A;  4HXN A;  4DON A;  4O71 A;  4YYI A;  5IGK A;  3SUB A;  4A9H A;  5KTU A;  5H9M A;  3UVY A;  5EK9 A;  3HME A;  5I7X A;  5HFQ A;  4YAD A;  3UVD A;  2DX8 A;  5E9K A;  5DKC A;  5KO4 A;  4V3L C;  5EA1 A;  4LZ2 A;  3HCT A;  5E3D A;  2CSY A;  5CUA A;  4XI1 A;  4LZR A;  5D26 A;  3P1D A;  5C7N A;  2XEU A;  4LKA A;  5LCW B;  3S92 A;  2CRW A;  4A9O A;  4C67 A;  5I89 A;  3S91 A;  2VJF A;  4XUA A;  5B77 A;  2XOZ A;  3LVR E;  4NN2 A;  3D1D A;  4CUU A;  2OSS A;  5F25 A;  4YAB A;  5HLS A;  5IGM A;  4MR3 A;  4Q0O A;  5TB6 A;  2EJN A;  5EV9 A;  1MBM A;  3FM8 C;  4TU6 A;  4UIZ A;  5KTW A;  5C89 A;  4HXP A;  2R0S A;  5D3P A;  4ALH A;  1ZKR A;  4ZW1 A;  5L98 A;  4R7E A;  4TT2 A;  5JI8 A;  4KV4 A;  3FJU B;  3O47 A;  4YYM A;  4UIW A;  5I40 A;  2R10 A;  5TDW A;  4UP0 A;  4TS8 A;  5K3Q A;  4QC1 A;  4O7A A;  4QSR A;  4QBM A;  4A49 A;  3JVM A;  5EGU A;  4O72 A;  2B0O E;  3P1C A;  4QYL A;  4YY4 A;  1E6I A;  2I7K A;  2EXU A;  2H0D A;  1WEO A;  2KKY A;  3JVL A;  4ZUX U;  4AP4 A;  2RO1 A;  5HJC A;  3C6W A;  4XY9 A;  5B8D A;  4YC9 A;  3HTK C;  3HMF A;  5CRM A;  4MR4 A;  4HXM A;  4H9D A;  5E74 A;  4QZS A;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  4TZ2 A;  4LYS A;  4HXR A;  4XYA A;  3LQI A;  3KV6 A;  2OXQ C;  2VPE A;  5JG6 A;  5E9M A;  5HQ7 A;  4UYF B;  2M6M A;  2VPB A;  4ZDT A;  5EI4 A;  5DLZ A;  4R2Y A;  4GPJ A;  4QNS A;  4NQM A;  4IR6 A;  5DKH A;  5E9L A;  5D25 A;  5DYU A;  4O7E A;  5C13 A;  1IYM A;  3U5K A;  2XOC A;  4I7B A;  4YYN A;  1JM7 B;  5D3N A;  4QC3 A;  2JMI A;  4AYC A;  5EP7 A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  5CUB A;  5EVA A;  2HYE D;  4CLB A;  5LJ2 A;  2E6S A;  2YDW A;  3U5N A;  4QUT A;  5KH7 A;  4NR6 A;  5H1T A;  1DVP A;  5DYA A;  5A5Q A;  4R8P K;  4ZQL A;  2OO1 A;  2VPD A;  2YYN A;  4NR8 A;  5DX4 A;  5D0C A;  5C85 A;  2M3H A;  1PUO A;  4FLP A;  5G4R A;  5FB1 A;  4AKH A;  2DJA A;  2RR4 A;  5ENE A;  3LJW A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  5CTL A;  5HRV A;  3ERR A;  1WE9 A;  5E3G A;  5A5O A;  4FO9 A;  3N9O A;  4FK5 A;  