3O35A

Crystal structure of trim24 phd-bromo complexed with h3(23-31)k27ac peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
183
structure length
178
Chain Sequence
PNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o35A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o35A01
5A7CA 5EICA 1JM4B 3P1FA 4QUUA 4B86C 3Q2EA 5HRWA 4CUQA 2G4AA 5HLSA 4YABA 4FO9A 1WESA 2FUUA 5DYCA 4I7DA 2DWWA 3ZYQA 5JI8A 2C2VS 5HFQA 3IU5A 5A5PA 1N72A 1Z60A 3N9MA 5F36A 4LRGA 3KNVA 2YQLA 3UVYA 2KE1A 2LQ6A 1MM2A 5G0FA 5EM3A 4IR6A 5CTLA 2RFJA 4CLBA 4QYDA 4PTBA 3GG3A 2PNXA 4LYSA 4A4BA 5E9LA 5LKZA 1G25A 5CQ6A 2ECVA 3ZNIA 4LK9A 4NYWA 4Q0NA 3U5PA 1DVPA 3FL2A 4N4FA 5D1MB 4UYFA 2L0BA 4L7XA 2KGGA 5F60A 3D7CA 4QSVA 5II2A 3MXFA 5DYUA 5ENFA 5TCMA 4YBSA 5J0DA 1RMDA 1WIMA 5BT3A 1XWHA 5HRXA 3U5NA 2JMJA 4A49A 2PUYA 5JG6A 5FB1A 4MSXA 2M3HA 4NRCA 5DW1A 5I89A 4N4IA 4QUTA 4ZC9A 4O7EA 5B78A 2LGLA 4UYFB 1FP0A 5FFYA 4LJNA 3RTRB 4AYCA 2YYNA 4MENA 5E3GA 3P5OA 5KH3A 4YYJA 4XUBA 4IOQA 4DONA 5EI4A 2QICA 5B75A 4TZ8A 5DYXA 4QF3A 4MEOA 3ZVZB 3LQJA 2KWOA 3IU6A 1K2FA 4TU6A 5F5ZA 3QZTA 4CURA 2RNXA 4I7BA 5DFDA 4NR9A 5DBMA 4J1PA 5FE5A 5C11A 4QSSA 5TDRA 2DATA 4YYKA 5L8UA 3ZTGA 5IBNA 2LDRA 4QSWA 3HMFA 2LSPB 2F42A 5LCWB 4YC9A 5EWCA 1WENA 5D25A 4UYEA 1WEQA 5B77A 5HQ7A 4BJXA 1BORA 4MR4A 1VYXA 4QSRA 3UV5A 2ECWA 1N87A 4C66A 4MVTA 3U5KA 2N9GA 4YK0A 2BAYA 5CUGA 4YH3A 4LYIA 4LZRA 4Z6HA 1WFKA 3PUQA 2VPBA 4LC2A 5A83A 4NR7A 4OGIA 2QJ0A 4OUFA 5FH6A 4O7BA 5FFWA 2HDPA 5FE0A 5H1VA 1T1HA 4PKLA 3SOXA 5G05B 4YYDA 5EISA 4GNGA 4WZ0A 5E9KA 4LYWA 2L5UA 3P1EA 2M1RA 2E6RA 3SOUA 4QR5A 3ZPV1 2MUMA 3MQMA 2WP2A 2KR4A 1WE9A 4LR6A 4HXPA 4PPEA 5D3HA 4FLPA 2R0YA 1CHCA 1EQFA 4A9EA 2ECNA 3ZYUA 2ZETC 5HQ5A 2VPDA 3ZVYA 2L80A 5FDZA 5HQ6A 4ZDTA 4LZ2A 1MM3A 4QR3A 4R2YA 5CUCA 5CUDA 5CQ5A 4A4CA 2EODA 2MIQA 5KU3A 3O35A 2Y1NA 2I7KA 5I80A 5FH8A 4NR4A 2OSSA 5II1A 5IGNA 3P1DA 3ASLA 4UYDA 4I7CA 4B7YC 5EWDA 2JMIA 3U5MA 5EPBA 2DKWA 3DAIA 5CQAA 5HFRA 4A9LA 2VJEA 5FE2A 1WEWA 3T7LA 1WILA 5C13A 5I3LA 4QBMA 4YYGA 3O7AA 4O72A 2YEKA 2YSJA 5G04B 5TB6A 3LJWA 2R0SA 4UP5A 5CRZA 2FUIA 3N9OA 5CUAA 5D3PA 4Y03A 4ALGA 2LGVA 3NG2A 5EYAF 4XY9A 5D0CA 4A9IA 3MUKA 4LLBA 3UVXA 5AMEA 2VJEB 5C89A 4A9FA 5DLZA 5ETBA 4YATA 2RNYA 2LN0A 5LVQA 5KTWA 5A5SA 4XY8A 4S3OC 4XI1A 4NN2A 5CUEA 5G4SA 2KTBB 3SVHA 5F25A 2JMDA 3VK6A 1U6GB 5HELA 3N9PA 3O34A 5DX4A 3SVGA 4UP0A 5E73A 5CQ8A 4CCGX 3O36A 5ETDA 5AD2A 4BW2A 5F2PA 4NRBA 4OGJA 2H0DA 2KWNA 5E9MA 2I50A 1WGMA 4X2IA 5D3TA 3G0JA 3G0LA 1JOCA 2YHNA 1LDJB 4IC3A 1F68A 3RPGC 2G6QA 1E4UA 5IGLA 2L43A 4XYAA 5LKTA 3MULA 5D3NA 3SOWA 3M63A 4PCEA 1Z6UA 5HENA 3HMHA 5FE3A 4QC3A 2ECTA 2DVRA 5EV9A 3QZSA 4HXNA 4TT6A 3I3JA 5B79A 5E0RA 4Z93A 5TBNA 5CU8A 4GNDA 4YADA 4LDFA 5A5RA 2LGGA 2OUOA 5G4RA 5DKHA 2MD7B 2YT5A 2DX8A 4IC2A 1IYMA 1HYIA 4F3IA 2MT5A 2KIZA 3QZVA 4ZQLA 2G43A 5AIUA 3C5KA 2CKLA 5CPEA 5A85A 5FG5A 3UVDA 4A9NA 2ECJA 5J3XA 2UZGA 5CGPA 4O74A 4F52B 3Q2FA 4AYCB 2YELA 4BW4A 2MNYA 3HCUA 4A9OA 2JRJA 2LXPC 3GL6A 5A81A 2L84A 4YY6A 4YH4A 4V3KC 4WZ2A 2EA6A 3PHDA 5CQ4A 4HBYA 5A5QA 2KGIA 5IGKA 3RPGB 4YBTA 4O71A 5H1TA 5A5OA 5AD3A 2E6SA 3TLPA 4QYLA 1WEOA 5DINA 3M99A 5EWWA 4HXOA 2M85A 2RSDA 3HCSA 3HMEA 5EU1A 4YBMA 2DVQA 5C8GA 4TTEA 4LZSA 4IR3A 1X4JA 2DVSA 2LXHC 5CZGA 2E3KA 4L58A 2M6MA 2YREA 4WHWA 5HRVA 5E74A 2R10A 3S91A 5I88A 2NAAA 4O7AA 3AQAA 3DWYA 2MNZA 4Q0OA 2VP7A 4WIVA 5COIA 5CY9A 3FKMX 5ENCA 3SVFA 5LVRA 4GNFA 4YY4A 4MR5A 2E7NA 4LADB 5KH7A 2D82A 3O37A 5D7XA 5DYAA 4A9JA 4NYVA 2IDAA 5I7XA 4NYXA 5CS8A 5L8TA 1X4IA 2K1JA 5D3RA 5LUUA 2E7OA 2XB1A 2YW8A 4MEPA 5FE8A 1VFYA 2Y43A 3LXJA 4NXJA 2YYRA 5C87A 3L1ZB 5DKCA 4YYHA 3K2JA 5FE4A 5D3SA 4MEQA 4X3GA 4QF2A 2WP1A 4O70A 3ONIA 3U5LA 2YSMA 3N9NA 5D1KB 2NXBA 5H85A 2L85A 4Z1QA 1Z2QA 5EA1A 4QC1A 4QSQA 5E3DA 2LRIC 2R0VA 2YDWA 5ENIA 4RVRA 3U5OA 2QIZA 3HTKC 2I8NA 2ECGA 4V3LC 4QNSA 4A0CD 3U5JA 2VJFA 4O75A 3DQVR 2ECIA 5ENBA 5EWHA 4BW1A 4CL9A 4QSPA 4XUAA 5HEMA 4P5OB 5FE6A 4R7EA 4QSUA 5C4QA 5EVAA 5F1HA 4ZW1A 1V87A 5KTXA 1FBVA 2VNFA 4FIPA 2CSYA 5FB0A 5L98A 5BT4A 1X4UA 4J3IA 2F6NA 3JVJA 4NR6A 4ZUXU 4GB0A 4R8PK 2AN6A 5CP5A 4NR8A 5E9VA 2Y1MA 5EPSA 2FSAA 4TQNA 4YAXA 4IOOA 5FE1A 5A5NA 3V43A 3PURA 4Q6FA 4ALHA 1ZS5A 3JVLA 4BBQA 5CQTA 5AITA 4QEWA 5H9MA 4WHUA 5I83A 2MD8C 2RS9B 2C2LA 5D26A 2KREA 3DPLR 5FG6A 4O77A 5F1LA 5KHMA 3UV4A 5CUBA 4BHWA 3KQIA 4O64A 2RNWA 3C6WA 4J0SA 4QY4A 5EPRA 4FK5A 5TDWA 4NR5A 5FG4A 1JSPB 4UYGA 4UIVA 5HJCA 5A82A 4NQMA 3UVWA 5E9YA 5H1UA 4NUDA 2XEUA 3UV2A 4UIZA 5FE7A 2YW5A 4KCXA 4CFKA 3NXBA 4NS5A 4QZSA 5I1QA 2H0DB 4A9MA 4PY6A 5F3AA 5IGMA 3SHBA 4PCIA 4QEUA 4A9KA 1HYJA 2K16A 4QB3A 5D3JA 4N3WA 4O76A 5FFVA 5LKUA 5I7YA 3GV4A 4YYMA 4HBVA 5ACYA 3L1XA 4BW3A 5CRMA 4GPJA 4N4GA 3L11A 2D9EA 2MA5A 4TZ2A 5JWMA 3KV6A 5HCLA 1VD4A 2OO1A 4O7FA 2CSZA 5B76A 5LJ2A 4NRAA 3I2DA 3MB4A 4J0RA 4S3OB 2MJVB 4KV1A 3T6RA 4HBWA 5D24A 4QEVA 4TYLA 5CFWA 4TU4A 4HXRA 4UIWA 4HXSA 5EK9A 2YURA 4IR4A 3N9LA 3JVKA 3EB5A 3O70A 1WUMA 4O7CA 4UITA 4YYIA 4IR5A 5C85A 1WUGA 2CKLB 5I29A 2H60A 2VPGA 4CUUA 3JVMA 3LQIA 5EQ1A 3LQHA 3UW9A 4AUQB 2G45A 5DKAA 2K4DA 4LKAA 1ZBDB 3AADA 5KH9A 5IIDA 2HYED 4AVXA 1WEMA 4CUPA 5FE9A 4NUEA 5DY7A 4C67A 4QSXA 5I40A 5E9IA 4Z6IA 4QR4A 4YYNA 5HM0A 5EWVA 5FH7A 5LJ0A 5L97A 4HBXA 2K17A 2CT2A 4UIUA 3MB3A 4WZ3B 4CA1A 1WEPA 5L96A 5TABA 2RO1A 3KV5A 5IG6A 4O78A 5AMFA 5ENGA 5KTUA 2KYUA 4C9ZA 2L5EA 2YHOA 5K29A 5TRBA 5L99A 4E96A 5F62A 2YEMA 1LDKC 2OXQC 5I86A 2KU3A 5EGUA 2LV9A 4TS8A 4GNEA 4NQNA 5F61A 2MA6A 4TT2A 5DFCA 4Z1SA 5DFBA 5ENEA 2L75A 2YUCA 3IHPA 1JM7A 4HXKA 2YQMA 2KFTA 3ZPVE 2YU4A 4UIXA 4WA6A 5D1LB 3RCWA 1F62A 3P1CA 5C7NA 5D3LA 4TT4A 4IORA 2KWJA 5DKDA 4CUSA 4CUTA 2VPEA 4QSTA 1JM7B 5F63A 2D8SA 1X0JA 5CQ3A 3O33A 5LJ1A 2RI7A 2F6JA 5KO4A 4N4HA 4KV4A 4AKNA 4TKPB 4MR3A 5DW2A 3MHHA 5EP7A 1WEVA 5ENHA 3M62A 3N9QA 4PS5A 4UYHA 5BT5A 4CFLA 5CQ7A 5DLXA 5E7DA 2LGKA 4FJCA 5B8DA 5FBXA 1WEEA 5LKXA 4NUCA 1E6IA 3HCTA 4UI9B 1WEUA 4A9HA 2EGPA 4W4UA 4HXMA 3MHSA 5FERA 3EB6A 2VJFB 3S92A 5ENJA 4MR6A 4UIYA 2YQDA 3LRQA 4AP4A 2DVVA 2GRCA 2KWKA 5FEYA 4HXLA
