3L11A

Crystal structure of the ring domain of rnf168
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
104
Chain Sequence
SMALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGYQPVRLLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF168
publication title Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 27
structure length 104
sequence length 113
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l11A00
2LN0A 3U5MA 3HCUA 4YBSA 4QF3A 4AYCB 2JMIA 3KV5A 5LKTA 2YW8A 3SOWA 1WEWA 1G25A 1LDKC 4FO9A 2KIZA 2VNFA 3HCSA 5C11A 2YQLA 1MM3A 1WIMA 4CA1A 3QZVA 1VD4A 3EB6A 2LXPC 4WA6A 3LQHA 2YQMA 2L5UA 2YT5A 1WILA 4F52B 5FB1A 1N87A 2L75A 4B7YC 2JMJA 2FUIA 2NAAA 5I3LA 2EGPA 3FL2A 2HYED 4GNDA 2F42A 2C2LA 2KYUA 3T7LA 2QIZA 2KU3A 3NG2A 1MM2A 1WEVA 2M85A 4IC3A 1WFKA 4UP5A 3N9OA 4YABA 2VPGA 5LKUA 1WEUA 2YHNA 2D8SA 1HYIA 4N3WA 2K1JA 4S3OB 2VJEA 3GL6A 4I7BA 3O35A 3ASLA 4AVXA 5KH9A 2LV9A 5TDWA 2ECVA 4R7EA 4AUQB 4FK5A 4V3LC 2KREA 2ECTA 2YHOA 2L80A 4B86C 2LRIC 4MVTA 2G43A 2LXHC 5FB0A 5H1VA 4A0CD 2VJFB 2VP7A 2M3HA 5B77A 4Q6FA 1HYJA 5B75A 5D1LB 3MHSA 2KE1A 3PURA 2YYRA 3O37A 3LQJA 4BBQA 2M1RA 3KQIA 1JM7A 2CKLB 1BORA 3RPGB 2KWOA 1Z60A 3U5OA 5AITA 5D1KB 3L11A 4AYCA 3IHPA 4P5OB 4WZ0A 2VPBA 5J3XA 4FIPA 2JMDA 4LJNA 4V3KC 4PTBA 1WEMA 1FP0A 5TRBA 3HCTA 1Z6UA 5D1MB 3GV4A 1WEOA 4LADB 2KWKA 1WEEA 2FUUA 5AIUA 4C9ZA 2DX8A 3L1ZB 2OXQC 3M99A 5TBNA 4S3OC 3N9PA 3MHHA 2HDPA 5TDRA 2I50A 2YU4A 4QF2A 2YURA 2MNYA 2CSYA 4W4UA 2JRJA 3O70A 2ECWA 2L0BA 1E4UA 1T1HA 1WEQA 2MD8C 4X3GA 2ECIA 3RTRB 1WENA 1CHCA 3ZNIA 2M6MA 5B78A 1K2FA 2KGIA 4N4FA 3RPGC 4I7DA 3O7AA 2G6QA 4LLBA 2LGVA 3ZVZB 3EB5A 4YC9A 2E6SA 2XEUA 4IC2A 1IYMA 2ZETC 3O36A 4A49A 5LKZA 3PUQA 4AP4A 5B8DA 5DKAA 2K16A 5FERA 2ECGA 2VJFA 3L1XA 2LGGA 3O34A 1JOCA 2FSAA 2QJ0A 4TKPB 3PHDA 5TABA 2H0DB 2KFTA 3N9LA 5C13A 2Y43A 5KH7A 2AN6A 1RMDA 4A4BA 1LDJB 5H1UA 1WE9A 3U5PA 2G45A 2H0DA 4BHWA 4R8PK 3DQVR 3ZPV1 2KWJA 5B79A 4NN2A 4CCGX 4L58A 2CKLA 3M63A 2ECJA 4MSXA 5FEYA 4YADA 2RSDA 2MT5A 4YAXA 4YBTA 2E6RA 5LKXA 2PNXA 4YBMA 2CT2A 3LQIA 3ZTGA 1X4JA 4YATA 2MNZA 2ECNA 2RI7A 3SOXA 1DVPA 3N9QA 5G05B 1V87A 2LGLA 4A4CA 2KGGA 5DINA 4LKAA 4XI1A 2YREA 2PUYA 3HTKC 2YUCA 3U5NA 3ZYQA 3N9NA 5B76A 3V43A 4GNGA 2MA5A 2LGKA 1VFYA 1WEPA 5H1TA 4WZ3B 4ZUXU 5H9MA 3I2DA 2BAYA 2KR4A 1WESA 2YSMA 2MD7B 3N9MA 4UI9B 1ZBDB 5JG6A 2IDAA 2YSJA 2MUMA 3C5KA 3T6RA 4FJCA 2K17A 4GB0A 3DPLR 1VYXA 2XB1A 4I7CA 4UP0A 5LCWB 3SOUA 4PPEA 2L43A 4WZ2A 4LK9A 1FBVA 3O33A 5G04B 5G0FA 2EODA 2VJEB 3LRQA 2K4DA 1X4UA 3ZVYA 4R2YA 3SHBA 4O64A 1Z2QA 2CSZA 2F6NA 3KNVA 2LQ6A 3M62A 2MA6A 2Y1MA 2MIQA 3KV6A 4L7XA 2LDRA 5EYAF 2F6JA 4ZQLA 2VPDA 2Y1NA 2VPEA 4GNEA 1XWHA 1WGMA 1X4IA 1F62A 4GNFA 5KH3A 2EA6A 2UZGA 2KWNA 3ZPVE 2C2VS 2QICA 1JM7B 3VK6A 4ZDTA 1U6GB 3C6WA