3H7H A;  5KHM A;  5CS8 A;  2KWN A;  1WEV A;  1DCQ A;  2RNX A;  2L85 A;  4J0S A;  3UV5 A;  1LDK C;  2UZG A;  5II1 A;  4CUP A;  5EPS A;  3SOX A;  4CFK A;  2G4A A;  5CFW A;  2ECJ A;  5ENG A;  3QZS A;  1WEU A;  5D24 A;  4CUR A;  2MIQ A;  4MEQ A;  2FD4 A;  5EYA F;  4NYX A;  4OGJ A;  4WZ3 B;  5FFW A;  4Y03 A;  5F62 A;  5A5N A;  4Z0O A;  4MR6 A;  4BJX A;  4LAD B;  3M99 A;  5L8T A;  5EWD A;  5JWM A;  3Q1D A;  5DFD A;  4A9J A;  5FH7 A;  5II2 A;  2L80 A;  4FJC A;  3P1F A;  4N4G A;  5D3T A;  4TT6 A;  4N4I A;  4J0R A;  5SVY A;  1U6G B;  3FL2 A;  5LJ0 A;  4QSX A;  1F62 A;  4YK0 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  3DAI A;  5ENB A;  5H1U A;  5FFV A;  1WFK A;  5B75 A;  3UV2 A;  3O34 A;  5AMF A;  5E0R A;  3O35 A;  4WHW A;  5FE1 A;  3UVW A;  3UW9 A;  5D3R A;  3VKG A;  3O70 A;  4GB0 A;  5D3L A;  4Z1Q A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  5ETD A;  5C4Q A;  5I86 A;  5LUU A;  2D82 A;  4Z0R A;  4S3O B;  3U5O A;  4QST A;  5D3J A;  2I50 A;  5D1K B;  4QEV A;  3ZNI A;  5G0F A;  3JUE A;  5F36 A;  5TRB A;  5IBN A;  2D8S A;  5CPE A;  3MUK A;  5I29 A;  2K17 A;  2LGG A;  3KNV A;  4WA6 A;  5TAB A;  3IU5 A;  2L0B A;  2CKL A;  2YEM A;  2E3K A;  5J0D A;  4N3W A;  2XB1 A;  5IGL A;  5BT3 A;  4NXJ A;  2Y1M A;  4PY6 A;  3N9M A;  5ENH A;  4BW4 A;  4O7C A;  5F5Z A;  4UYF A;  2KIZ A;  5HM0 A;  2DSM A;  3Q2F A;  4F3I A;  2H60 A;  3LJU X;  4S3O C;  3PLW A;  2WP2 A;  2I8N A;  3U5L A;  4A9M A;  1XWH A;  5ENC A;  2EGM A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  4J3I A;  5LKZ A;  2MA6 A;  2KTB B;  3N9N A;  5DFC A;  2IQJ A;  2LSP B;  5FE6 A;  4HBX A;  3EB6 A;  4LYI A;  4X3G A;  3SOW A;  5EPR A;  2M13 A;  4NYW A;  4UIV A;  2E7O A;  1BOR A;  2AN6 A; 
#chains in the Genus database with same CATH homology
