3L11A

Crystal structure of the ring domain of rnf168
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
104
Chain Sequence
SMALPKDAIPSLSECQCGICMEILVEPVTLPCNHTLCKPCFQSTVEKASLCCPFCRRRVSSWTRYHTRRNSLVNVELWTIIQKHYPRECKLRASGYQPVRLLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into the function of RING finger (RNF)-containing proteins hRNF8 and hRNF168 in Ubc13/Mms2-dependent ubiquitylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF168
total genus 27
structure length 104
sequence length 113
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14447 Prok-RING_4 Prokaryotic RING finger family 4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3l11A00
1WEOA 5H1UA 3NG2A 4O64A 4LKAA 3U5NA 5KH3A 3LQHA 2KGIA 1WEMA 1VFYA 2YHOA 2L5UA 2KWJA 4N4FA 4R2YA 4AP4A 1JOCA 5FB0A 2CSZA 2MIQA 2EGPA 4L58A 2KREA 2KWOA 1WEUA 1MM3A 2FUUA 2H0DA 2K17A 1WGMA 2VJFA 2XB1A 2MD7B 5G04B 1E4UA 2M3HA 5LKXA 2ECJA 2OXQC 4WZ2A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 3PHDA 5LKTA 3SOWA 2QICA 4IC3A 5G05B 1F62A 4GNGA 1K2FA 2ECNA 3O37A 1JM7A 5TBNA 3N9LA 5TDRA 3SHBA 5LKZA 5TDWA 1WEVA 3M63A 2MNZA 2YURA 1X4UA 3C5KA 2LXPC 3IHPA 2LGGA 2YYRA 2VP7A 3O35A 2MT5A 5B77A 2F6NA 3SOXA 5B8DA 1CHCA 2MNYA 2HDPA 5B75A 1VD4A 2VJEA 3EB5A 4V3KC 3SOUA 4BHWA 3ZPV1 4LLBA 3ZTGA 2YQLA 2KYUA 2BAYA 3DPLR 3GV4A 1FBVA 2ZETC 3T6RA 4R7EA 2PUYA 2ECTA 5DKAA 2D8SA 3VK6A 1WEWA 1VYXA 3FL2A 3LQIA 3ZNIA 3L1ZB 4FJCA 3M62A 4NN2A 2RSDA 4FO9A 3O34A 4FK5A 4LJNA 4S3OB 3RPGB 4UI9B 2H0DB 2KIZA 5TABA 4PPEA 4Q6FA 4QF2A 2KE1A 5FEYA 1LDKC 4X3GA 2CSYA 2VJEB 2FSAA 1RMDA 3V43A 4I7DA 2ECIA 2YU4A 4BBQA 2JMJA 1ZBDB 3L11A 5LKUA 2Y1NA 2L75A 5AIUA 3KQIA 2LN0A 3N9QA 5H1TA 4YATA 5FERA 3RPGC 5TRBA 3HCUA 4I7BA 4S3OC 2VNFA 2XEUA 2L80A 2CT2A 3ZVYA 2F6JA 2KWNA 4A4CA 4MVTA 4WZ0A 2AN6A 3ASLA 5C13A 2LGKA 2YSMA 2YHNA 3M99A 3KV6A 5JG6A 4YBSA 3DQVR 2CKLA 5D1MB 5EYAF 3ZVZB 4UP0A 2F42A 2E6RA 1WENA 3QZVA 2K16A 4ZUXU 4AVXA 2ECWA 5B78A 5B79A 2QIZA 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 2JRJA 