chains in the Genus database with same CATH superfamily
2LN0A 3U5MA 2DSMA 3HCUA 4YBSA 4QF3A 4AYCB 2JM3A 2JMIA 3KV5A 5LKTA 5SVYA 2YW8A 3SOWA 3LDYA 1WEWA 1G25A 1LDKC 4FO9A 2KIZA 2VNFA 3HCSA 5C11A 2YQLA 2B0OE 1MM3A 1WIMA 2XOCA 4CA1A 3QZVA 1VD4A 3EB6A 2LXPC 4WA6A 3LQHA 2YQMA 2L5UA 2YT5A 1WILA 4F52B 5FB1A 1N87A 2LAUA 2L75A 4B7YC 2JMJA 2FUIA 3LVQE 2IQJA 2NAAA 5I3LA 2EGPA 3FL2A 2HYED 4Z0RA 4GNDA 2F42A 2FFWA 2C2LA 2KYUA 3T7LA 2QIZA 2KU3A 3NG2A 1MM2A 1WEVA 2M85A 4IC3A 1WFKA 4UP5A 3N9OA 4YABA 2VPGA 5LKUA 1WEUA 2YHNA 2D8SA 1HYIA 4N3WA 2K1JA 4S3OB 2VJEA 3GL6A 3H7HA 4I7BA 3O35A 3ASLA 4AVXA 5KH9A 2LV9A 5TDWA 2ECVA 4R7EA 2XOYA 4AUQB 4FK5A 4V3LC 2KREA 2ECTA 2DJAA 2L80A 2YHOA 4B86C 2LRIC 4MVTA 2G43A 2LXHC 5FB0A 5H1VA 4A0CD 2VJFB 3JUEA 2VP7A 2M3HA 5B77A 4Q6FA 1HYJA 2XP0A 5B75A 5D1LB 3MHSA 2KE1A 3PURA 3DWDA 2YYRA 3O37A 3LQJA 4BBQA 3FM8C 2M1RA 3E2DA 3KQIA 1JM7A 2CKLB 1BORA 3RPGB 2KWOA 1Z60A 3U5OA 2KKXA 5AITA 5D1KB 3L11A 4AYCA 3IHPA 2L7PA 4P5OB 4WZ0A 2VPBA 5J3XA 4FIPA 2P57A 2JMDA 4LJNA 2MKEA 4V3KC 2EXUA 4PTBA 2JUNA 1WEMA 1FP0A 5TRBA 3LJUX 3HCTA 1Z6UA 5D1MB 3GV4A 1WEOA 4LADB 2KWKA 1WEEA 2FUUA 5AIUA 4C9ZA 2DX8A 3L1ZB 2OXQC 3M99A 5TBNA 4S3OC 3DDTA 2CONA 3N9PA 3MHHA 2XOZA 2HDPA 3Q1DA 5TDRA 2I50A 2YU4A 4QF2A 2YURA 2MNYA 2CSYA 1MBMA 4W4UA 2JRJA 3O70A 2ECWA 2L0BA 2YVRA 2RR4A 1E4UA 1T1HA 1WEQA 2MD8C 3O47A 4X3GA 4QQ4A 2ECIA 3RTRB 1WENA 2M13A 1CHCA 3ZNIA 4O62A 3MDBC 2M6MA 5B78A 1K2FA 2KGIA 4N4FA 3RPGC 4I7DA 3O7AA 2G6QA 4LLBA 2LGVA 3ZVZB 3EB5A 4YC9A 2E6SA 3KDEC 2EGMA 2XEUA 4IC2A 1IYMA 2ZETC 3O36A 4A49A 5LKZA 3PUQA 4AP4A 5B8DA 5DKAA 2K16A 5FERA 2ECGA 2VJFA 3L1XA 2LGGA 3O34A 1JOCA 2FSAA 2QJ0A 4TKPB 3PHDA 5TABA 2H0DB 4OGEA 2KFTA 3N9LA 5C13A 2Y43A 5KH7A 2AN6A 1RMDA 4A4BA 1LDJB 5H1UA 1WE9A 3U5PA 2G45A 3FAOA 2H0DA 4BHWA 4R8PK 3DQVR 3FANA 2FD4A 3ZPV1 2KWJA 5B79A 4NN2A 4CCGX 4L58A 2CKLA 3M63A 2ECJA 4MSXA 5FEYA 4YADA 2RSDA 2MT5A 4YAXA 4YBTA 2E61A 2CRWA 2E6RA 5LKXA 2PNXA 4YBMA 2CT2A 3LQIA 3ZTGA 1X4JA 2D8UA 3SUBA 3PLWA 4YATA 2OWAA 2MNZA 2ECNA 5SVXA 2RI7A 3FEHA 3SOXA 