 1WUM A;  5CGP A;  3NG2 A;  1CHC A;  2YRE A;  5DYC A;  3GG3 A;  5A81 A;  2LDR A;  3RPG B;  5FE5 A;  5LVR A;  2LRI C;  4QUU A;  2QJ0 A;  2VPG A;  4V3K C;  4C66 A;  4NR5 A;  2DAT A;  2FUU A;  4NYV A;  5CP5 A;  2LGV A;  4YAX A;  5L99 A;  4QYD A;  5F60 A;  5LVQ A;  2F42 A;  4YH4 A;  3MUL A;  2RS9 B;  3LXJ A;  5FH6 A;  2ECW A;  2RNW A;  5ENI A;  2RFJ A;  1Z60 A;  3U5P A;  4CUS A;  3GV4 A;  4W4U A;  3UV4 A;  2VNF A;  2F6N A;  3SVH A;  5FE9 A;  3HCS A;  4UIX A;  3MHH A;  5DFB A;  3RPG C;  3ZVZ B;  2KWK A;  5C87 A;  4UYE A;  3DPL R;  4L7X A;  3NXB A;  2N9G A;  4NUC A;  4E96 A;  5DBM A;  4QF3 A;  5FER A;  5KU3 A;  4I7D A;  4A0C D;  4Q0N A;  5KH9 A;  4MR5 A;  3AQA A;  2PNX A;  5L97 A;  2LXH C;  4I7C A;  5IID A;  4LYW A;  4LRG A;  5I3L A;  2RI7 A;  3LQH A;  4YYD A;  1ZS5 A;  1WEQ A;  2QIZ A;  5K29 A;  2ECG A;  5FB0 A;  4UYH A;  5BT5 A;  4BW1 A;  4WZ0 A;  2VJF B;  2MUM A;  4GNE A;  1E4U A;  4NQN A;  4QSV A;  4LR6 A;  5EWW A;  5HEM A;  4IC2 A;  5FBX A;  3D7C A;  2G45 A;  4AKN A;  2MJV B;  4UI9 B;  5D3S A;  2LV9 A;  5EM3 A;  2DWW A;  2ZET C;  5CQ6 A;  4B7Y C;  4Z6I A;  5G4S A;  5FE8 A;  4NR7 A;  4O64 A;  5HQ6 A;  4A9L A;  4YY6 A;  1RMD A;  1N87 A;  4CUT A;  2YQL A;  2YHN A;  5CUG A;  4IR4 A;  4IOR A;  4TT4 A;  1JOC A;  3IU6 A;  5A5R A;  2K1J A;  2YQM A;  3QZT A;  3FKM X;  4O7B A;  4YH3 A;  2KR4 A;  5AIT A;  4UP5 A;  3LRQ A;  4NRB A;  5CQ7 A;  5COI A;  5F63 A;  2G6Q A;  5EU1 A;  3PUQ A;  4WZ2 A;  4HXL A;  4O7F A;  2EA6 A;  2QIC A;  5EIC A;  5HCL A;  4BW2 A;  2IDA A;  1MM3 A;  5CQ4 A;  2L5U A;  4O78 A;  5EIS A;  5E73 A;  5DW1 A;  4QEU A;  5CY9 A;  2R0Y A;  2LN0 A;  2NAA A;  5F2P A;  2Y43 A;  5ENJ A;  2EGP A;  1G25 A;  4A9K A;  4CUQ A;  1JM4 B;  4YBT A;  5ENF A;  5C8G A;  2CSZ A;  3MHS A;  4A4B A;  5D7X A;  1WIM A;  2YSJ A;  3MXF A;  3SHB A;  3U5M A;  5CU8 A;  2E6R A;  3QZV A;  2M85 A;  4QB3 A;  3PHD A;  5KTX A;  4A9E A;  4PPE A;  2D9E A;  4NR4 A;  2C2V S;  4OUF A;  4YYK A;  3G0J A;  3L1X A;  2YSM A;  4ZC9 A;  1WES A;  4XUB A;  5CQ5 A;  5CUD A;  4QF2 A;  1Z2Q A;  5FG4 A;  5BT4 A;  4L58 A;  4TZ8 A;  4AYC B;  2DVS A;  1FP0 A;  4BHW A;  5B76 A;  5HFR A;  2L75 A;  5FE7 A;  2C2L A;  4LLB A;  5F3A A;  2MNY A;  5F61 A;  2VP7 A;  5A5S A;  2JRJ A;  5DYX A;  4KV1 A;  4ALG A;  4IR5 A;  2CT2 A;  5E9Y A;  4N4H A;  3ZVY A;  4IR3 A;  2DVV