3RTRB 5H9MA 2K4DA 4I7CA 3KNVA 2KGGA 2LDRA 2G43A 2JMIA 3HTKC 5C11A 4UP5A 4FIPA 1V87A 3GL6A 4AYCB 5FB1A 3EB6A 2L43A 2JMDA 4YAXA 2G6QA 2YREA 5KH7A 2QJ0A 3HCTA 5G0FA 3O7AA 1WFKA 5AITA 2VPDA 1HYIA 2K1JA 1Z2QA 2M6MA 3U5OA 3U5MA 4N3WA 3PURA 2NAAA 2RI7A 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 2YUCA 2EODA 4AUQB 4CA1A 5I3LA 4GNFA 4MSXA 2KWKA 2YQMA 2I50A 4W4UA 2LXHC 1WIMA 5LCWB 1WILA 5DINA 3ZYQA 4A4BA 2UZGA 5B76A 4YADA 4AYCA 4CCGX 2FUIA 2DX8A 5D1KB 3O36A 4YC9A 2MUMA 2LQ6A 3C6WA 1BORA 3L1XA 1IYMA 4ZQLA 5J3XA 1WEQA 2M1RA 4XI1A 1X4IA 3O70A 4LK9A 4GB0A 2C2VS 3KV5A 4IC2A 3N9MA 2EA6A 1XWHA 2HYED 4F52B 3HCSA 4LADB 2Y1MA 2MA5A 4GNEA 4YABA 1MM2A 1Z60A 3U5PA 1Z6UA 3T7LA 2ECVA 3N9NA 1N87A 3ZPVE 2VPEA 1DVPA 3MHHA 2KFTA 4V3LC 5H1VA 2PNXA 2LGVA 2G45A 3LRQA 4P5OB 4GNDA 4QF3A 2KR4A 4WA6A 4B7YC 3I2DA 2KU3A 2LRIC 2MA6A 4YBTA 2L0BA 4PTBA 4R8PK 2YW8A 2LV9A 1T1HA 5D1LB 2M85A 1FP0A 1WESA 2IDAA 2Y43A 4WZ3B 4TKPB 3O33A 2E6SA 3LQJA 1WEPA 4L7XA 4A49A 1HYJA 4YBMA 2CKLB 2MD8C 1JM7B 3MHSA 2VJFB 1WE9A 4B86C 1G25A 2VPBA 2YSJA
chains in the Genus database with same CATH superfamily
1WEOA 3SUBA 5H1UA 3NG2A 4O64A 4LKAA 3U5NA 5KH3A 3JUEA 3LQHA 2KGIA 1WEMA 1VFYA 2M13A 2YHOA 2L5UA 2KWJA 2B0OE 4N4FA 4R2YA 4AP4A 1JOCA 5FB0A 2CSZA 2DSMA 2MIQA 2EGPA 3PLWA 4L58A 3T9KA 2KREA 2KWOA 1WEUA 1MM3A 2FUUA 2H0DA 2K17A 2RR4A 1WGMA 2VJFA 2XB1A 2MD7B 5G04B 1E4UA 2M3HA 2JM3A 5LKXA 2ECJA 2OXQC 4WZ2A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 4H9DA 3PHDA 5LKTA 3SOWA 2LAUA 2QICA 4IC3A 5G05B 1F62A 4GNGA 1K2FA 2ECNA 3O37A 1JM7A 5TBNA 3N9LA 5TDRA 3SHBA 5LKZA 3H7HA 5TDWA 1WEVA 3FEHA 3M63A 2MNZA 2YURA 3C5KA 1X4UA 2XOYA 2LXPC 3IHPA 2LGGA 2YYRA 2VP7A 3O35A 2XOZA 2MT5A 5B77A 2F6NA 3SOXA 5B8DA 1CHCA 2MNYA 2HDPA 5B75A 1VD4A 2VJEA 4QQ4A 3EB5A 4V3KC 3SOUA 4BHWA 3ZPV1 4LLBA 3ZTGA 2YQLA 2KYUA 2BAYA 3DDTA 3FAOA 3DPLR 3GV4A 2DJAA 1FBVA 3DWDA 2ZETC 2CONA 3T6RA 4R7EA 2PUYA 2ECTA 5DKAA 2D8SA 3VK6A 1MBMA 1WEWA 1VYXA 3FL2A 3LQIA 3ZNIA 3L1ZB 4FJCA 3M62A 4NN2A 2RSDA 4FO9A 