1DVPA 3N9QA 5G05B 5K3QA 1V87A 2LGLA 4A4CA 2KGGA 5DINA 4LKAA 4XI1A 2YREA 2PUYA 2KKYA 3HTKC 2CRRA 2YUCA 3U5NA 3ZYQA 3N9NA 5B76A 3V43A 4GNGA 2MA5A 2LGKA 1VFYA 1WEPA 5H1TA 4WZ3B 4ZUXU 5H9MA 3I2DA 2BAYA 2KR4A 1WESA 2YSMA 2MD7B 3N9MA 4UI9B 1ZBDB 5JG6A 2IDAA 3T9KA 2YSJA 2MUMA 3C5KA 3T6RA 4FJCA 2K17A 4GB0A 3DPLR 1VYXA 2XB1A 4I7CA 4UP0A 5LCWB 3SOUA 4PPEA 2L43A 4H9DA 4WZ2A 4LK9A 1FBVA 3O33A 5G04B 4OGCA 5G0FA 2EODA 2VJEB 3LRQA 2K4DA 1X4UA 3ZVYA 2CSVA 4R2YA 1DCQA 3SHBA 4O64A 1Z2QA 2CSZA 2F6NA 3KNVA 3LVRE 5SVIB 2LQ6A 3M62A 2MA6A 2Y1MA 2MIQA 3KV6A 4L7XA 2LDRA 5EYAF 2F6JA 4ZQLA 5SVIA 2VPDA 2Y1NA 2VPEA 4F1PA 4GNEA 1XWHA 1WGMA 1X4IA 1F62A 4GNFA 5KH3A 3FJUB 2EA6A 3M7KA 2UZGA 2KWNA 3ZPVE 2C2VS 4Z0OA 2QICA 1JM7B 3VK6A 4ZDTA 1U6GB 3C6WA
chains in the Genus database with same CATH topology
2LN0A 3U5MA 3HCUA 4YBSA 4QF3A 4AYCB 2JMIA 3KV5A 5LKTA 2YW8A 3SOWA 1WEWA 1G25A 1LDKC 4FO9A 2KIZA 2VNFA 3HCSA 5C11A 2YQLA 1MM3A 1WIMA 4CA1A 3QZVA 1VD4A 3EB6A 2LXPC 4WA6A 3LQHA 2YQMA 2L5UA 2YT5A 1WILA 4F52B 5FB1A 1N87A 2L75A 4B7YC 2JMJA 2FUIA 2NAAA 5I3LA 2EGPA 3FL2A 2HYED 4GNDA 2F42A 2C2LA 2KYUA 3T7LA 2QIZA 2KU3A 3NG2A 1MM2A 1WEVA 2M85A 4IC3A 1WFKA 4UP5A 3N9OA 4YABA 2VPGA 5LKUA 1WEUA 2YHNA 2D8SA 1HYIA 4N3WA 2K1JA 4S3OB 2VJEA 3GL6A 4I7BA 3O35A 3ASLA 4AVXA 5KH9A 2LV9A 5TDWA 2ECVA 4R7EA 4AUQB 4FK5A 4V3LC 2KREA 2ECTA 2YHOA 2L80A 4B86C 2LRIC 4MVTA 2G43A 2LXHC 5FB0A 5H1VA 4A0CD 2VJFB 2VP7A 2M3HA 5B77A 4Q6FA 1HYJA 5B75A 5D1LB 3MHSA 2KE1A 3PURA 2YYRA 3O37A 3LQJA 4BBQA 2M1RA 3KQIA 1JM7A 2CKLB 1BORA 3RPGB 2KWOA 1Z60A 3U5OA 5AITA 5D1KB 3L11A 4AYCA 3IHPA 4P5OB 4WZ0A 2VPBA 5J3XA 4FIPA 2JMDA 4LJNA 4V3KC 4PTBA 1WEMA 1FP0A 5TRBA 3HCTA 1Z6UA 5D1MB 3GV4A 1WEOA 4LADB 2KWKA 1WEEA 2FUUA 5AIUA 4C9ZA 2DX8A 3L1ZB 2OXQC 3M99A 5TBNA 4S3OC 3N9PA 3MHHA 2HDPA 5TDRA 2I50A 2YU4A 4QF2A 2YURA 2MNYA 2CSYA 4W4UA 2JRJA 3O70A 2ECWA 2L0BA 1E4UA 1T1HA 1WEQA 2MD8C 4X3GA 2ECIA 3RTRB 1WENA 1CHCA 3ZNIA 2M6MA 5B78A 1K2FA 2KGIA 4N4FA 3RPGC 4I7DA 3O7AA 2G6QA 4LLBA 2LGVA 3ZVZB 3EB5A 4YC9A 2E6SA 2XEUA 4IC2A 1IYMA 2ZETC 3O36A 4A49A 5LKZA 3PUQA 4AP4A 5B8DA 5DKAA 2K16A 5FERA 2ECGA 2VJFA 3L1XA 2LGGA 3O34A 1JOCA 2FSAA 2QJ0A 4TKPB 3PHDA 5TABA 2H0DB 2KFTA 3N9LA 5C13A 2Y43A 5KH7A 2AN6A 1RMDA 4A4BA 1LDJB 5H1UA 1WE9A 3U5PA 2G45A 2H0DA 4BHWA 4R8PK 3DQVR 3ZPV1 2KWJA 5B79A 4NN2A 4CCGX 4L58A 2CKLA 3M63A 2ECJA 4MSXA 5FEYA 4YADA 2RSDA 2MT5A 4YAXA 4YBTA 2E6RA 5LKXA 2PNXA 