chains in the Genus database with same CATH superfamily
5A7CA 5EICA 1JM4B 3P1FA 4QUUA 4B86C 3Q2EA 5HRWA 4CUQA 2G4AA 5HLSA 4YABA 4FO9A 1WESA 2FUUA 4AKIA 5DYCA 3PLWA 4I7DA 2DWWA 3ZYQA 2DJAA 5JI8A 2C2VS 5HFQA 3IU5A 3DDTA 5A5PA 1DCQA 1N72A 1Z60A 3ZVYA 3N9MA 5F36A 4LRGA 3KNVA 2YQLA 3UVYA 2KE1A 2LQ6A 1MM2A 5G0FA 5EM3A 4IR6A 5CTLA 2XOCA 2RFJA 4CLBA 4QYDA 4PTBA 3GG3A 2PNXA 4LYSA 4A4BA 5E9LA 5LKZA 1G25A 5CQ6A 2ECVA 3ZNIA 4LK9A 4NYWA 4Q0NA 3U5PA 1DVPA 3FL2A 4N4FA 5D1MB 4UYFA 2L0BA 4L7XA 2KGGA 5F60A 3D7CA 4QSVA 5II2A 3MXFA 5DYUA 3D1DA 5ENFA 5TCMA 4YBSA 5J0DA 1RMDA 5BT3A 1WIMA 5HRXA 3U5NA 2JMJA 4A49A 4QQ4A 2PUYA 5JG6A 5FB1A 2IQJA 3LDYA 4MSXA 2M3HA 4NRCA 5DW1A 5SVXA 5I89A 4N4IA 4QUTA 4ZC9A 4O7EA 5B78A 2LGLA 4UYFB 1FP0A 5FFYA 4LJNA 3RTRB 4AYCA 2YYNA 4MENA 5E3GA 3P5OA 2RR4A 5KH3A 4YYJA 4XUBA 4IOQA 4DONA 5EI4A 2QICA 5B75A 4TZ8A 5DYXA 4QF3A 4MEOA 3ZVZB 3LQJA 2KWOA 3IU6A 1K2FA 4TU6A 5F5ZA 3QZTA 4CURA 2RNXA 4I7BA 5DFDA 4NR9A 5DBMA 4J1PA 5FE5A 5C11A 4QSSA 5TDRA 2DATA 4YYKA 5L8UA 3ZTGA 5IBNA 2LDRA 4QSWA 3HMFA 2LSPB 2F42A 5LCWB 4YC9A 5EWCA 1WENA 5D25A 4UYEA 1WEQA 5B77A 5HQ7A 4BJXA 1BORA 4MR4A 1VYXA 4QSRA 3UV5A 2ECWA 2LAUA 1N87A 4C66A 4MVTA 3U5KA 3MDBC 2N9GA 4YK0A 2BAYA 5CUGA 4YH3A 4LYIA 4LZRA 4Z6HA 1WFKA 3PUQA 5SVIA 3M7KA 4OGCA 2VPBA 4LC2A 5A83A 4NR7A 4OGIA 2QJ0A 4OUFA 5FH6A 4O7BA 5FFWA 2HDPA 5FE0A 5H1VA 1T1HA 4PKLA 3SOXA 3FJUB 5G05B 4YYDA 5EISA 4GNGA 4WZ0A 5E9KA 4LYWA 2L5UA 3P1EA 2M1RA 2E6RA 3LVRE 5K3QA 3SOUA 3T9KA 4QR5A 3ZPV1 2MUMA 3MQMA 2WP2A 2KR4A 1WE9A 4LR6A 4HXPA 4PPEA 5D3HA 4FLPA 2R0YA 1CHCA 1EQFA 4A9EA 2ECNA 3ZYUA 2ZETC 5HQ5A 2VPDA 3D1BA 2L80A 5FDZA 5HQ6A 4ZDTA 4LZ2A 1MM3A 4QR3A 2XOYA 4R2YA 5CUCA 5CUDA 5CQ5A 4A4CA 2EODA 2L7PA 2MIQA 5KU3A 3O35A 2Y1NA 2I7KA 5I80A 5FH8A 4NR4A 2OSSA 5II1A 5IGNA 3P1DA 3ASLA 4UYDA 4I7CA 4B7YC 3JUEA 5EWDA 2JMIA 3U5MA 5EPBA 2DKWA 3DAIA 5CQAA 5HFRA 4A9LA 2VJEA 5FE2A 1WEWA 3T7LA 1WILA 5C13A 5I3LA 4QBMA 4YYGA 3O7AA 4O72A 2YEKA 2YSJA 5G04B 5TB6A 3LJWA 2R0SA 4UP5A 5CRZA 2FUIA 3N9OA 5CUAA 5D3PA 4Y03A 4ALGA 2LGVA 3NG2A 5EYAF 4XY9A 5D0CA 4A9IA 3MUKA 4LLBA 3UVXA 5AMEA 2VJEB 5C89A 4A9FA 5DLZA 5ETBA 4YATA 2RNYA 2LN0A 5LVQA 5KTWA 5A5SA 4XY8A 4S3OC 4XI1A 4NN2A 5CUEA 5G4SA 2KTBB 3SVHA 5F25A 2JMDA 3VK6A 1U6GB 5HELA 3N9PA 3O34A 5DX4A 3SVGA 4UP0A 5E73A 5CQ8A 2DSMA 4CCGX 3O36A 5ETDA 5AD2A 4BW2A 5F2PA 4NRBA 4OGJA 2H0DA 2KWNA 5E9MA 2I50A 1WGMA 4X2IA 5D3TA 3G0JA 3G0LA 1JOCA 2YHNA 1LDJB 4IC3A 1F68A 3RPGC 2EXUA 2G6QA 1E4UA 5IGLA 2L43A 4XYAA 5LKTA 3MULA 5D3NA 3SOWA 3M63A 3FAOA 4PCEA 1Z6UA 5HENA 3HMHA 5FE3A 4QC3A 2ECTA 2DVRA 5EV9A 3QZSA 2FFWA 4HXNA 4TT6A 3I3JA 5B79A 5E0RA 4Z93A 5TBNA 5CU8A 4GNDA 4YADA 4LDFA 5A5RA 2LGGA 2OUOA 5G4RA 5DKHA 2MD7B 2KKYA 2YT5A 2DX8A 4IC2A 1IYMA 1HYIA 4F3IA 2MT5A 2KIZA 3QZVA 4ZQLA 2G43A 5AIUA 3C5KA 2CKLA 2CRRA 5CPEA 5A85A 5FG5A 3UVDA 4A9NA 2ECJA 5J3XA 2UZGA 5CGPA 4O74A 4F52B 3Q2FA 4AYCB 2YELA 4OGEA 4BW4A 2MNYA 3HCUA 4A9OA 2JRJA 2LXPC 3GL6A 5A81A 2L84A 2CSVA 4YY6A 4YH4A 4AI6A 4V3KC 2EGMA 2EA6A 3PHDA 5CQ4A 4HBYA 5A5QA 1XWHA 4WZ2A 2KGIA 5IGKA 3RPGB 4YBTA 4O71A 5H1TA 5A5OA 5AD3A 3E2DA 2E6SA 4F1PA 3TLPA 4QYLA 1WEOA 5DINA 3M99A 5EWWA 4HXOA 2M85A 2JUNA 2RSDA 3HCSA 3LVQE 3HMEA 5EU1A 4YBMA 2DVQA 5C8GA 4TTEA 4LZSA 4IR3A 4Z0OA 2M13A 1X4JA 2DVSA 2LXHC 5CZGA 2E3KA 4L58A 2M6MA 2YREA 4WHWA 5HRVA 5E74A 2R10A 3S91A 5I88A 2NAAA 4O7AA 3AQAA 3DWYA 5SVIB 2MNZA 4Q0OA 2VP7A 4WIVA 5COIA 5CY9A 3FKMX 2KKXA 5ENCA 3SVFA 5LVRA 4GNFA 4YY4A 4MR5A 2E7NA 4LADB 5KH7A 2D82A 3O37A 5D7XA 5DYAA 4A9JA 4NYVA 2IDAA 5I7XA 4NYXA 5CS8A 5L8TA 1X4IA 2K1JA 5D3RA 5LUUA 2E7OA 2P57A 2XB1A 2YW8A 3KDEC 4MEPA 4O62A 5FE8A 1VFYA 2Y43A 3LXJA 4NXJA 2YYRA 5C87A 2E61A 5DKCA 4YYHA 3L1ZB 3K2JA 3ERRA 5FE4A 5D3SA 4MEQA 4X3GA 4QF2A 2WP1A 4O70A 3ONIA 3U5LA 2YSMA 3N9NA 5D1KB 2NXBA 5H85A 2L85A 4Z1QA 1Z2QA 5EA1A 4QC1A 4QSQA 5E3DA 2LRIC 2R0VA 2YDWA 5ENIA 4RVRA 3U5OA 3VKHA 2QIZA 2I8NA 2ECGA 2XP0A 4QNSA 3HTKC 4V3LC 4A0CD 3U5JA 2VJFA 4O75A 3DQVR 2ECIA 2XOZA 5ENBA 5EWHA 4BW1A 4CL9A 4QSPA 4XUAA 5HEMA 4P5OB 5FE6A 4R7EA 4QSUA 5C4QA 5EVAA 5F1HA 4ZW1A 1V87A 5KTXA 1FBVA 2VNFA 4FIPA 2CSYA 5FB0A 5L98A 5BT4A 1X4UA 4J3IA 2F6NA 3JVJA 4NR6A 4ZUXU 4GB0A 4R8PK 2AN6A 5CP5A 4NR8A 5E9VA 2Y1MA 3FANA 5EPSA 2CRWA 2FSAA 3FEHA 4TQNA 4YAXA 4IOOA 5FE1A 5A5NA 3V43A 3PURA 4Q6FA 4ALHA 1ZS5A 3JVLA 4BBQA 5CQTA 5SVYA 5AITA 4QEWA 5H9MA 4WHUA 5I83A 2MD8C 2RS9B 1PUOA 5D26A 2C2LA 2KREA 3DPLR 5FG6A 4O77A 5F1LA 5KHMA 3UV4A 3VKGA 5CUBA 4BHWA 2B0OE 3KQIA 4O64A 2RNWA 3C6WA 4J0SA 4QY4A 5EPRA 3FM8C 4FK5A 4AKHA 5TDWA 4NR5A 5FG4A 1JSPB 4UYGA 4UIVA 5HJCA 5A82A 4NQMA 3UVWA 5E9YA 5H1UA 4NUDA 2XEUA 3UV2A 4UIZA 5FE7A 2YW5A 4KCXA 4CFKA 3NXBA 4NS5A 4QZSA 5I1QA 2H0DB 4A9MA 4PY6A 3DWDA 5F3AA 5IGMA 3SHBA 4PCIA 4QEUA 4A9KA 1HYJA 2K16A 4QB3A 5D3JA 4N3WA 4O76A 5FFVA 5LKUA 5I7YA 3GV4A 4YYMA 4HBVA 5ACYA 3L1XA 4BW3A 5CRMA 4GPJA 4N4GA 3L11A 2D9EA 2MA5A 4TZ2A 5JWMA 3KV6A 5HCLA 1VD4A 2OO1A 4O7FA 2CSZA 5B76A 5LJ2A 4NRAA 4AKGA 3I2DA 3MB4A 4J0RA 4S3OB 2MJVB 4KV1A 3T6RA 4HBWA 5D24A 4QEVA 4TYLA 5CFWA 4TU4A 4HXRA 3SUBA 4UIWA 4HXSA 5EK9A 2EJNA 2YURA 4IR4A 3N9LA 3JVKA 3EB5A 3O70A 1WUMA 4O7CA 4UITA 4YYIA 4IR5A 5C85A 1WUGA 2CKLB 5I29A 2H60A 2VPGA 4CUUA 3JVMA 