3O34A 4FK5A 4LJNA 4S3OB 2IQJA 2XP0A 3RPGB 4UI9B 2H0DB 2KIZA 5TABA 4PPEA 4Q6FA 4QF2A 2KE1A 5FEYA 1LDKC 4X3GA 2CSYA 2VJEB 2FSAA 3M7KA 1RMDA 2FD4A 4I7DA 2ECIA 3V43A 2YU4A 4BBQA 2JMJA 1ZBDB 3L11A 2CSVA 5LKUA 2Y1NA 2EXUA 2L75A 5AIUA 3KQIA 2JUNA 2LN0A 3N9QA 5H1TA 4YATA 5FERA 3RPGC 5TRBA 3HCUA 4I7BA 4S3OC 4OGEA 2VNFA 2XEUA 2L80A 2CT2A 3ZVYA 2F6JA 2KWNA 2CRWA 4A4CA 4MVTA 4WZ0A 5SVIB 2AN6A 3ASLA 5C13A 2LGKA 2YSMA 3E2DA 2YHNA 3M99A 3KV6A 5JG6A 4YBSA 5SVXA 3DQVR 2CKLA 5D1MB 5EYAF 3ZVZB 4UP0A 3LVRE 2F42A 2E6RA 1WENA 3QZVA 2K16A 4ZUXU 4AVXA 2OWAA 2ECWA 5B78A 5B79A 2QIZA 3LVQE 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 2JRJA 3RTRB 4F1PA 5H9MA 2K4DA 4I7CA 3KNVA 2KGGA 2LDRA 2G43A 2JMIA 3HTKC 5C11A 4UP5A 4FIPA 1V87A 3GL6A 4AYCB 5FB1A 3EB6A 2EGMA 2KKXA 2L43A 2JMDA 5K3QA 4YAXA 2G6QA 2XOCA 2YREA 5KH7A 2QJ0A 3HCTA 2FFWA 2YVRA 5G0FA 3O7AA 1WFKA 5AITA 2VPDA 1HYIA 2K1JA 1Z2QA 2M6MA 3U5OA 3U5MA 4N3WA 3MDBC 3PURA 2NAAA 2RI7A 2L7PA 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 2YUCA 2EODA 4AUQB 4CA1A 5I3LA 4GNFA 4MSXA 2KWKA 2E61A 2YQMA 4O62A 2MKEA 2I50A 4W4UA 2KKYA 2LXHC 1WIMA 5LCWB 1DCQA 1WILA 5SVIA 5DINA 3ZYQA 4A4BA 2UZGA 5B76A 4YADA 4AYCA 4CCGX 2FUIA 2DX8A 5D1KB 3O36A 2P57A 3FANA 4YC9A 2MUMA 2D8UA 2LQ6A 3C6WA 3Q1DA 1BORA 3L1XA 1IYMA 4ZQLA 3LJUX 5J3XA 1WEQA 2M1RA 4XI1A 1X4IA 3O70A 5SVYA 4LK9A 4GB0A 3O47A 4Z0RA 2C2VS 3KV5A 4IC2A 3N9MA 2EA6A 1XWHA 2HYED 4F52B 3HCSA 4LADB 2Y1MA 2MA5A 2CRRA 4GNEA 4YABA 1MM2A 1Z60A 3U5PA 1Z6UA 3T7LA 2ECVA 3N9NA 1N87A 4OGCA 3ZPVE 2VPEA 1DVPA 3MHHA 3FJUB 2KFTA 4V3LC 5H1VA 2PNXA 3KDEC 2LGVA 2G45A 3LRQA 4P5OB 4GNDA 4QF3A 2KR4A 4WA6A 4B7YC 4Z0OA 3I2DA 2KU3A 3FM8C 2LRIC 2MA6A 4YBTA 2L0BA 4PTBA 4R8PK 2YW8A 2LV9A 1T1HA 5D1LB 2M85A 1FP0A 3LDYA 1WESA 2IDAA 2Y43A 4WZ3B 4TKPB 3O33A 2E6SA 3LQJA 1WEPA 4L7XA 4A49A 1HYJA 4YBMA 2CKLB 2MD8C 1JM7B 3MHSA 2VJFB 1WE9A 4B86C 1G25A 2VPBA 2YSJA
chains in the Genus database with same CATH topology