4YBMA 2CT2A 3LQIA 3ZTGA 1X4JA 4YATA 2MNZA 2ECNA 2RI7A 3SOXA 1DVPA 3N9QA 5G05B 1V87A 2LGLA 4A4CA 2KGGA 5DINA 4LKAA 4XI1A 2YREA 2PUYA 3HTKC 2YUCA 3U5NA 3ZYQA 3N9NA 5B76A 3V43A 4GNGA 2MA5A 2LGKA 1VFYA 1WEPA 5H1TA 4WZ3B 4ZUXU 5H9MA 3I2DA 2BAYA 2KR4A 1WESA 2YSMA 2MD7B 3N9MA 4UI9B 1ZBDB 5JG6A 2IDAA 2YSJA 2MUMA 3C5KA 3T6RA 4FJCA 2K17A 4GB0A 3DPLR 1VYXA 2XB1A 4I7CA 4UP0A 5LCWB 3SOUA 4PPEA 2L43A 4WZ2A 4LK9A 1FBVA 3O33A 5G04B 5G0FA 2EODA 2VJEB 3LRQA 2K4DA 1X4UA 3ZVYA 4R2YA 3SHBA 4O64A 1Z2QA 2CSZA 2F6NA 3KNVA 2LQ6A 3M62A 2MA6A 2Y1MA 2MIQA 3KV6A 4L7XA 2LDRA 5EYAF 2F6JA 4ZQLA 2VPDA 2Y1NA 2VPEA 4GNEA 1XWHA 1WGMA 1X4IA 1F62A 4GNFA 5KH3A 2EA6A 2UZGA 2KWNA 3ZPVE 2C2VS 2QICA 1JM7B 3VK6A 4ZDTA 1U6GB 3C6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LN0 A;  3U5M A;  3HCU A;  4YBS A;  4QF3 A;  4AYC B;  2JMI A;  3KV5 A;  5LKT A;  2YW8 A;  3SOW A;  1WEW A;  1G25 A;  1LDK C;  4FO9 A;  2KIZ A;  2VNF A;  3HCS A;  5C11 A;  2YQL A;  1MM3 A;  1WIM A;  4CA1 A;  3QZV A;  1VD4 A;  3EB6 A;  2LXP C;  4WA6 A;  3LQH A;  2YQM A;  2L5U A;  2YT5 A;  1WIL A;  4F52 B;  5FB1 A;  1N87 A;  2L75 A;  4B7Y C;  2JMJ A;  2FUI A;  2NAA A;  5I3L A;  2EGP A;  3FL2 A;  2HYE D;  4GND A;  2F42 A;  2C2L A;  2KYU A;  3T7L A;  2QIZ A;  2KU3 A;  3NG2 A;  1MM2 A;  1WEV A;  2M85 A;  4IC3 A;  1WFK A;  4UP5 A;  3N9O A;  4YAB A;  2VPG A;  5LKU A;  1WEU A;  2YHN A;  2D8S A;  1HYI A;  4N3W A;  2K1J A;  4S3O B;  2VJE A;  3GL6 A;  4I7B A;  3O35 A;  3ASL A;  4AVX A;  5KH9 A;  2LV9 A;  5TDW A;  2ECV A;  4R7E A;  4AUQ B;  4FK5 A;  4V3L C;  2KRE A;  2ECT A;  2YHO A;  2L80 A;  4B86 C;  2LRI C;  4MVT A;  2G43 A;  2LXH C;  5FB0 A;  5H1V A;  4A0C D;  2VJF B;  2VP7 A;  2M3H A;  5B77 A;  4Q6F A;  1HYJ A;  5B75 A;  5D1L B;  3MHS A;  2KE1 A;  3PUR A;  2YYR A;  3O37 A;  3LQJ A;  4BBQ A;  2M1R A;  3KQI A;  1JM7 A;  2CKL B;  1BOR A;  3RPG B;  2KWO A;  1Z60 A;  3U5O A;  5AIT A;  5D1K B;  3L11 A;  4AYC A;  3IHP A;  4P5O B;  4WZ0 A;  2VPB A;  5J3X A;  4FIP A;  2JMD A;  4LJN A;  4V3K C;  4PTB A;  1WEM A;  1FP0 A;  5TRB A;  3HCT A;  1Z6U A;  5D1M B;  3GV4 A;  1WEO A;  4LAD B;  2KWK A;  1WEE A;  2FUU A;  5AIU A;  4C9Z A;  2DX8 A;  3L1Z B;  2OXQ C;  3M99 A;  5TBN A;  4S3O C;  3N9P A;  3MHH A;  2HDP A;  5TDR A;  2I50 A;  2YU4 A;  4QF2 A;  2YUR A;  2MNY A;  2CSY A;  4W4U A;  2JRJ A;  3O70 A;  2ECW A;  2L0B A;  1E4U A;  1T1H A;  1WEQ A;  2MD8 C;  