A;  4UIU A;  2KFT A;  1WIL A;  2LXP C;  3HMH A;  3L1Z B;  2WP1 A;  4KCX A;  4BW3 A;  1VD4 A;  3PUR A;  5J3X A;  3G0L A;  5CUE A;  5FG5 A;  5AD2 A;  4PTB A;  3LQJ A;  5FEY A;  2YW8 A;  4Z1S A;  4NS5 A;  5HQ5 A;  3SVF A;  4WIV A;  1F68 A;  2JMJ A;  4QR5 A;  5L96 A;  4YBM A;  3VK6 A;  4HBY A;  1WEN A;  4TU4 A;  2G43 A;  2L43 A;  4GNF A;  5D1L B;  5TCM A;  5DIN A;  5DY7 A;  4QEW A;  4CL9 A;  2JMD A;  5L8U A;  2L84 A;  1EQF A;  3L11 A;  1WEW A;  3GL6 A;  5G05 B;  3JVK A;  3KQI A;  4GNG A;  5LKX A;  3DWY A;  4HXO A;  5DW2 A;  4B86 C;  4A9I A;  5E9I A;  3O7A A;  3N9P A;  2DVQ A;  4C9Z A;  4CCG X;  4MEN A;  2ECT A;  5E7D A;  1X0J A;  5AIU A;  5KH3 A;  3ZPV E;  2RNY A;  5ACY A;  5F1L A;  4RVR A;  5AME A;  4LZS A;  3T7L A;  5IGN A;  3ZTG A;  5C11 A;  2KYU A;  4O75 A;  2K4D A;  1LDJ B;  3UVX A;  1VFY A;  4MVT A;  4LC2 A;  3MB4 A;  1V87 A;  2YUR A;  1MM2 A;  4MEO A;  4X2I A;  5F1H A;  5A85 A;  4P5O B;  2DVR A;  4TQN A;  4NRC A;  2KWO A;  4Z93 A;  2E7N A;  4UYD A;  5A7C A;  2YUC A;  3T6R A;  4MEP A;  5CQ3 A;  4O74 A;  2KRE A;  5LKT A;  4A9F A;  4LK9 A;  4Z6H A;  5AD3 A;  3N9L A;  1X4I A;  2YHO A;  3ZYQ A;  3SVG A;  4CFL A;  4QSW A;  4XY8 A;  5I83 A;  2MD8 C;  2KU3 A;  4YYJ A;  3I3J A;  5CQT A;  1FBV A;  3IHP A;  4QR3 A;  3RTR B;  3ZPV 1;  5B78 A;  5TDR A;  2YQD A;  4TKP B;  5DKA A;  5E9V A;  4IOQ A;  4QSP A;  5LKU A;  3ONI A;  4QSS A;  2Y1N A;  4A4C A;  2VJE A;  4UIY A;  2FSA A;  3TLP A;  3EB5 A;  4QSU A;  4QR4 A;  3I2D A;  2YW5 A;  4NRA A;  4GND A;  4LJN A;  3MB3 A;  2NXB A;  4YYG A;  5CRZ A;  2YU4 A;  1N72 A;  5I7Y A;  3P1E A;  2KGG A;  1Z6U A;  3HCU A;  4O70 A;  5HRW A;  2KE1 A;  5HEN A;  5A5P A;  4J1P A;  4NUE A;  4MSX A;  2ECN A;  1HYI A;  3K2J A;  5I88 A;  5EPB A;  5CZG A;  2OUO A;  4PS5 A;  2H0D B;  5IG6 A;  3P5O A;  3O36 A;  4QY4 A;  1JSP B;  1WEP A;  2PUY A;  3M63 A;  4HXS A;  4TYL A;  2LGL A;  1T1H A;  5FH8 A;  2DKW A;  2BAY A;  5I1Q A;  5A83 A;  5EWH A;  5H1V A;  4HXK A;  2LGK A;  4OGI A;  4IC3 A;  3MQM A;  5EWV A;  4YAT A;  4LDF A;  4TTE A;  5D3H A;  4PCE