3O47A 3LQIA 5EQ1A 3LQHA 3UW9A 4AUQB 2G45A 5DKAA 2K4DA 4LKAA 1ZBDB 3AADA 5KH9A 5IIDA 2HYED 4AVXA 1WEMA 4CUPA 5FE9A 4NUEA 5DY7A 4C67A 4QSXA 5I40A 5E9IA 4Z6IA 4QR4A 4YYNA 5HM0A 5EWVA 5FH7A 5LJ0A 3Q1DA 5L97A 4HBXA 2K17A 2CT2A 4UIUA 3MB3A 4WZ3B 3LJUX 4CA1A 1WEPA 5L96A 5TABA 2RO1A 3KV5A 5IG6A 4O78A 5AMFA 5ENGA 5KTUA 2KYUA 4C9ZA 2L5EA 2YHOA 5K29A 5TRBA 5L99A 4E96A 5F62A 2YEMA 1LDKC 2OXQC 5I86A 2KU3A 5EGUA 2LV9A 4TS8A 4GNEA 4H9DA 4NQNA 2OWAA 5F61A 2MA6A 4TT2A 5DFCA 4Z1SA 5DFBA 5ENEA 2L75A 2YUCA 3IHPA 1JM7A 4HXKA 2YQMA 2KFTA 3ZPVE 2YU4A 4UIXA 2CONA 4WA6A 5D1LB 3RCWA 1F62A 3P1CA 5C7NA 5D3LA 4TT4A 4IORA 2KWJA 5DKDA 4CUSA 4CUTA 2D8UA 3H7HA 2VPEA 4QSTA 1JM7B 5F63A 2D8SA 1X0JA 5CQ3A 3O33A 5LJ1A 2RI7A 2F6JA 5KO4A 4N4HA 4KV4A 4AKNA 2FD4A 4TKPB 4MR3A 5DW2A 3MHHA 5EP7A 1WEVA 5ENHA 3M62A 3N9QA 2JM3A 4PS5A 4UYHA 5BT5A 4CFLA 5CQ7A 5DLXA 5E7DA 1MBMA 2LGKA 4FJCA 5B8DA 5FBXA 1WEEA 5LKXA 4NUCA 1E6IA 3HCTA 4UI9B 4Z0RA 1WEUA 4A9HA 2EGPA 4W4UA 4HXMA 3MHSA 5FERA 3EB6A 2VJFB 2YVRA 3S92A 1ZKRA 5ENJA 2MKEA 4MR6A 4UIYA 2YQDA 3LRQA 4AP4A 2DVVA 2GRCA 2KWKA 5FEYA 4HXLA
chains in the Genus database with same CATH topology
5A7CA 5EICA 1JM4B 3P1FA 4QUUA 4B86C 3Q2EA 5HRWA 4CUQA 2G4AA 5HLSA 4YABA 4FO9A 1WESA 2FUUA 5DYCA 4I7DA 2DWWA 3ZYQA 5JI8A 2C2VS 5HFQA 3IU5A 5A5PA 1N72A 1Z60A 3N9MA 5F36A 4LRGA 3KNVA 2YQLA 3UVYA 2KE1A 2LQ6A 1MM2A 5G0FA 5EM3A 4IR6A 5CTLA 2RFJA 4CLBA 4QYDA 4PTBA 3GG3A 2PNXA 4LYSA 4A4BA 5E9LA 5LKZA 1G25A 5CQ6A 2ECVA 3ZNIA 4LK9A 4NYWA 4Q0NA 3U5PA 1DVPA 3FL2A 4N4FA 5D1MB 4UYFA 2L0BA 4L7XA 2KGGA 5F60A 3D7CA 4QSVA 5II2A 3MXFA 5DYUA 5ENFA 5TCMA 4YBSA 5J0DA 1RMDA 1WIMA 5BT3A 1XWHA 5HRXA 3U5NA 2JMJA 4A49A 2PUYA 5JG6A 5FB1A 4MSXA 2M3HA 4NRCA 5DW1A 5I89A 4N4IA 4QUTA 4ZC9A 4O7EA 5B78A 2LGLA 4UYFB 1FP0A 5FFYA 4LJNA 3RTRB 4AYCA 2YYNA 4MENA 5E3GA 3P5OA 5KH3A 4YYJA 4XUBA 4IOQA 4DONA 5EI4A 2QICA 5B75A 4TZ8A 5DYXA 4QF3A 4MEOA 3ZVZB 3LQJA 2KWOA 3IU6A 1K2FA 4TU6A 5F5ZA 3QZTA 4CURA 2RNXA 4I7BA 5DFDA 4NR9A 5DBMA 4J1PA 5FE5A 5C11A 4QSSA 5TDRA 2DATA 4YYKA 5L8UA 3ZTGA 5IBNA 2LDRA 4QSWA 3HMFA 2LSPB 2F42A 5LCWB 4YC9A 5EWCA 1WENA 5D25A 4UYEA 1WEQA 5B77A 5HQ7A 4BJXA 1BORA 4MR4A 1VYXA 4QSRA 3UV5A 2ECWA 1N87A 4C66A 4MVTA 3U5KA 2N9GA 4YK0A 2BAYA 5CUGA 4YH3A 4LYIA 4LZRA 4Z6HA 1WFKA 3PUQA 2VPBA 4LC2A 5A83A 4NR7A 4OGIA 2QJ0A 4OUFA 5FH6A 4O7BA 5FFWA 2HDPA 5FE0A 5H1VA 1T1HA 4PKLA 3SOXA 5G05B 4YYDA 5EISA 4GNGA 4WZ0A 5E9KA 4LYWA 2L5UA 3P1EA 2M1RA 2E6RA 3SOUA 4QR5A 3ZPV1 2MUMA 3MQMA 2WP2A 2KR4A 1WE9A 4LR6A 4HXPA 4PPEA 5D3HA 4FLPA 2R0YA 1CHCA 1EQFA 4A9EA 2ECNA 3ZYUA 2ZETC 5HQ5A 2VPDA 3ZVYA 2L80A 5FDZA 5HQ6A 4ZDTA 4LZ2A 1MM3A 4QR3A 4R2YA 5CUCA 5CUDA 5CQ5A 4A4CA 2EODA 2MIQA 5KU3A 3O35A 2Y1NA 2I7KA 5I80A 5FH8A 4NR4A 2OSSA 5II1A 5IGNA 3P1DA 3ASLA 4UYDA 4I7CA 4B7YC 5EWDA 2JMIA 3U5MA 5EPBA 2DKWA 3DAIA 5CQAA 5HFRA 4A9LA 2VJEA 5FE2A 1WEWA 3T7LA 1WILA 5C13A 5I3LA 4QBMA 4YYGA 3O7AA 4O72A 2YEKA 2YSJA 5G04B 5TB6A 3LJWA 2R0SA 4UP5A 5CRZA 2FUIA 3N9OA 5CUAA 5D3PA 4Y03A 4ALGA 2LGVA 3NG2A 5EYAF 4XY9A 5D0CA 4A9IA 3MUKA 4LLBA 3UVXA 5AMEA 2VJEB 5C89A 4A9FA 5DLZA 5ETBA 4YATA 2RNYA 2LN0A 5LVQA 5KTWA 5A5SA 4XY8A 4S3OC 4XI1A 4NN2A 5CUEA 5G4SA 2KTBB 3SVHA 5F25A 2JMDA 3VK6A 1U6GB 5HELA 3N9PA 3O34A 5DX4A 3SVGA 4UP0A 5E73A 5CQ8A 4CCGX 3O36A 5ETDA 5AD2A 4BW2A 5F2PA 4NRBA 4OGJA 2H0DA 2KWNA 5E9MA 2I50A 1WGMA 4X2IA 5D3TA 3G0JA 3G0LA 1JOCA 2YHNA 1LDJB 4IC3A 1F68A 3RPGC 2G6QA 1E4UA 5IGLA 2L43A 4XYAA 5LKTA 3MULA 5D3NA 3SOWA 3M63A 4PCEA 1Z6UA 5HENA 3HMHA 5FE3A 4QC3A 2ECTA 2DVRA 5EV9A 3QZSA 4HXNA 4TT6A 3I3JA 5B79A 5E0RA 4Z93A 5TBNA 5CU8A 4GNDA 4YADA 4LDFA 5A5RA 2LGGA 2OUOA 5G4RA 5DKHA 2MD7B 2YT5A 2DX8A 4IC2A 1IYMA 1HYIA 4F3IA 2MT5A 2KIZA 3QZVA 4ZQLA 2G43A 5AIUA 3C5KA 2CKLA 5CPEA 5A85A 5FG5A 3UVDA 4A9NA 2ECJA 5J3XA 2UZGA 5CGPA 4O74A 4F52B 3Q2FA 4AYCB 2YELA 4BW4A 2MNYA 3HCUA 4A9OA 2JRJA 2LXPC 3GL6A 5A81A 2L84A 4YY6A 4YH4A 4V3KC 4WZ2A 2EA6A 3PHDA 5CQ4A 4HBYA 5A5QA 2KGIA 5IGKA 3RPGB 4YBTA 4O71A 5H1TA 5A5OA 5AD3A 2E6SA 3TLPA 4QYLA 1WEOA 5DINA 3M99A 5EWWA 4HXOA 2M85A 2RSDA 3HCSA 3HMEA 5EU1A 4YBMA 2DVQA 5C8GA 4TTEA 4LZSA 4IR3A 1X4JA 2DVSA 2LXHC 5CZGA 2E3KA 4L58A 2M6MA 2YREA 4WHWA 5HRVA 5E74A 2R10A 3S91A 5I88A 2NAAA 4O7AA 3AQAA 3DWYA 2MNZA 4Q0OA 2VP7A 4WIVA 5COIA 5CY9A 3FKMX 5ENCA 3SVFA 5LVRA 4GNFA 4YY4A 4MR5A 2E7NA 4LADB 5KH7A 2D82A 3O37A 5D7XA 5DYAA 4A9JA 4NYVA 2IDAA 5I7XA 4NYXA 5CS8A 5L8TA 1X4IA 2K1JA 5D3RA 5LUUA 2E7OA 2XB1A 2YW8A 4MEPA 5FE8A 1VFYA 2Y43A 3LXJA 4NXJA 2YYRA 5C87A 3L1ZB 5DKCA 4YYHA 3K2JA 5FE4A 5D3SA 4MEQA 4X3GA 4QF2A 2WP1A 4O70A 3ONIA 3U5LA 2YSMA 3N9NA 5D1KB 2NXBA 5H85A 2L85A 4Z1QA 1Z2QA 5EA1A 4QC1A 4QSQA 5E3DA 2LRIC 2R0VA 2YDWA 5ENIA 4RVRA 3U5OA 2QIZA 3HTKC 2I8NA 2ECGA 4V3LC 4QNSA 4A0CD 3U5JA 2VJFA 4O75A 3DQVR 2ECIA 5ENBA 5EWHA 4BW1A 4CL9A 4QSPA 4XUAA 5HEMA 4P5OB 5FE6A 4R7EA 4QSUA 5C4QA 5EVAA 5F1HA 4ZW1A 1V87A 5KTXA 1FBVA 2VNFA 4FIPA 2CSYA 5FB0A 5L98A 5BT4A 1X4UA 4J3IA 2F6NA 3JVJA 4NR6A 4ZUXU 4GB0A 4R8PK 2AN6A 5CP5A 4NR8A 5E9VA 2Y1MA 5EPSA 2FSAA 4TQNA 4YAXA 4IOOA 5FE1A 5A5NA 3V43A 3PURA 4Q6FA 4ALHA 1ZS5A 3JVLA 4BBQA 5CQTA 5AITA 4QEWA 5H9MA 4WHUA 5I83A 2MD8C 2RS9B 2C2LA 5D26A 2KREA 3DPLR 5FG6A 4O77A 5F1LA 5KHMA 3UV4A 5CUBA 4BHWA 3KQIA 4O64A 2RNWA 3C6WA 4J0SA 4QY4A 5EPRA 4FK5A 5TDWA 4NR5A 5FG4A 1JSPB 4UYGA 4UIVA 5HJCA 5A82A 4NQMA 3UVWA 5E9YA 5H1UA 4NUDA 2XEUA 3UV2A 4UIZA 5FE7A 2YW5A 4KCXA 4CFKA 3NXBA 4NS5A 4QZSA 5I1QA 2H0DB 4A9MA 4PY6A 5F3AA 5IGMA 3SHBA 4PCIA 4QEUA 4A9KA 1HYJA 2K16A 4QB3A 5D3JA 4N3WA 4O76A 5FFVA 5LKUA 5I7YA 3GV4A 4YYMA 4HBVA 5ACYA 3L1XA 4BW3A 5CRMA 4GPJA 4N4GA 3L11A 2D9EA 2MA5A 4TZ2A 5JWMA 3KV6A 