4X3G A;  2ECI A;  3RTR B;  1WEN A;  1CHC A;  3ZNI A;  2M6M A;  5B78 A;  1K2F A;  2KGI A;  4N4F A;  3RPG C;  4I7D A;  3O7A A;  2G6Q A;  4LLB A;  2LGV A;  3ZVZ B;  3EB5 A;  4YC9 A;  2E6S A;  2XEU A;  4IC2 A;  1IYM A;  2ZET C;  3O36 A;  4A49 A;  5LKZ A;  3PUQ A;  4AP4 A;  5B8D A;  5DKA A;  2K16 A;  5FER A;  2ECG A;  2VJF A;  3L1X A;  2LGG A;  3O34 A;  1JOC A;  2FSA A;  2QJ0 A;  4TKP B;  3PHD A;  5TAB A;  2H0D B;  2KFT A;  3N9L A;  5C13 A;  2Y43 A;  5KH7 A;  2AN6 A;  1RMD A;  4A4B A;  1LDJ B;  5H1U A;  1WE9 A;  3U5P A;  2G45 A;  2H0D A;  4BHW A;  4R8P K;  3DQV R;  3ZPV 1;  2KWJ A;  5B79 A;  4NN2 A;  4CCG X;  4L58 A;  2CKL A;  3M63 A;  2ECJ A;  4MSX A;  5FEY A;  4YAD A;  2RSD A;  2MT5 A;  4YAX A;  4YBT A;  2E6R A;  5LKX A;  2PNX A;  4YBM A;  2CT2 A;  3LQI A;  3ZTG A;  1X4J A;  4YAT A;  2MNZ A;  2ECN A;  2RI7 A;  3SOX A;  1DVP A;  3N9Q A;  5G05 B;  1V87 A;  2LGL A;  4A4C A;  2KGG A;  5DIN A;  4LKA A;  4XI1 A;  2YRE A;  2PUY A;  3HTK C;  2YUC A;  3U5N A;  3ZYQ A;  3N9N A;  5B76 A;  3V43 A;  4GNG A;  2MA5 A;  2LGK A;  1VFY A;  1WEP A;  5H1T A;  4WZ3 B;  4ZUX U;  5H9M A;  3I2D A;  2BAY A;  2KR4 A;  1WES A;  2YSM A;  2MD7 B;  3N9M A;  4UI9 B;  1ZBD B;  5JG6 A;  2IDA A;  2YSJ A;  2MUM A;  3C5K A;  3T6R A;  4FJC A;  2K17 A;  4GB0 A;  3DPL R;  1VYX A;  2XB1 A;  4I7C A;  4UP0 A;  5LCW B;  3SOU A;  4PPE A;  2L43 A;  4WZ2 A;  4LK9 A;  1FBV A;  3O33 A;  5G04 B;  5G0F A;  2EOD A;  2VJE B;  3LRQ A;  2K4D A;  1X4U A;  3ZVY A;  4R2Y A;  3SHB A;  4O64 A;  1Z2Q A;  2CSZ A;  2F6N A;  3KNV A;  2LQ6 A;  3M62 A;  2MA6 A;  2Y1M A;  2MIQ A;  3KV6 A;  4L7X A;  2LDR A;  5EYA F;  2F6J A;  4ZQL A;  2VPD A;  2Y1N A;  2VPE A;  4GNE A;  1XWH A;  1WGM A;  1X4I A;  1F62 A;  4GNF A;  5KH3 A;  2EA6 A;  2UZG A;  2KWN A;  3ZPV E;  2C2V S;  2QIC A;  1JM7 B;  3VK6 A;  4ZDT A;  1U6G B;  3C6W A; 
#chains in the Genus database with same CATH topology
 2LN0 A;  3U5M A;  2DSM A;  3HCU A;  4YBS A;  4QF3 A;  4AYC B;  2JM3 A;  2JMI A;  3KV5 A;  5LKT A;  5SVY A;  2YW8 A;  3SOW A;  3LDY A;  1WEW A;  1G25 A;  1LDK C;  4FO9 A;  2KIZ A;  2VNF A;  3HCS A;  5C11 A;  2YQL A;  2B0O E;  1MM3 A;  1WIM A;  2XOC A;  4CA1 A;  3QZV A;  1VD4 A;  3EB6 A;  2LXP C;  4WA6 A;  3LQH A;  2YQM A;  2L5U A;  2YT5 A;  1WIL A;  4F52 B;  5FB1 A;  1N87 A;  2LAU A;  2L75 A;  4B7Y C;  2JMJ A;  2FUI A;  3LVQ E;  2IQJ A;  2NAA A;  5I3L A;  2EGP A;  