A;  4WHU A;  1WUG A;  1HYJ A;  1X4J A;  2YT5 A;  2YEL A;  4Q6F A;  5ETB A;  4UYG A;  4HBV A;  4A9N A;  4FIP A;  5B79 A;  5EWC A;  2L5E A;  1WEM A;  4HBW A;  3ZYU A;  5HRX A;  2FUI A;  3O33 A;  2GRC A;  5H85 A;  4PKL A;  2LQ6 A;  4AUQ B;  5I80 A;  4F52 B;  4IOO A;  5CUC A;  4NR9 A;  3RCW A;  5CQ8 A;  3Q2E A;  2MNZ A;  4N4F A;  4YBS A;  4QSQ A;  4UIT A;  5A82 A;  2EOD A;  2RSD A;  5DLX A;  2KWJ A;  2KGI A;  5FE2 A;  5FDZ A;  5EQ1 A;  5FE4 A;  3U5J A;  3AAD A;  5LJ1 A;  3KV5 A;  5FG6 A;  2MA5 A;  3JVJ A;  4O76 A;  4PCI A;  5FFY A;  4O77 A;  4NUD A;  2YEK A;  5D1M B;  4YYH A;  5FE3 A;  2R0V A;  5HEL A;  5G04 B;  5DKD A;  5CQA A;  1X4U A;  5FE0 A;  1K2F A;  4HXN A;  4DON A;  4O71 A;  4YYI A;  5IGK A;  4A9H A;  5KTU A;  5H9M A;  3UVY A;  5EK9 A;  3HME A;  5I7X A;  5HFQ A;  4YAD A;  3UVD A;  2DX8 A;  5E9K A;  5DKC A;  5KO4 A;  4V3L C;  5EA1 A;  4LZ2 A;  3HCT A;  5E3D A;  2CSY A;  5CUA A;  4XI1 A;  4LZR A;  5D26 A;  3P1D A;  5C7N A;  2XEU A;  4LKA A;  5LCW B;  3S92 A;  4A9O A;  4C67 A;  5I89 A;  3S91 A;  2VJF A;  4XUA A;  5B77 A;  4NN2 A;  4CUU A;  2OSS A;  5F25 A;  4YAB A;  5HLS A;  5IGM A;  4MR3 A;  4Q0O A;  5TB6 A;  5EV9 A;  4TU6 A;  4UIZ A;  5KTW A;  5C89 A;  4HXP A;  2R0S A;  5D3P A;  4ALH A;  4R7E A;  4ZW1 A;  5L98 A;  4TT2 A;  5JI8 A;  4KV4 A;  4YYM A;  4UIW A;  5I40 A;  2R10 A;  5TDW A;  4UP0 A;  4TS8 A;  4QC1 A;  4O7A A;  4QSR A;  4QBM A;  4A49 A;  3JVM A;  5EGU A;  4O72 A;  3P1C A;  4QYL A;  4YY4 A;  1E6I A;  2I7K A;  2H0D A;  1WEO A;  3JVL A;  4ZUX U;  4AP4 A;  2RO1 A;  5HJC A;  3C6W A;  4XY9 A;  5B8D A;  4YC9 A;  3HTK C;  3HMF A;  5CRM A;  4MR4 A;  4HXM A;  5E74 A;  4QZS A;  2CKL B;  2HDP A;  2YYR A;  2ECV A;  4TZ2 A;  4LYS A;  4HXR A;  4XYA A;  3LQI A;  3KV6 A;  2OXQ C;  2VPE A;  5JG6 A;  5E9M A;  5HQ7 A;  4UYF B;  2M6M A;  2VPB A;  4ZDT A;  5EI4 A;  5DLZ A;  4R2Y A;  4GPJ A;  4QNS A;  4NQM A;  4IR6 A;  5DKH A;  5E9L A;  5D25 A;  5DYU A;  4O7E A;  5C13 A;  1IYM A;  3U5K A;  4I7B A;  4YYN A;  1JM7 B;  5D3N A;  4QC3 A;  2JMI A;  4AYC A;  5EP7 A;  2K16 