5HCLA 1VD4A 2OO1A 4O7FA 2CSZA 5B76A 5LJ2A 4NRAA 3I2DA 3MB4A 4J0RA 4S3OB 2MJVB 4KV1A 3T6RA 4HBWA 5D24A 4QEVA 4TYLA 5CFWA 4TU4A 4HXRA 4UIWA 4HXSA 5EK9A 2YURA 4IR4A 3N9LA 3JVKA 3EB5A 3O70A 1WUMA 4O7CA 4UITA 4YYIA 4IR5A 5C85A 1WUGA 2CKLB 5I29A 2H60A 2VPGA 4CUUA 3JVMA 3LQIA 5EQ1A 3LQHA 3UW9A 4AUQB 2G45A 5DKAA 2K4DA 4LKAA 1ZBDB 3AADA 5KH9A 5IIDA 2HYED 4AVXA 1WEMA 4CUPA 5FE9A 4NUEA 5DY7A 4C67A 4QSXA 5I40A 5E9IA 4Z6IA 4QR4A 4YYNA 5HM0A 5EWVA 5FH7A 5LJ0A 5L97A 4HBXA 2K17A 2CT2A 4UIUA 3MB3A 4WZ3B 4CA1A 1WEPA 5L96A 5TABA 2RO1A 3KV5A 5IG6A 4O78A 5AMFA 5ENGA 5KTUA 2KYUA 4C9ZA 2L5EA 2YHOA 5K29A 5TRBA 5L99A 4E96A 5F62A 2YEMA 1LDKC 2OXQC 5I86A 2KU3A 5EGUA 2LV9A 4TS8A 4GNEA 4NQNA 5F61A 2MA6A 4TT2A 5DFCA 4Z1SA 5DFBA 5ENEA 2L75A 2YUCA 3IHPA 1JM7A 4HXKA 2YQMA 2KFTA 3ZPVE 2YU4A 4UIXA 4WA6A 5D1LB 3RCWA 1F62A 3P1CA 5C7NA 5D3LA 4TT4A 4IORA 2KWJA 5DKDA 4CUSA 4CUTA 2VPEA 4QSTA 1JM7B 5F63A 2D8SA 1X0JA 5CQ3A 3O33A 5LJ1A 2RI7A 2F6JA 5KO4A 4N4HA 4KV4A 4AKNA 4TKPB 4MR3A 5DW2A 3MHHA 5EP7A 1WEVA 5ENHA 3M62A 3N9QA 4PS5A 4UYHA 5BT5A 4CFLA 5CQ7A 5DLXA 5E7DA 2LGKA 4FJCA 5B8DA 5FBXA 1WEEA 5LKXA 4NUCA 1E6IA 3HCTA 4UI9B 1WEUA 4A9HA 2EGPA 4W4UA 4HXMA 3MHSA 5FERA 3EB6A 2VJFB 3S92A 5ENJA 4MR6A 4UIYA 2YQDA 3LRQA 4AP4A 2DVVA 2GRCA 2KWKA 5FEYA 4HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7C A;  5EIC A;  1JM4 B;  3P1F A;  4QUU A;  4B86 C;  3Q2E A;  5HRW A;  4CUQ A;  2G4A A;  5HLS A;  4YAB A;  4FO9 A;  1WES A;  2FUU A;  5DYC A;  4I7D A;  2DWW A;  3ZYQ A;  5JI8 A;  2C2V S;  5HFQ A;  3IU5 A;  5A5P A;  1N72 A;  1Z60 A;  3N9M A;  5F36 A;  4LRG A;  3KNV A;  2YQL A;  3UVY A;  2KE1 A;  2LQ6 A;  1MM2 A;  5G0F A;  5EM3 A;  4IR6 A;  5CTL A;  2RFJ A;  4CLB A;  4QYD A;  4PTB A;  3GG3 A;  2PNX A;  4LYS A;  4A4B A;  5E9L A;  5LKZ A;  1G25 A;  5CQ6 A;  2ECV A;  3ZNI A;  4LK9 A;  4NYW A;  4Q0N A;  3U5P A;  1DVP A;  3FL2 A;  4N4F A;  5D1M B;  4UYF A;  2L0B A;  4L7X A;  2KGG A;  5F60 A;  3D7C A;  4QSV A;  5II2 A;  3MXF A;  5DYU A;  5ENF A;  5TCM A;  4YBS A;  5J0D A;  1RMD A;  1WIM A;  5BT3 A;  1XWH A;  5HRX A;  3U5N A;  2JMJ A;  4A49 A;  2PUY A;  5JG6 A;  5FB1 A;  4MSX A;  2M3H A;  4NRC A;  5DW1 A;  5I89 A;  4N4I A;  4QUT A;  4ZC9 A;  4O7E A;  5B78 A;  2LGL A;  4UYF B;  1FP0 A;  5FFY A;  4LJN A;  3RTR B;  4AYC A;  2YYN A;  4MEN A;  5E3G A;  3P5O A;  5KH3 A;  4YYJ A;  4XUB A;  4IOQ A;  4DON A;  5EI4 A;  2QIC A;  5B75 A;  4TZ8 A;  5DYX A;  4QF3 A;  4MEO A;  3ZVZ B;  3LQJ A;  2KWO A;  3IU6 A;  1K2F A;  4TU6 A;  5F5Z A;  3QZT A;  4CUR A;  2RNX A;  4I7B A;  5DFD A;  4NR9 A;  5DBM A;  4J1P A;  5FE5 A;  5C11 A;  4QSS A;  5TDR A;  2DAT A;  4YYK A;  5L8U A;  3ZTG A;  5IBN A;  2LDR A;  4QSW A;  3HMF A;  2LSP B;  2F42 A;  5LCW B;  4YC9 A;  5EWC A;  1WEN A;  5D25 A;  4UYE A;  1WEQ A;  5B77 A;  5HQ7 A;  4BJX A;  1BOR A;  4MR4 A;  1VYX A;  4QSR A;  3UV5 A;  2ECW A;  1N87 A;  4C66 A;  4MVT A;  3U5K A;  2N9G A;  4YK0 A;  2BAY A;  5CUG A;  4YH3 A;  4LYI A;  4LZR A;  4Z6H A;  1WFK A;  3PUQ A;  2VPB A;  4LC2 A;  5A83 A;  4NR7 A;  4OGI A;  2QJ0 A;  4OUF A;  5FH6 A;  4O7B A;  5FFW A;  2HDP A;  5FE0 A;  5H1V A;  1T1H A;  4PKL A;  3SOX A;  5G05 B;  4YYD A;  5EIS A;  4GNG A;  4WZ0 A;  5E9K A;  4LYW A;  2L5U A;  3P1E A;  2M1R A;  2E6R A;  3SOU A;  4QR5 A;  3ZPV 1;  2MUM A;  3MQM A;  2WP2 A;  2KR4 A;  1WE9 A;  4LR6 A;  4HXP A;  4PPE A;  5D3H A;  4FLP A;  2R0Y A;  1CHC A;  1EQF A;  4A9E A;  2ECN A;  3ZYU A;  2ZET C;  5HQ5 A;  2VPD A;  3ZVY A;  2L80 A;  5FDZ A;  5HQ6 A;  4ZDT A;  4LZ2 A;  1MM3 A;  4QR3 A;  4R2Y A;  5CUC A;  5CUD A;  5CQ5 A;  4A4C A;  2EOD A;  2MIQ A;  5KU3 A;  3O35 A;  2Y1N A;  2I7K A;  5I80 A;  5FH8 A;  4NR4 A;  2OSS A;  5II1 A;  5IGN A;  3P1D A;  3ASL A;  4UYD A;  4I7C A;  4B7Y C;  5EWD A;  2JMI A;  3U5M A;  5EPB A;  2DKW A;  3DAI A;  5CQA A;  5HFR A;  4A9L A;  2VJE A;  5FE2 A;  1WEW A;  3T7L A;  1WIL A;  5C13 A;  5I3L A;  4QBM A;  4YYG A;  3O7A A;  4O72 A;  2YEK A;  2YSJ A;  5G04 B;  5TB6 A;  3LJW A;  2R0S A;  4UP5 A;  5CRZ A;  2FUI A;  3N9O A;  5CUA A;  5D3P A;  4Y03 A;  4ALG A;  2LGV A;  3NG2 A;  5EYA F;  4XY9 A;  5D0C A;  4A9I A;  3MUK A;  4LLB A;  3UVX A;  5AME A;  2VJE B;  5C89 A;  4A9F A;  5DLZ A;  5ETB A;  4YAT A;  2RNY A;  2LN0 A;  5LVQ A;  5KTW A;  5A5S A;  4XY8 A;  4S3O C;  4XI1 A;  4NN2 A;  5CUE A;  5G4S A;  2KTB B;  3SVH A;  5F25 A;  2JMD A;  3VK6 A;  1U6G B;  5HEL A;  3N9P A;  3O34 A;  5DX4 A;  3SVG A;  4UP0 A;  5E73 A;  5CQ8 A;  4CCG X;  3O36 A;  5ETD A;  5AD2 A;  4BW2 A;  5F2P A;  4NRB A;  4OGJ A;  2H0D A;  2KWN A;  5E9M A;  2I50 A;  1WGM A;  4X2I A;  5D3T A;  3G0J A;  3G0L A;  1JOC A;  2YHN A;  1LDJ B;  4IC3 A;  1F68 A;  3RPG C;  2G6Q A;  1E4U A;  5IGL A;  2L43 A;  4XYA A;  5LKT A;  3MUL A;  5D3N A;  3SOW A;  3M63 A;  4PCE A;  1Z6U A;  5HEN A;  3HMH A;  5FE3 A;  4QC3 A;  2ECT A;  2DVR A;  5EV9 A;  3QZS A;  4HXN A;  4TT6 A;  3I3J A;  5B79 A;  5E0R A;  4Z93 A;  5TBN A;  5CU8 A;  4GND A;  4YAD A;  4LDF A;  5A5R A;  2LGG A;  2OUO A;  5G4R A;  5DKH A;  2MD7 B;  2YT5 A;  2DX8 A;  4IC2 A;  1IYM A;  1HYI A;  4F3I A;  2MT5 A;  2KIZ A;  3QZV A;  4ZQL A;  2G43 A;  5AIU A;  3C5K A;  2CKL A;  5CPE A;  5A85 A;  5FG5 A;  3UVD A;  4A9N A;  2ECJ A;  5J3X A;  2UZG A;  5CGP A;  4O74 A;  4F52 B;  3Q2F A;  4AYC B;  2YEL A;  4BW4 A;  2MNY A;  3HCU A;  4A9O A;  2JRJ A;  2LXP C;  3GL6 A;  5A81 A;  2L84 A;  4YY6 A;  4YH4 A;  4V3K C;  4WZ2 A;  2EA6 A;  3PHD A;  5CQ4 A;  4HBY A;  5A5Q A;  2KGI A;  5IGK A;  3RPG B;  4YBT A;  4O71 A;  5H1T A;  5A5O A;  5AD3 A;  2E6S A;  3TLP A;  4QYL A;  1WEO A;  5DIN