3FL2 A;  2HYE D;  4Z0R A;  4GND A;  2F42 A;  2FFW A;  2C2L A;  2KYU A;  3T7L A;  2QIZ A;  2KU3 A;  3NG2 A;  1MM2 A;  1WEV A;  2M85 A;  4IC3 A;  1WFK A;  4UP5 A;  3N9O A;  4YAB A;  2VPG A;  5LKU A;  1WEU A;  2YHN A;  2D8S A;  1HYI A;  4N3W A;  2K1J A;  4S3O B;  2VJE A;  3GL6 A;  3H7H A;  4I7B A;  3O35 A;  3ASL A;  4AVX A;  5KH9 A;  2LV9 A;  5TDW A;  2ECV A;  4R7E A;  2XOY A;  4AUQ B;  4FK5 A;  4V3L C;  2KRE A;  2ECT A;  2DJA A;  2L80 A;  2YHO A;  4B86 C;  2LRI C;  4MVT A;  2G43 A;  2LXH C;  5FB0 A;  5H1V A;  4A0C D;  2VJF B;  3JUE A;  2VP7 A;  2M3H A;  5B77 A;  4Q6F A;  1HYJ A;  2XP0 A;  5B75 A;  5D1L B;  3MHS A;  2KE1 A;  3PUR A;  3DWD A;  2YYR A;  3O37 A;  3LQJ A;  4BBQ A;  3FM8 C;  2M1R A;  3E2D A;  3KQI A;  1JM7 A;  2CKL B;  1BOR A;  3RPG B;  2KWO A;  1Z60 A;  3U5O A;  2KKX A;  5AIT A;  5D1K B;  3L11 A;  4AYC A;  3IHP A;  2L7P A;  4P5O B;  4WZ0 A;  2VPB A;  5J3X A;  4FIP A;  2P57 A;  2JMD A;  4LJN A;  2MKE A;  4V3K C;  2EXU A;  4PTB A;  2JUN A;  1WEM A;  1FP0 A;  5TRB A;  3LJU X;  3HCT A;  1Z6U A;  5D1M B;  3GV4 A;  1WEO A;  4LAD B;  2KWK A;  1WEE A;  2FUU A;  5AIU A;  4C9Z A;  2DX8 A;  3L1Z B;  2OXQ C;  3M99 A;  5TBN A;  4S3O C;  3DDT A;  2CON A;  3N9P A;  3MHH A;  2XOZ A;  2HDP A;  3Q1D A;  5TDR A;  2I50 A;  2YU4 A;  4QF2 A;  2YUR A;  2MNY A;  2CSY A;  1MBM A;  4W4U A;  2JRJ A;  3O70 A;  2ECW A;  2L0B A;  2YVR A;  2RR4 A;  1E4U A;  1T1H A;  1WEQ A;  2MD8 C;  3O47 A;  4X3G A;  4QQ4 A;  2ECI A;  3RTR B;  1WEN A;  2M13 A;  1CHC A;  3ZNI A;  4O62 A;  3MDB C;  2M6M A;  5B78 A;  1K2F A;  2KGI A;  4N4F A;  3RPG C;  4I7D A;  3O7A A;  2G6Q A;  4LLB A;  2LGV A;  3ZVZ B;  3EB5 A;  4YC9 A;  2E6S A;  3KDE C;  2EGM A;  2XEU A;  4IC2 A;  1IYM A;  2ZET C;  3O36 A;  4A49 A;  5LKZ A;  3PUQ A;  4AP4 A;  5B8D A;  5DKA A;  2K16 A;  5FER A;  2ECG A;  2VJF A;  3L1X A;  2LGG A;  3O34 A;  1JOC A;  2FSA A;  2QJ0 A;  4TKP B;  3PHD A;  5TAB A;  2H0D B;  4OGE A;  2KFT A;  3N9L A;  5C13 A;  2Y43 A;  5KH7 A;  2AN6 A;  1RMD A;  4A4B A;  1LDJ B;  5H1U A;  1WE9 A;  3U5P A;  2G45 A;  3FAO A;  2H0D A;  4BHW A;  4R8P K;  3DQV R;  3FAN A;  2FD4 A;  3ZPV 1;  2KWJ A;  5B79 A;  4NN2 A;  4CCG X;  4L58 A;  2CKL A;  3M63 A;  2ECJ A;  4MSX A;  5FEY A;  4YAD A;  2RSD A;  2MT5 A;  4YAX A;  4YBT A;  2E61 A;  2CRW A;  2E6R A;  5LKX A;  2PNX A;  4YBM A;  2CT2 A;  3LQI A;  3ZTG A;  1X4J A;  2D8U A;  3SUB A;  3PLW