A;  3V43 A;  4BBQ A;  5TBN A;  4AVX A;  2MT5 A;  2MD7 B;  5CUB A;  5EVA A;  2HYE D;  4CLB A;  5LJ2 A;  2E6S A;  2YDW A;  3U5N A;  4QUT A;  5KH7 A;  4NR6 A;  5H1T A;  1DVP A;  5DYA A;  5A5Q A;  4R8P K;  4ZQL A;  2OO1 A;  2VPD A;  2YYN A;  4NR8 A;  5DX4 A;  5D0C A;  5C85 A;  2M3H A;  4FLP A;  5G4R A;  5FB1 A;  5ENE A;  3LJW A;  3SOU A;  2F6J A;  3ASL A;  3O37 A;  4CA1 A;  5CTL A;  5HRV A;  1WE9 A;  4FO9 A;  5E3G A;  5A5O A;  3N9O A;  4FK5 A;  5KHM A;  5CS8 A;  2KWN A;  1WEV A;  2RNX A;  2L85 A;  4J0S A;  3UV5 A;  1LDK C;  2UZG A;  5II1 A;  4CUP A;  5EPS A;  3SOX A;  4CFK A;  2G4A A;  5CFW A;  2ECJ A;  5ENG A;  3QZS A;  1WEU A;  5D24 A;  4CUR A;  2MIQ A;  4MEQ A;  5EYA F;  4NYX A;  4OGJ A;  4WZ3 B;  5FFW A;  4Y03 A;  5F62 A;  5A5N A;  4MR6 A;  4BJX A;  4LAD B;  3M99 A;  5L8T A;  5EWD A;  5JWM A;  5DFD A;  4A9J A;  5FH7 A;  5II2 A;  2L80 A;  4FJC A;  3P1F A;  4N4G A;  5D3T A;  4TT6 A;  4N4I A;  4J0R A;  1U6G B;  3FL2 A;  5LJ0 A;  4QSX A;  1F62 A;  4YK0 A;  1VYX A;  2VJE B;  3N9Q A;  3DQV R;  3DAI A;  5ENB A;  5H1U A;  5FFV A;  1WFK A;  5B75 A;  3UV2 A;  3O34 A;  5AMF A;  5E0R A;  3O35 A;  4WHW A;  5FE1 A;  3UVW A;  3UW9 A;  5D3R A;  3O70 A;  4GB0 A;  5D3L A;  4Z1Q A;  1WEE A;  2M1R A;  2ECI A;  3C5K A;  5ETD A;  5C4Q A;  5I86 A;  5LUU A;  2D82 A;  4S3O B;  3U5O A;  4QST A;  5D3J A;  2I50 A;  5D1K B;  4QEV A;  3ZNI A;  5G0F A;  5F36 A;  5TRB A;  5IBN A;  2D8S A;  5CPE A;  3MUK A;  5I29 A;  2K17 A;  2LGG A;  3KNV A;  4WA6 A;  5TAB A;  3IU5 A;  2L0B A;  2CKL A;  2YEM A;  2E3K A;  5J0D A;  4N3W A;  2XB1 A;  5IGL A;  5BT3 A;  4NXJ A;  2Y1M A;  4PY6 A;  3N9M A;  5ENH A;  4BW4 A;  4O7C A;  5F5Z A;  4UYF A;  2KIZ A;  5HM0 A;  3Q2F A;  4F3I A;  2H60 A;  4S3O C;  2WP2 A;  2I8N A;  3U5L A;  4A9M A;  1XWH A;  5ENC A;  1JM7 A;  1ZBD B;  1WGM A;  3M62 A;  4J3I A;  5LKZ A;  2MA6 A;  2KTB B;  3N9N A;  5DFC A;  4X3G A;  2LSP B;  5FE6 A;  4HBX A;  3EB6 A;  4LYI A;  3SOW A;  5EPR A;  4NYW A;  4UIV A;  2E7O A;  1BOR A;  2AN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...