A;  3M99 A;  5EWW A;  4HXO A;  2M85 A;  2RSD A;  3HCS A;  3HME A;  5EU1 A;  4YBM A;  2DVQ A;  5C8G A;  4TTE A;  4LZS A;  4IR3 A;  1X4J A;  2DVS A;  2LXH C;  5CZG A;  2E3K A;  4L58 A;  2M6M A;  2YRE A;  4WHW A;  5HRV A;  5E74 A;  2R10 A;  3S91 A;  5I88 A;  2NAA A;  4O7A A;  3AQA A;  3DWY A;  2MNZ A;  4Q0O A;  2VP7 A;  4WIV A;  5COI A;  5CY9 A;  3FKM X;  5ENC A;  3SVF A;  5LVR A;  4GNF A;  4YY4 A;  4MR5 A;  2E7N A;  4LAD B;  5KH7 A;  2D82 A;  3O37 A;  5D7X A;  5DYA A;  4A9J A;  4NYV A;  2IDA A;  5I7X A;  4NYX A;  5CS8 A;  5L8T A;  1X4I A;  2K1J A;  5D3R A;  5LUU A;  2E7O A;  2XB1 A;  2YW8 A;  4MEP A;  5FE8 A;  1VFY A;  2Y43 A;  3LXJ A;  4NXJ A;  2YYR A;  5C87 A;  3L1Z B;  5DKC A;  4YYH A;  3K2J A;  5FE4 A;  5D3S A;  4MEQ A;  4X3G A;  4QF2 A;  2WP1 A;  4O70 A;  3ONI A;  3U5L A;  2YSM A;  3N9N A;  5D1K B;  2NXB A;  5H85 A;  2L85 A;  4Z1Q A;  1Z2Q A;  5EA1 A;  4QC1 A;  4QSQ A;  5E3D A;  2LRI C;  2R0V A;  2YDW A;  5ENI A;  4RVR A;  3U5O A;  2QIZ A;  3HTK C;  2I8N A;  2ECG A;  4V3L C;  4QNS A;  4A0C D;  3U5J A;  2VJF A;  4O75 A;  3DQV R;  2ECI A;  5ENB A;  5EWH A;  4BW1 A;  4CL9 A;  4QSP A;  4XUA A;  5HEM A;  4P5O B;  5FE6 A;  4R7E A;  4QSU A;  5C4Q A;  5EVA A;  5F1H A;  4ZW1 A;  1V87 A;  5KTX A;  1FBV A;  2VNF A;  4FIP A;  2CSY A;  5FB0 A;  5L98 A;  5BT4 A;  1X4U A;  4J3I A;  2F6N A;  3JVJ A;  4NR6 A;  4ZUX U;  4GB0 A;  4R8P K;  2AN6 A;  5CP5 A;  4NR8 A;  5E9V A;  2Y1M A;  5EPS A;  2FSA A;  4TQN A;  4YAX A;  4IOO A;  5FE1 A;  5A5N A;  3V43 A;  3PUR A;  4Q6F A;  4ALH A;  1ZS5 A;  3JVL A;  4BBQ A;  5CQT A;  5AIT A;  4QEW A;  5H9M A;  4WHU A;  5I83 A;  2MD8 C;  2RS9 B;  2C2L A;  5D26 A;  2KRE A;  3DPL R;  5FG6 A;  4O77 A;  5F1L A;  5KHM A;  3UV4 A;  5CUB A;  4BHW A;  3KQI A;  4O64 A;  2RNW A;  3C6W A;  4J0S A;  4QY4 A;  5EPR A;  4FK5 A;  5TDW A;  4NR5 A;  5FG4 A;  1JSP B;  4UYG A;  4UIV A;  5HJC A;  5A82 A;  4NQM A;  3UVW A;  5E9Y A;  5H1U A;  4NUD A;  2XEU A;  3UV2 A;  4UIZ A;  5FE7 A;  2YW5 A;  4KCX A;  4CFK A;  3NXB A;  4NS5 A;  4QZS A;  5I1Q A;  2H0D B;  4A9M A;  4PY6 A;  5F3A A;  5IGM A;  3SHB A;  4PCI A;  4QEU A;  4A9K A;  1HYJ A;  2K16 A;  4QB3 A;  5D3J A;  4N3W A;  4O76 A;  5FFV A;  5LKU A;  5I7Y A;  3GV4 A;  4YYM A;  4HBV A;  5ACY A;  3L1X A;  4BW3 A;  5CRM A;  4GPJ A;  4N4G A;  3L11 A;  2D9E A;  2MA5 A;  4TZ2 A;  5JWM A;  3KV6 A;  5HCL A;  1VD4 A;  2OO1 A;  4O7F A;  2CSZ A;  5B76 A;  5LJ2 A;  4NRA A;  3I2D A;  3MB4 A;  4J0R A;  4S3O B;  2MJV B;  4KV1 A;  3T6R A;  4HBW A;  5D24 A;  4QEV A;  4TYL A;  5CFW A;  4TU4 A;  4HXR A;  4UIW A;  4HXS A;  5EK9 A;  2YUR A;  4IR4 A;  3N9L A;  3JVK A;  3EB5 A;  3O70 A;  1WUM A;  4O7C A;  4UIT A;  4YYI A;  4IR5 A;  5C85 A;  1WUG A;  2CKL B;  5I29 A;  2H60 A;  2VPG A;  4CUU A;  3JVM A;  3LQI A;  5EQ1 A;  3LQH A;  3UW9 A;  4AUQ B;  2G45 A;  5DKA A;  2K4D A;  4LKA A;  1ZBD B;  3AAD A;  5KH9 A;  5IID A;  2HYE D;  4AVX A;  1WEM A;  4CUP A;  5FE9 A;  4NUE A;  5DY7 A;  4C67 A;  4QSX A;  5I40 A;  5E9I A;  4Z6I A;  4QR4 A;  4YYN A;  5HM0 A;  5EWV A;  5FH7 A;  5LJ0 A;  5L97 A;  4HBX A;  2K17 A;  2CT2 A;  4UIU A;  3MB3 A;  4WZ3 B;  4CA1 A;  1WEP A;  5L96 A;  5TAB A;  2RO1 A;  3KV5 A;  5IG6 A;  4O78 A;  5AMF A;  5ENG A;  5KTU A;  2KYU A;  4C9Z A;  2L5E A;  2YHO A;  5K29 A;  5TRB A;  5L99 A;  4E96 A;  5F62 A;  2YEM A;  1LDK C;  2OXQ C;  5I86 A;  2KU3 A;  5EGU A;  2LV9 A;  4TS8 A;  4GNE A;  4NQN A;  5F61 A;  2MA6 A;  4TT2 A;  5DFC A;  4Z1S A;  5DFB A;  5ENE A;  2L75 A;  2YUC A;  3IHP A;  1JM7 A;  4HXK A;  2YQM A;  2KFT A;  3ZPV E;  2YU4 A;  4UIX A;  4WA6 A;  5D1L B;  3RCW A;  1F62 A;  3P1C A;  5C7N A;  5D3L A;  4TT4 A;  4IOR A;  2KWJ A;  5DKD A;  4CUS A;  4CUT A;  2VPE A;  4QST A;  1JM7 B;  5F63 A;  2D8S A;  1X0J A;  5CQ3 A;  3O33 A;  5LJ1 A;  2RI7 A;  2F6J A;  5KO4 A;  4N4H A;  4KV4 A;  4AKN A;  4TKP B;  4MR3 A;  5DW2 A;  3MHH A;  5EP7 A;  1WEV A;  5ENH A;  3M62 A;  3N9Q A;  4PS5 A;  4UYH A;  5BT5 A;  4CFL A;  5CQ7 A;  5DLX A;  5E7D A;  2LGK A;  4FJC A;  5B8D A;  5FBX A;  1WEE A;  5LKX A;  4NUC A;  1E6I A;  3HCT A;  4UI9 B;  1WEU A;  4A9H A;  2EGP A;  4W4U A;  4HXM A;  3MHS A;  5FER A;  3EB6 A;  2VJF B;  3S92 A;  5ENJ A;  4MR6 A;  4UIY A;  2YQD A;  3LRQ A;  4AP4 A;  2DVV A;  2GRC A;  2KWK A;  5FEY A;  4HXL A; 
#chains in the Genus database with same CATH topology
 5A7C A;  5EIC A;  1JM4 B;  3P1F A;  4QUU A;  4B86 C;  3Q2E A;  5HRW A;  4CUQ A;  2G4A A;  5HLS A;  4YAB A;  4FO9 A;  1WES A;  2FUU A;  4AKI A;  5DYC A;  3PLW A;  4I7D A;  2DWW A;  3ZYQ A;  2DJA A;  5JI8 A;  2C2V S;  5HFQ A;  3IU5 A;  3DDT A;  5A5P A;  1DCQ A;  1N72 A;  1Z60 A;  3ZVY A;  3N9M A;  5F36 A;  4LRG A;  3KNV A;  2YQL A;  3UVY A;  2KE1 A;  2LQ6 A;  1MM2 A;  5G0F A;  5EM3 A;  4IR6 A;  5CTL A;  2XOC A;  2RFJ A;  4CLB A;  4QYD A;  4PTB A;  3GG3 A;  2PNX A;  4LYS A;  4A4B A;  5E9L A;  5LKZ A;  1G25 A;  5CQ6 A;  2ECV A;  3ZNI A;  4LK9 A;  4NYW A;  4Q0N A;  3U5P A;  1DVP A;  3FL2 A;  4N4F A;  5D1M B;  4UYF A;  2L0B A;  4L7X A;  2KGG A;  5F60 A;  3D7C A;  4QSV A;  5II2 A;  3MXF A;  5DYU A;  3D1D A;  5ENF A;  5TCM A;  4YBS A;  5J0D A;  1RMD A;  5BT3 A;  1WIM A;  5HRX A;  3U5N A;  2JMJ A;  4A49 A;  4QQ4 A;  2PUY A;  5JG6 A;  5FB1 A;  2IQJ A;  3LDY A;  4MSX A;  2M3H A;  4NRC A;  5DW1 A;  5SVX A;  5I89 A;  4N4I A;  4QUT A;  4ZC9 A;  4O7E A;  5B78 A;  2LGL A;  4UYF B;  1FP0 A;  5FFY A;  4LJN A;  3RTR B;  4AYC A;  2YYN A;  4MEN A;  5E3G A;  3P5O A;  2RR4 A;  5KH3 A;  4YYJ A;  4XUB A;  4IOQ A;  4DON A;  5EI4 A;  2QIC A;  5B75 A;  4TZ8 A;  5DYX A;  4QF3 