1WEOA 5H1UA 3NG2A 4O64A 4LKAA 3U5NA 5KH3A 3LQHA 2KGIA 1WEMA 1VFYA 2YHOA 2L5UA 2KWJA 4N4FA 4R2YA 4AP4A 1JOCA 5FB0A 2CSZA 2MIQA 2EGPA 4L58A 2KREA 2KWOA 1WEUA 1MM3A 2FUUA 2H0DA 2K17A 1WGMA 2VJFA 2XB1A 2MD7B 5G04B 1E4UA 2M3HA 5LKXA 2ECJA 2OXQC 4WZ2A 4C9ZA 1WEEA 2C2LA 3N9PA 2VPGA 3PHDA 5LKTA 3SOWA 2QICA 4IC3A 5G05B 1F62A 4GNGA 1K2FA 2ECNA 3O37A 1JM7A 5TBNA 3N9LA 5TDRA 3SHBA 5LKZA 5TDWA 1WEVA 3M63A 2MNZA 2YURA 1X4UA 3C5KA 2LXPC 3IHPA 2LGGA 2YYRA 2VP7A 3O35A 2MT5A 5B77A 2F6NA 3SOXA 5B8DA 1CHCA 2MNYA 2HDPA 5B75A 1VD4A 2VJEA 3EB5A 4V3KC 3SOUA 4BHWA 3ZPV1 4LLBA 3ZTGA 2YQLA 2KYUA 2BAYA 3DPLR 3GV4A 1FBVA 2ZETC 3T6RA 4R7EA 2PUYA 2ECTA 5DKAA 2D8SA 3VK6A 1WEWA 1VYXA 3FL2A 3LQIA 3ZNIA 3L1ZB 4FJCA 3M62A 4NN2A 2RSDA 4FO9A 3O34A 4FK5A 4LJNA 4S3OB 3RPGB 4UI9B 2H0DB 2KIZA 5TABA 4PPEA 4Q6FA 4QF2A 2KE1A 5FEYA 1LDKC 4X3GA 2CSYA 2VJEB 2FSAA 1RMDA 3V43A 4I7DA 2ECIA 2YU4A 4BBQA 2JMJA 1ZBDB 3L11A 5LKUA 2Y1NA 2L75A 5AIUA 3KQIA 2LN0A 3N9QA 5H1TA 4YATA 5FERA 3RPGC 5TRBA 3HCUA 4I7BA 4S3OC 2VNFA 2XEUA 2L80A 2CT2A 3ZVYA 2F6JA 2KWNA 4A4CA 4MVTA 4WZ0A 2AN6A 3ASLA 5C13A 2LGKA 2YSMA 2YHNA 3M99A 3KV6A 5JG6A 4YBSA 3DQVR 2CKLA 5D1MB 5EYAF 3ZVZB 4UP0A 2F42A 2E6RA 1WENA 3QZVA 2K16A 4ZUXU 4AVXA 2ECWA 5B78A 5B79A 2QIZA 3PUQA 1U6GB 5KH9A 2ECGA 3N9OA 4A0CD 2JRJA 3RTRB 5H9MA 2K4DA 4I7CA 3KNVA 2KGGA 2LDRA 2G43A 2JMIA 3HTKC 5C11A 4UP5A 4FIPA 1V87A 3GL6A 4AYCB 5FB1A 3EB6A 2L43A 2JMDA 4YAXA 2G6QA 2YREA 5KH7A 2QJ0A 3HCTA 5G0FA 3O7AA 1WFKA 5AITA 2VPDA 1HYIA 2K1JA 1Z2QA 2M6MA 3U5OA 3U5MA 4N3WA 3PURA 2NAAA 2RI7A 1LDJB 4ZDTA 2YT5A 1X4JA 2LGLA 2YUCA 2EODA 4AUQB 4CA1A 5I3LA 4GNFA 4MSXA 2KWKA 2YQMA 2I50A 4W4UA 2LXHC 1WIMA 5LCWB 1WILA 5DINA 3ZYQA 4A4BA 2UZGA 5B76A 4YADA 4AYCA 4CCGX 2FUIA 2DX8A 5D1KB 3O36A 4YC9A 2MUMA 2LQ6A 3C6WA 1BORA 3L1XA 1IYMA 4ZQLA 5J3XA 1WEQA 2M1RA 4XI1A 1X4IA 3O70A 4LK9A 4GB0A 2C2VS 3KV5A 4IC2A 3N9MA 2EA6A 1XWHA 2HYED 4F52B 3HCSA 4LADB 2Y1MA 2MA5A 4GNEA 4YABA 1MM2A 1Z60A 3U5PA 1Z6UA 3T7LA 2ECVA 3N9NA 1N87A 3ZPVE 2VPEA 1DVPA 3MHHA 2KFTA 4V3LC 5H1VA 2PNXA 2LGVA 2G45A 3LRQA 4P5OB 4GNDA 4QF3A 2KR4A 4WA6A 4B7YC 3I2DA 2KU3A 