A;  4YAT A;  2OWA A;  2MNZ A;  2ECN A;  5SVX A;  2RI7 A;  3FEH A;  3SOX A;  1DVP A;  3N9Q A;  5G05 B;  5K3Q A;  1V87 A;  2LGL A;  4A4C A;  2KGG A;  5DIN A;  4LKA A;  4XI1 A;  2YRE A;  2PUY A;  2KKY A;  3HTK C;  2CRR A;  2YUC A;  3U5N A;  3ZYQ A;  3N9N A;  5B76 A;  3V43 A;  4GNG A;  2MA5 A;  2LGK A;  1VFY A;  1WEP A;  5H1T A;  4WZ3 B;  4ZUX U;  5H9M A;  3I2D A;  2BAY A;  2KR4 A;  1WES A;  2YSM A;  2MD7 B;  3N9M A;  4UI9 B;  1ZBD B;  5JG6 A;  2IDA A;  3T9K A;  2YSJ A;  2MUM A;  3C5K A;  3T6R A;  4FJC A;  2K17 A;  4GB0 A;  3DPL R;  1VYX A;  2XB1 A;  4I7C A;  4UP0 A;  5LCW B;  3SOU A;  4PPE A;  2L43 A;  4H9D A;  4WZ2 A;  4LK9 A;  1FBV A;  3O33 A;  5G04 B;  4OGC A;  5G0F A;  2EOD A;  2VJE B;  3LRQ A;  2K4D A;  1X4U A;  3ZVY A;  2CSV A;  4R2Y A;  1DCQ A;  3SHB A;  4O64 A;  1Z2Q A;  2CSZ A;  2F6N A;  3KNV A;  3LVR E;  5SVI B;  2LQ6 A;  3M62 A;  2MA6 A;  2Y1M A;  2MIQ A;  3KV6 A;  4L7X A;  2LDR A;  5EYA F;  2F6J A;  4ZQL A;  5SVI A;  2VPD A;  2Y1N A;  2VPE A;  4F1P A;  4GNE A;  1XWH A;  1WGM A;  1X4I A;  1F62 A;  4GNF A;  5KH3 A;  3FJU B;  2EA6 A;  3M7K A;  2UZG A;  2KWN A;  3ZPV E;  2C2V S;  4Z0O A;  2QIC A;  1JM7 B;  3VK6 A;  4ZDT A;  1U6G B;  3C6W A; 
#chains in the Genus database with same CATH homology
 2LN0 A;  3U5M A;  3HCU A;  4YBS A;  4QF3 A;  4AYC B;  2JMI A;  3KV5 A;  5LKT A;  2YW8 A;  3SOW A;  1WEW A;  1G25 A;  1LDK C;  4FO9 A;  2KIZ A;  2VNF A;  3HCS A;  5C11 A;  2YQL A;  1MM3 A;  1WIM A;  4CA1 A;  3QZV A;  1VD4 A;  3EB6 A;  2LXP C;  4WA6 A;  3LQH A;  2YQM A;  2L5U A;  2YT5 A;  1WIL A;  4F52 B;  5FB1 A;  1N87 A;  2L75 A;  4B7Y C;  2JMJ A;  2FUI A;  2NAA A;  5I3L A;  2EGP A;  3FL2 A;  2HYE D;  4GND A;  2F42 A;  2C2L A;  2KYU A;  3T7L A;  2QIZ A;  2KU3 A;  3NG2 A;  1MM2 A;  1WEV A;  2M85 A;  4IC3 A;  1WFK A;  4UP5 A;  3N9O A;  4YAB A;  2VPG A;  5LKU A;  1WEU A;  2YHN A;  2D8S A;  1HYI A;  4N3W A;  2K1J A;  4S3O B;  2VJE A;  3GL6 A;  4I7B A;  3O35 A;  3ASL A;  4AVX A;  5KH9 A;  2LV9 A;  5TDW A;  2ECV A;  4R7E A;  4AUQ B;  4FK5 A;  4V3L C;  2KRE A;  2ECT A;  2YHO A;  2L80 A;  4B86 C;  2LRI C;  4MVT A;  2G43 A;  2LXH C;  5FB0 A;  5H1V A;  4A0C D;  2VJF B;  2VP7 A;  2M3H A;  5B77 A;  4Q6F A;  1HYJ A;  5B75 A;  5D1L B;  3MHS A;  2KE1 A;  3PUR A;  2YYR A;  3O37 A;  3LQJ A;  4BBQ A;  2M1R A;  3KQI A;  1JM7 A;  2CKL B;  1BOR A;  3RPG B;  2KWO A;  1Z60 A;  3U5O A;  5AIT