A;  4MEO A;  3ZVZ B;  3LQJ A;  2KWO A;  3IU6 A;  1K2F A;  4TU6 A;  5F5Z A;  3QZT A;  4CUR A;  2RNX A;  4I7B A;  5DFD A;  4NR9 A;  5DBM A;  4J1P A;  5FE5 A;  5C11 A;  4QSS A;  5TDR A;  2DAT A;  4YYK A;  5L8U A;  3ZTG A;  5IBN A;  2LDR A;  4QSW A;  3HMF A;  2LSP B;  2F42 A;  5LCW B;  4YC9 A;  5EWC A;  1WEN A;  5D25 A;  4UYE A;  1WEQ A;  5B77 A;  5HQ7 A;  4BJX A;  1BOR A;  4MR4 A;  1VYX A;  4QSR A;  3UV5 A;  2ECW A;  2LAU A;  1N87 A;  4C66 A;  4MVT A;  3U5K A;  3MDB C;  2N9G A;  4YK0 A;  2BAY A;  5CUG A;  4YH3 A;  4LYI A;  4LZR A;  4Z6H A;  1WFK A;  3PUQ A;  5SVI A;  3M7K A;  4OGC A;  2VPB A;  4LC2 A;  5A83 A;  4NR7 A;  4OGI A;  2QJ0 A;  4OUF A;  5FH6 A;  4O7B A;  5FFW A;  2HDP A;  5FE0 A;  5H1V A;  1T1H A;  4PKL A;  3SOX A;  3FJU B;  5G05 B;  4YYD A;  5EIS A;  4GNG A;  4WZ0 A;  5E9K A;  4LYW A;  2L5U A;  3P1E A;  2M1R A;  2E6R A;  3LVR E;  5K3Q A;  3SOU A;  3T9K A;  4QR5 A;  3ZPV 1;  2MUM A;  3MQM A;  2WP2 A;  2KR4 A;  1WE9 A;  4LR6 A;  4HXP A;  4PPE A;  5D3H A;  4FLP A;  2R0Y A;  1CHC A;  1EQF A;  4A9E A;  2ECN A;  3ZYU A;  2ZET C;  5HQ5 A;  2VPD A;  3D1B A;  2L80 A;  5FDZ A;  5HQ6 A;  4ZDT A;  4LZ2 A;  1MM3 A;  4QR3 A;  2XOY A;  4R2Y A;  5CUC A;  5CUD A;  5CQ5 A;  4A4C A;  2EOD A;  2L7P A;  2MIQ A;  5KU3 A;  3O35 A;  2Y1N A;  2I7K A;  5I80 A;  5FH8 A;  4NR4 A;  2OSS A;  5II1 A;  5IGN A;  3P1D A;  3ASL A;  4UYD A;  4I7C A;  4B7Y C;  3JUE A;  5EWD A;  2JMI A;  3U5M A;  5EPB A;  2DKW A;  3DAI A;  5CQA A;  5HFR A;  4A9L A;  2VJE A;  5FE2 A;  1WEW A;  3T7L A;  1WIL A;  5C13 A;  5I3L A;  4QBM A;  4YYG A;  3O7A A;  4O72 A;  2YEK A;  2YSJ A;  5G04 B;  5TB6 A;  3LJW A;  2R0S A;  4UP5 A;  5CRZ A;  2FUI A;  3N9O A;  5CUA A;  5D3P A;  4Y03 A;  4ALG A;  2LGV A;  3NG2 A;  5EYA F;  4XY9 A;  5D0C A;  4A9I A;  3MUK A;  4LLB A;  3UVX A;  5AME A;  2VJE B;  5C89 A;  4A9F A;  5DLZ A;  5ETB A;  4YAT A;  2RNY A;  2LN0 A;  5LVQ A;  5KTW A;  5A5S A;  4XY8 A;  4S3O C;  4XI1 A;  4NN2 A;  5CUE A;  5G4S A;  2KTB B;  3SVH A;  5F25 A;  2JMD A;  3VK6 A;  1U6G B;  5HEL A;  3N9P A;  3O34 A;  5DX4 A;  3SVG A;  4UP0 A;  5E73 A;  5CQ8 A;  2DSM A;  4CCG X;  3O36 A;  5ETD A;  5AD2 A;  4BW2 A;  5F2P A;  4NRB A;  4OGJ A;  2H0D A;  2KWN A;  5E9M A;  2I50 A;  1WGM A;  4X2I A;  5D3T A;  3G0J A;  3G0L A;  1JOC A;  2YHN A;  1LDJ B;  4IC3 A;  1F68 A;  3RPG C;  2EXU A;  2G6Q A;  1E4U A;  5IGL A;  2L43 A;  4XYA A;  5LKT A;  3MUL A;  5D3N A;  3SOW A;  3M63 A;  3FAO A;  4PCE A;  1Z6U A;  5HEN A;  3HMH A;  5FE3 A;  4QC3 A;  2ECT A;  2DVR A;  5EV9 A;  3QZS A;  2FFW A;  4HXN A;  4TT6 A;  3I3J A;  5B79 A;  5E0R A;  4Z93 A;  5TBN A;  5CU8 A;  4GND A;  4YAD A;  4LDF A;  5A5R A;  2LGG A;  2OUO A;  5G4R A;  5DKH A;  2MD7 B;  2KKY A;  2YT5 A;  2DX8 A;  4IC2 A;  1IYM A;  1HYI A;  4F3I A;  2MT5 A;  2KIZ A;  3QZV A;  4ZQL A;  2G43 A;  5AIU A;  3C5K A;  2CKL A;  2CRR A;  5CPE A;  5A85 A;  5FG5 A;  3UVD A;  4A9N A;  2ECJ A;  5J3X A;  2UZG A;  5CGP A;  4O74 A;  4F52 B;  3Q2F A;  4AYC B;  2YEL A;  4OGE A;  4BW4 A;  2MNY A;  3HCU A;  4A9O A;  2JRJ A;  2LXP C;  3GL6 A;  5A81 A;  2L84 A;  2CSV A;  4YY6 A;  4YH4 A;  4AI6 A;  4V3K C;  2EGM A;  2EA6 A;  3PHD A;  5CQ4 A;  4HBY A;  5A5Q A;  1XWH A;  4WZ2 A;  2KGI A;  5IGK A;  3RPG B;  4YBT A;  4O71 A;  5H1T A;  5A5O A;  5AD3 A;  3E2D A;  2E6S A;  4F1P A;  3TLP A;  4QYL A;  1WEO A;  5DIN A;  3M99 A;  5EWW A;  4HXO A;  2M85 A;  2JUN A;  2RSD A;  3HCS A;  3LVQ E;  3HME A;  5EU1 A;  4YBM A;  2DVQ A;  5C8G A;  4TTE A;  4LZS A;  4IR3 A;  4Z0O A;  2M13 A;  1X4J A;  2DVS A;  2LXH C;  5CZG A;  2E3K A;  4L58 A;  2M6M A;  2YRE A;  4WHW A;  5HRV A;  5E74 A;  2R10 A;  3S91 A;  5I88 A;  2NAA A;  4O7A A;  3AQA A;  3DWY A;  5SVI B;  2MNZ A;  4Q0O A;  2VP7 A;  4WIV A;  5COI A;  5CY9 A;  3FKM X;  2KKX A;  5ENC A;  3SVF A;  5LVR A;  4GNF A;  4YY4 A;  4MR5 A;  2E7N A;  4LAD B;  5KH7 A;  2D82 A;  3O37 A;  5D7X A;  5DYA A;  4A9J A;  4NYV A;  2IDA A;  5I7X A;  4NYX A;  5CS8 A;  5L8T A;  1X4I A;  2K1J A;  5D3R A;  5LUU A;  2E7O A;  2P57 A;  2XB1 A;  2YW8 A;  3KDE C;  4MEP A;  4O62 A;  5FE8 A;  1VFY A;  2Y43 A;  3LXJ A;  4NXJ A;  2YYR A;  5C87 A;  2E61 A;  5DKC A;  4YYH A;  3L1Z B;  3K2J A;  3ERR A;  5FE4 A;  5D3S A;  4MEQ A;  4X3G A;  4QF2 A;  2WP1 A;  4O70 A;  3ONI A;  3U5L A;  2YSM A;  3N9N A;  5D1K B;  2NXB A;  5H85 A;  2L85 A;  4Z1Q A;  1Z2Q A;  5EA1 A;  4QC1 A;  4QSQ A;  5E3D A;  2LRI C;  2R0V A;  2YDW A;  5ENI A;  4RVR A;  3U5O A;  3VKH A;  2QIZ A;  2I8N A;  2ECG A;  2XP0 A;  4QNS A;  3HTK C;  4V3L C;  4A0C D;  3U5J A;  2VJF A;  4O75 A;  3DQV R;  2ECI A;  2XOZ A;  5ENB A;  5EWH A;  4BW1 A;  4CL9 A;  4QSP A;  4XUA A;  5HEM A;  4P5O B;  5FE6 A;  4R7E A;  4QSU A;  5C4Q A;  5EVA A;  5F1H A;  4ZW1 A;  1V87 A;  5KTX A;  1FBV A;  2VNF A;  4FIP A;  2CSY A;  5FB0 A;  5L98 A;  5BT4 A;  1X4U A;  4J3I A;  2F6N A;  3JVJ A;  4NR6 A;  4ZUX U;  4GB0 A;  4R8P K;  2AN6 A;  5CP5 A;  4NR8 A;  5E9V A;  2Y1M A;  3FAN A;  5EPS A;  2CRW A;  2FSA A;  3FEH A;  4TQN A;  4YAX A;  4IOO A;  5FE1 A;  5A5N A;  3V43 A;  3PUR A;  4Q6F A;  4ALH A;  1ZS5 A;  3JVL A;  4BBQ A;  5CQT A;  5SVY A;  5AIT A;  4QEW A;  5H9M A;  4WHU A;  5I83 A;  2MD8 C;  2RS9 B;  1PUO A;  5D26 A;  2C2L A;  2KRE A;  3DPL R;  5FG6 A;  4O77 A;  5F1L A;  5KHM A;  3UV4 A;  3VKG A;  5CUB A;  4BHW A;  2B0O E;  3KQI A;  4O64 A;  2RNW A;  3C6W A;  4J0S A;  4QY4 A;  5EPR A;  3FM8 C;  4FK5 A;  4AKH A;  5TDW A;  4NR5 A;  5FG4 A;  1JSP B;  4UYG A;  4UIV A;  5HJC A;  5A82 A;  4NQM A;  3UVW A;  5E9Y A;  5H1U A;  4NUD A;  2XEU A;  3UV2 A;  4UIZ A;  5FE7 A;  2YW5 A;  4KCX A;  4CFK A;  3NXB A;  4NS5 A;  4QZS A;  5I1Q A;  2H0D B;  4A9M A;  4PY6 A;  3DWD A;  5F3A A;  5IGM A;  3SHB A;  4PCI A;  4QEU A;  4A9K A;  1HYJ A;  2K16 A;  4QB3 A;  5D3J A;  4N3W A;  4O76 A;  5FFV A;  5LKU A;  5I7Y A;  3GV4 A;  4YYM A;  4HBV A;  5ACY A;  3L1X A;  4BW3 A;  5CRM A;  4GPJ A;  4N4G A;  3L11 A;  2D9E A;  2MA5 A;  4TZ2 A;  5JWM A;  3KV6 A;  5HCL A;  1VD4 A;  2OO1 A;  4O7F A;  2CSZ A;  5B76 A;  5LJ2 A;  4NRA A;  4AKG A;  3I2D A;  3MB4 A;  4J0R A;  4S3O B;  2MJV B;  4KV1 A;  3T6R A;  4HBW A;  5D24 A;  4QEV A;  4TYL A;  5CFW A;  4TU4 A;  4HXR A;  3SUB A;  4UIW A;  4HXS A;  5EK9 A;  2EJN A;  2YUR A;  4IR4 A;  3N9L A;  3JVK A;  3EB5 A;  3O70 A;  1WUM A;  4O7C A;  4UIT A;  4YYI A;  4IR5 A;  5C85 A;  1WUG A;  2CKL B;  5I29 A;  2H60 A;  2VPG A;  4CUU A;  3JVM A;  3O47 A;  3LQI A;  5EQ1 A;  3LQH A;  3UW9 A;  4AUQ B;  2G45 A;  5DKA A;  2K4D A;  4LKA A;  1ZBD B;  3AAD A;  5KH9 A;  5IID A;  2HYE D;  4AVX A;  1WEM A;  4CUP A;  5FE9 A;  4NUE A;  5DY7 A;  4C67 A;  4QSX A;  5I40 A;  5E9I A;  4Z6I A;  4QR4 A;  4YYN A;  5HM0 A;  5EWV A;  5FH7 A;  5LJ0 A;  3Q1D A;  5L97 A;  4HBX A;  2K17 A;  2CT2 A;  4UIU A;  3MB3 A;  4WZ3 B;  3LJU X;  4CA1 A;  1WEP A;  5L96 A;  5TAB A;  2RO1 A;  3KV5 A;  5IG6 A;  4O78 A;  5AMF A;  5ENG A;  5KTU A;  2KYU A;  4C9Z A;  2L5E A;  2YHO A;  5K29 A;  5TRB A;  5L99 A;  4E96 A;  5F62 A;  2YEM A;  1LDK C;  2OXQ C;  5I86 A;  2KU3 A;  5EGU A;  2LV9 A;  4TS8 A;  4GNE A;  4H9D A;  4NQN A;  2OWA A;  5F61 A;  2MA6 A;  4TT2 A;  5DFC A;  4Z1S A;  5DFB A;  5ENE A;  2L75 A;  2YUC A;  3IHP A;  1JM7 A;  4HXK A;  2YQM A;  2KFT A;  3ZPV E;  2YU4 A;  4UIX A;  2CON A;  4WA6 A;  5D1L B;  3RCW A;  1F62 A;  3P1C A;  5C7N A;  5D3L A;  4TT4 A;  4IOR A;  2KWJ A;  5DKD A;  4CUS A;  4CUT A;  2D8U A;  3H7H A;  2VPE A;  4QST A;  1JM7 B;  5F63 A;  2D8S A;  1X0J A;  5CQ3 A;  3O33 A;  5LJ1 A;  2RI7 A;  2F6J A;  5KO4 A;  4N4H A;  4KV4 A;  4AKN A;  2FD4 A;  4TKP B;  4MR3 A;  5DW2 A;  3MHH A;  5EP7 A;  1WEV A;  5ENH A;  3M62 A;  3N9Q A;  2JM3 A;  4PS5 A;  4UYH A;  5BT5 A;  4CFL A;  5CQ7 A;  5DLX A;  5E7D A;  1MBM A;  2LGK A;  4FJC A;  5B8D A;  5FBX A;  1WEE A;  5LKX A;  4NUC A;  1E6I A;  3HCT A;  4UI9 B;  4Z0R A;  1WEU A;  4A9H A;  2EGP A;  4W4U A;  4HXM A;  3MHS A;  5FER A;  3EB6 A;  2VJF B;  2YVR A;  3S92 A;  1ZKR A;  5ENJ A;  2MKE A;  4MR6 A;  4UIY A;  2YQD A;  3LRQ A;  4AP4 A;  2DVV A;  2GRC A;  2KWK A;  5FEY A;  4HXL A; 
#chains in the Genus database with same CATH homology
 5A7C A;  5EIC A;  1JM4 B;  3P1F A;  4QUU A;  4B86 C;  3Q2E A;  5HRW A;  4CUQ A;  2G4A A;  5HLS A;  4YAB A;  4FO9 A;  1WES A;  2FUU A;  5DYC A;  4I7D A;  2DWW A;  3ZYQ A;  5JI8 A;  2C2V S;  5HFQ A;  3IU5 A;  5A5P A;  1N72 A;  1Z60 A;  3N9M A;  5F36 A;  4LRG A;  3KNV A;  2YQL A;  3UVY A;  2KE1 A;  2LQ6 A;  1MM2 A;  5G0F A;  5EM3 A;  4IR6 A;  5CTL A;  2RFJ A;  4CLB A;  4QYD A;  4PTB A;  3GG3 A;  2PNX A;  4LYS A;  4A4B A;  5E9L A;  5LKZ A;  1G25 A;  5CQ6 A;  2ECV A;  3ZNI A;  4LK9 A;  4NYW A;  4Q0N A;  3U5P A;  1DVP A;  3FL2 A;  4N4F A;  5D1M B;  4UYF A;  2L0B A;  4L7X A;  2KGG A;  5F60 A;  3D7C A;  4QSV A;  5II2 A;  3MXF A;  5DYU A;  5ENF A;  5TCM A;  4YBS A;  5J0D A;  1RMD A;  1WIM A;  5BT3 A;  1XWH A;  5HRX A;  3U5N A;  2JMJ A;  4A49 A;  2PUY A;  5JG6 A;  5FB1 A;  4MSX A;  2M3H A;  4NRC A;  5DW1 A;  5I89 A;  4N4I A;  4QUT A;  4ZC9 A;  4O7E A;  5B78 A;  2LGL A;  4UYF B;  1FP0 A;  5FFY A;  4LJN A;  3RTR B;  4AYC A;  2YYN A;  4MEN A;  5E3G A;  3P5O A;  5KH3 A;  4YYJ A;  4XUB A;  4IOQ A;  4DON A;  5EI4 A;  2QIC A;  5B75 A;  4TZ8 A;  5DYX A;  4QF3 A;  4MEO A;  3ZVZ B;  3LQJ A;  2KWO A;  3IU6 A;  1K2F A;  4TU6 A;  5F5Z A;  3QZT A;  4CUR A;  2RNX A;  4I7B A;  5DFD A;  4NR9 A;  5DBM A;  4J1P A;  5FE5 A;  5C11 A;  4QSS A;  5TDR A;  2DAT A;  4YYK A;  5L8U A;  3ZTG A;  5IBN A;  2LDR A;  4QSW A;  3HMF A;  2LSP B;  2F42 A;  5LCW B;  4YC9 A;  5EWC A;  1WEN A;  5D25 A;  4UYE A;  1WEQ A;  5B77 A;  5HQ7 A;  4BJX A;  1BOR A;  4MR4 A;  1VYX A;  4QSR A;  3UV5 A;  2ECW A;  1N87 A;  4C66 A;  4MVT A;  3U5K A;  2N9G A;  4YK0 A;  2BAY A;  5CUG A;  4YH3 A;  4LYI A;  4LZR A;  4Z6H A;  1WFK A;  3PUQ A;  2VPB A;  4LC2 A;  5A83 A;  4NR7 A;  4OGI A;  2QJ0 A;  4OUF A;  5FH6 A;  4O7B A;  5FFW A;  2HDP A;  5FE0 A;  5H1V A;  1T1H A;  4PKL A;  3SOX A;  5G05 B;  4YYD A;  5EIS A;  4GNG A;  4WZ0 A;  5E9K A;  4LYW A;  2L5U A;  3P1E A;  2M1R A;  2E6R A;  3SOU A;  4QR5 A;  3ZPV 1;  2MUM A;  3MQM A;  2WP2 A;  2KR4 A;  1WE9 A;  4LR6 A;  4HXP A;  4PPE A;  5D3H A;  4FLP A;  2R0Y A;  1CHC A;  1EQF A;  4A9E A;  2ECN A;  3ZYU A;  2ZET C;  5HQ5 A;  2VPD A;  3ZVY A;  2L80 A;  5FDZ A;  5HQ6 A;  4ZDT A;  4LZ2 A;  1MM3 A;  4QR3 A;  4R2Y A;  5CUC A;  5CUD A;  5CQ5 A;  4A4C A;  2EOD A;  2MIQ A;  5KU3 A;  3O35 A;  2Y1N A;  2I7K A;  5I80 A;  5FH8 A;  4NR4 A;  2OSS A;  5II1 A;  5IGN A;  3P1D A;  3ASL A;  4UYD A;  4I7C A;  4B7Y C;  5EWD A;  2JMI A;  3U5M A;  5EPB A;  2DKW A;  3DAI A;  5CQA A;  5HFR A;  4A9L A;  2VJE A;  5FE2 A;  1WEW A;  3T7L A;  1WIL A;  5C13 A;  5I3L A;  4QBM A;  4YYG A;  3O7A A;  4O72 A;  2YEK A;  2YSJ A;  5G04 B;  5TB6 A;  3LJW A;  2R0S A;  4UP5 A;  5CRZ A;  2FUI A;  3N9O A;  5CUA A;  5D3P A;  4Y03 A;  4ALG A;  2LGV A;  3NG2 A;  5EYA F;  4XY9 A;  5D0C A;  4A9I A;  3MUK A;  4LLB A;  3UVX A;  5AME A;  2VJE B;  5C89 A;  4A9F A;  5DLZ A;  5ETB A;  4YAT A;  2RNY A;  2LN0 A;  5LVQ A;  5KTW A;  5A5S A;  4XY8 A;  4S3O C;  4XI1 A;  4NN2 A;  5CUE A;  5G4S A;  2KTB B;  3SVH A;  5F25 