A;  5D1K B;  3L11 A;  4AYC A;  3IHP A;  4P5O B;  4WZ0 A;  2VPB A;  5J3X A;  4FIP A;  2JMD A;  4LJN A;  4V3K C;  4PTB A;  1WEM A;  1FP0 A;  5TRB A;  3HCT A;  1Z6U A;  5D1M B;  3GV4 A;  1WEO A;  4LAD B;  2KWK A;  1WEE A;  2FUU A;  5AIU A;  4C9Z A;  2DX8 A;  3L1Z B;  2OXQ C;  3M99 A;  5TBN A;  4S3O C;  3N9P A;  3MHH A;  2HDP A;  5TDR A;  2I50 A;  2YU4 A;  4QF2 A;  2YUR A;  2MNY A;  2CSY A;  4W4U A;  2JRJ A;  3O70 A;  2ECW A;  2L0B A;  1E4U A;  1T1H A;  1WEQ A;  2MD8 C;  4X3G A;  2ECI A;  3RTR B;  1WEN A;  1CHC A;  3ZNI A;  2M6M A;  5B78 A;  1K2F A;  2KGI A;  4N4F A;  3RPG C;  4I7D A;  3O7A A;  2G6Q A;  4LLB A;  2LGV A;  3ZVZ B;  3EB5 A;  4YC9 A;  2E6S A;  2XEU A;  4IC2 A;  1IYM A;  2ZET C;  3O36 A;  4A49 A;  5LKZ A;  3PUQ A;  4AP4 A;  5B8D A;  5DKA A;  2K16 A;  5FER A;  2ECG A;  2VJF A;  3L1X A;  2LGG A;  3O34 A;  1JOC A;  2FSA A;  2QJ0 A;  4TKP B;  3PHD A;  5TAB A;  2H0D B;  2KFT A;  3N9L A;  5C13 A;  2Y43 A;  5KH7 A;  2AN6 A;  1RMD A;  4A4B A;  1LDJ B;  5H1U A;  1WE9 A;  3U5P A;  2G45 A;  2H0D A;  4BHW A;  4R8P K;  3DQV R;  3ZPV 1;  2KWJ A;  5B79 A;  4NN2 A;  4CCG X;  4L58 A;  2CKL A;  3M63 A;  2ECJ A;  4MSX A;  5FEY A;  4YAD A;  2RSD A;  2MT5 A;  4YAX A;  4YBT A;  2E6R A;  5LKX A;  2PNX A;  4YBM A;  2CT2 A;  3LQI A;  3ZTG A;  1X4J A;  4YAT A;  2MNZ A;  2ECN A;  2RI7 A;  3SOX A;  1DVP A;  3N9Q A;  5G05 B;  1V87 A;  2LGL A;  4A4C A;  2KGG A;  5DIN A;  4LKA A;  4XI1 A;  2YRE A;  2PUY A;  3HTK C;  2YUC A;  3U5N A;  3ZYQ A;  3N9N A;  5B76 A;  3V43 A;  4GNG A;  2MA5 A;  2LGK A;  1VFY A;  1WEP A;  5H1T A;  4WZ3 B;  4ZUX U;  5H9M A;  3I2D A;  2BAY A;  2KR4 A;  1WES A;  2YSM A;  2MD7 B;  3N9M A;  4UI9 B;  1ZBD B;  5JG6 A;  2IDA A;  2YSJ A;  2MUM A;  3C5K A;  3T6R A;  4FJC A;  2K17 A;  4GB0 A;  3DPL R;  1VYX A;  2XB1 A;  4I7C A;  4UP0 A;  5LCW B;  3SOU A;  4PPE A;  2L43 A;  4WZ2 A;  4LK9 A;  1FBV A;  3O33 A;  5G04 B;  5G0F A;  2EOD A;  2VJE B;  3LRQ A;  2K4D A;  1X4U A;  3ZVY A;  4R2Y A;  3SHB A;  4O64 A;  1Z2Q A;  2CSZ A;  2F6N A;  3KNV A;  2LQ6 A;  3M62 A;  2MA6 A;  2Y1M A;  2MIQ A;  3KV6 A;  4L7X A;  2LDR A;  5EYA F;  2F6J A;  4ZQL A;  2VPD A;  2Y1N A;  2VPE A;  4GNE A;  1XWH A;  1WGM A;  1X4I A;  1F62 A;  4GNF A;  5KH3 A;  2EA6 A;  2UZG A;  2KWN A;  3ZPV E;  2C2V S;  2QIC A;  1JM7 B;  3VK6 A;  4ZDT A;  1U6G B;  3C6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...