A;  2JMD A;  3VK6 A;  1U6G B;  5HEL A;  3N9P A;  3O34 A;  5DX4 A;  3SVG A;  4UP0 A;  5E73 A;  5CQ8 A;  4CCG X;  3O36 A;  5ETD A;  5AD2 A;  4BW2 A;  5F2P A;  4NRB A;  4OGJ A;  2H0D A;  2KWN A;  5E9M A;  2I50 A;  1WGM A;  4X2I A;  5D3T A;  3G0J A;  3G0L A;  1JOC A;  2YHN A;  1LDJ B;  4IC3 A;  1F68 A;  3RPG C;  2G6Q A;  1E4U A;  5IGL A;  2L43 A;  4XYA A;  5LKT A;  3MUL A;  5D3N A;  3SOW A;  3M63 A;  4PCE A;  1Z6U A;  5HEN A;  3HMH A;  5FE3 A;  4QC3 A;  2ECT A;  2DVR A;  5EV9 A;  3QZS A;  4HXN A;  4TT6 A;  3I3J A;  5B79 A;  5E0R A;  4Z93 A;  5TBN A;  5CU8 A;  4GND A;  4YAD A;  4LDF A;  5A5R A;  2LGG A;  2OUO A;  5G4R A;  5DKH A;  2MD7 B;  2YT5 A;  2DX8 A;  4IC2 A;  1IYM A;  1HYI A;  4F3I A;  2MT5 A;  2KIZ A;  3QZV A;  4ZQL A;  2G43 A;  5AIU A;  3C5K A;  2CKL A;  5CPE A;  5A85 A;  5FG5 A;  3UVD A;  4A9N A;  2ECJ A;  5J3X A;  2UZG A;  5CGP A;  4O74 A;  4F52 B;  3Q2F A;  4AYC B;  2YEL A;  4BW4 A;  2MNY A;  3HCU A;  4A9O A;  2JRJ A;  2LXP C;  3GL6 A;  5A81 A;  2L84 A;  4YY6 A;  4YH4 A;  4V3K C;  4WZ2 A;  2EA6 A;  3PHD A;  5CQ4 A;  4HBY A;  5A5Q A;  2KGI A;  5IGK A;  3RPG B;  4YBT A;  4O71 A;  5H1T A;  5A5O A;  5AD3 A;  2E6S A;  3TLP A;  4QYL A;  1WEO A;  5DIN A;  3M99 A;  5EWW A;  4HXO A;  2M85 A;  2RSD A;  3HCS A;  3HME A;  5EU1 A;  4YBM A;  2DVQ A;  5C8G A;  4TTE A;  4LZS A;  4IR3 A;  1X4J A;  2DVS A;  2LXH C;  5CZG A;  2E3K A;  4L58 A;  2M6M A;  2YRE A;  4WHW A;  5HRV A;  5E74 A;  2R10 A;  3S91 A;  5I88 A;  2NAA A;  4O7A A;  3AQA A;  3DWY A;  2MNZ A;  4Q0O A;  2VP7 A;  4WIV A;  5COI A;  5CY9 A;  3FKM X;  5ENC A;  3SVF A;  5LVR A;  4GNF A;  4YY4 A;  4MR5 A;  2E7N A;  4LAD B;  5KH7 A;  2D82 A;  3O37 A;  5D7X A;  5DYA A;  4A9J A;  4NYV A;  2IDA A;  5I7X A;  4NYX A;  5CS8 A;  5L8T A;  1X4I A;  2K1J A;  5D3R A;  5LUU A;  2E7O A;  2XB1 A;  2YW8 A;  4MEP A;  5FE8 A;  1VFY A;  2Y43 A;  3LXJ A;  4NXJ A;  2YYR A;  5C87 A;  3L1Z B;  5DKC A;  4YYH A;  3K2J A;  5FE4 A;  5D3S A;  4MEQ A;  4X3G A;  4QF2 A;  2WP1 A;  4O70 A;  3ONI A;  3U5L A;  2YSM A;  3N9N A;  5D1K B;  2NXB A;  5H85 A;  2L85 A;  4Z1Q A;  1Z2Q A;  5EA1 A;  4QC1 A;  4QSQ A;  5E3D A;  2LRI C;  2R0V A;  2YDW A;  5ENI A;  4RVR A;  3U5O A;  2QIZ A;  3HTK C;  2I8N A;  2ECG A;  4V3L C;  4QNS A;  4A0C D;  3U5J A;  2VJF A;  4O75 A;  3DQV R;  2ECI A;  5ENB A;  5EWH A;  4BW1 A;  4CL9 A;  4QSP A;  4XUA A;  5HEM A;  4P5O B;  5FE6 A;  4R7E A;  4QSU A;  5C4Q A;  5EVA A;  5F1H A;  4ZW1 A;  1V87 A;  5KTX A;  1FBV A;  2VNF A;  4FIP A;  2CSY A;  5FB0 A;  5L98 A;  5BT4 A;  1X4U A;  4J3I A;  2F6N A;  3JVJ A;  4NR6 A;  4ZUX U;  4GB0 A;  4R8P K;  2AN6 A;  5CP5 A;  4NR8 A;  5E9V A;  2Y1M A;  5EPS A;  2FSA A;  4TQN A;  4YAX A;  4IOO A;  5FE1 A;  5A5N A;  3V43 A;  3PUR A;  4Q6F A;  4ALH A;  1ZS5 A;  3JVL A;  4BBQ A;  5CQT A;  5AIT A;  4QEW A;  5H9M A;  4WHU A;  5I83 A;  2MD8 C;  2RS9 B;  2C2L A;  5D26 A;  2KRE A;  3DPL R;  5FG6 A;  4O77 A;  5F1L A;  5KHM A;  3UV4 A;  5CUB A;  4BHW A;  3KQI A;  4O64 A;  2RNW A;  3C6W A;  4J0S A;  4QY4 A;  5EPR A;  4FK5 A;  5TDW A;  4NR5 A;  5FG4 A;  1JSP B;  4UYG A;  4UIV A;  5HJC A;  5A82 A;  4NQM A;  3UVW A;  5E9Y A;  5H1U A;  4NUD A;  2XEU A;  3UV2 A;  4UIZ A;  5FE7 A;  2YW5 A;  4KCX A;  4CFK A;  3NXB A;  4NS5 A;  4QZS A;  5I1Q A;  2H0D B;  4A9M A;  4PY6 A;  5F3A A;  5IGM A;  3SHB A;  4PCI A;  4QEU A;  4A9K A;  1HYJ A;  2K16 A;  4QB3 A;  5D3J A;  4N3W A;  4O76 A;  5FFV A;  5LKU A;  5I7Y A;  3GV4 A;  4YYM A;  4HBV A;  5ACY A;  3L1X A;  4BW3 A;  5CRM A;  4GPJ A;  4N4G A;  3L11 A;  2D9E A;  2MA5 A;  4TZ2 A;  5JWM A;  3KV6 A;  5HCL A;  1VD4 A;  2OO1 A;  4O7F A;  2CSZ A;  5B76 A;  5LJ2 A;  4NRA A;  3I2D A;  3MB4 A;  4J0R A;  4S3O B;  2MJV B;  4KV1 A;  3T6R A;  4HBW A;  5D24 A;  4QEV A;  4TYL A;  5CFW A;  4TU4 A;  4HXR A;  4UIW A;  4HXS A;  5EK9 A;  2YUR A;  4IR4 A;  3N9L A;  3JVK A;  3EB5 A;  3O70 A;  1WUM A;  4O7C A;  4UIT A;  4YYI A;  4IR5 A;  5C85 A;  1WUG A;  2CKL B;  5I29 A;  2H60 A;  2VPG A;  4CUU A;  3JVM A;  3LQI A;  5EQ1 A;  3LQH A;  3UW9 A;  4AUQ B;  2G45 A;  5DKA A;  2K4D A;  4LKA A;  1ZBD B;  3AAD A;  5KH9 A;  5IID A;  2HYE D;  4AVX A;  1WEM A;  4CUP A;  5FE9 A;  4NUE A;  5DY7 A;  4C67 A;  4QSX A;  5I40 A;  5E9I A;  4Z6I A;  4QR4 A;  4YYN A;  5HM0 A;  5EWV A;  5FH7 A;  5LJ0 A;  5L97 A;  4HBX A;  2K17 A;  2CT2 A;  4UIU A;  3MB3 A;  4WZ3 B;  4CA1 A;  1WEP A;  5L96 A;  5TAB A;  2RO1 A;  3KV5 A;  5IG6 A;  4O78 A;  5AMF A;  5ENG A;  5KTU A;  2KYU A;  4C9Z A;  2L5E A;  2YHO A;  5K29 A;  5TRB A;  5L99 A;  4E96 A;  5F62 A;  2YEM A;  1LDK C;  2OXQ C;  5I86 A;  2KU3 A;  5EGU A;  2LV9 A;  4TS8 A;  4GNE A;  4NQN A;  5F61 A;  2MA6 A;  4TT2 A;  5DFC A;  4Z1S A;  5DFB A;  5ENE A;  2L75 A;  2YUC A;  3IHP A;  1JM7 A;  4HXK A;  2YQM A;  2KFT A;  3ZPV E;  2YU4 A;  4UIX A;  4WA6 A;  5D1L B;  3RCW A;  1F62 A;  3P1C A;  5C7N A;  5D3L A;  4TT4 A;  4IOR A;  2KWJ A;  5DKD A;  4CUS A;  4CUT A;  2VPE A;  4QST A;  1JM7 B;  5F63 A;  2D8S A;  1X0J A;  5CQ3 A;  3O33 A;  5LJ1 A;  2RI7 A;  2F6J A;  5KO4 A;  4N4H A;  4KV4 A;  4AKN A;  4TKP B;  4MR3 A;  5DW2 A;  3MHH A;  5EP7 A;  1WEV A;  5ENH A;  3M62 A;  3N9Q A;  4PS5 A;  4UYH A;  5BT5 A;  4CFL A;  5CQ7 A;  5DLX A;  5E7D A;  2LGK A;  4FJC A;  5B8D A;  5FBX A;  1WEE A;  5LKX A;  4NUC A;  1E6I A;  3HCT A;  4UI9 B;  1WEU A;  4A9H A;  2EGP A;  4W4U A;  4HXM A;  3MHS A;  5FER A;  3EB6 A;  2VJF B;  3S92 A;  5ENJ A;  4MR6 A;  4UIY A;  2YQD A;  3LRQ A;  4AP4 A;  2DVV A;  2GRC A;  2KWK A;  5FEY A;  4HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...