2LRIC 2MA6A 4YBTA 2L0BA 4PTBA 4R8PK 2YW8A 2LV9A 1T1HA 5D1LB 2M85A 1FP0A 1WESA 2IDAA 2Y43A 4WZ3B 4TKPB 3O33A 2E6SA 3LQJA 1WEPA 4L7XA 4A49A 1HYJA 4YBMA 2CKLB 2MD8C 1JM7B 3MHSA 2VJFB 1WE9A 4B86C 1G25A 2VPBA 2YSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEO A;  5H1U A;  3NG2 A;  4O64 A;  4LKA A;  3U5N A;  5KH3 A;  3LQH A;  2KGI A;  1WEM A;  1VFY A;  2YHO A;  2L5U A;  2KWJ A;  4N4F A;  4R2Y A;  4AP4 A;  1JOC A;  5FB0 A;  2CSZ A;  2MIQ A;  2EGP A;  4L58 A;  2KRE A;  2KWO A;  1WEU A;  1MM3 A;  2FUU A;  2H0D A;  2K17 A;  1WGM A;  2VJF A;  2XB1 A;  2MD7 B;  5G04 B;  1E4U A;  2M3H A;  5LKX A;  2ECJ A;  2OXQ C;  4WZ2 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  3PHD A;  5LKT A;  3SOW A;  2QIC A;  4IC3 A;  5G05 B;  1F62 A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  1JM7 A;  5TBN A;  3N9L A;  5TDR A;  3SHB A;  5LKZ A;  5TDW A;  1WEV A;  3M63 A;  2MNZ A;  2YUR A;  1X4U A;  3C5K A;  2LXP C;  3IHP A;  2LGG A;  2YYR A;  2VP7 A;  3O35 A;  2MT5 A;  5B77 A;  2F6N A;  3SOX A;  5B8D A;  1CHC A;  2MNY A;  2HDP A;  5B75 A;  1VD4 A;  2VJE A;  3EB5 A;  4V3K C;  3SOU A;  4BHW A;  3ZPV 1;  4LLB A;  3ZTG A;  2YQL A;  2KYU A;  2BAY A;  3DPL R;  3GV4 A;  1FBV A;  2ZET C;  3T6R A;  4R7E A;  2PUY A;  2ECT A;  5DKA A;  2D8S A;  3VK6 A;  1WEW A;  1VYX A;  3FL2 A;  3LQI A;  3ZNI A;  3L1Z B;  4FJC A;  3M62 A;  4NN2 A;  2RSD A;  4FO9 A;  3O34 A;  4FK5 A;  4LJN A;  4S3O B;  3RPG B;  4UI9 B;  2H0D B;  2KIZ A;  5TAB A;  4PPE A;  4Q6F A;  4QF2 A;  2KE1 A;  5FEY A;  1LDK C;  4X3G A;  2CSY A;  2VJE B;  2FSA A;  1RMD A;  3V43 A;  4I7D A;  2ECI A;  2YU4 A;  4BBQ A;  2JMJ A;  1ZBD B;  3L11 A;  5LKU A;  2Y1N A;  2L75 A;  5AIU A;  3KQI A;  2LN0 A;  3N9Q A;  5H1T A;  4YAT A;  5FER A;  3RPG C;  5TRB A;  3HCU A;  4I7B A;  4S3O C;  2VNF A;  2XEU A;  2L80 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  4A4C A;  4MVT A;  4WZ0 A;  2AN6 A;  3ASL A;  5C13 A;  2LGK A;  2YSM A;  2YHN A;  3M99 A;  3KV6 A;  5JG6 A;  4YBS A;  3DQV R;  2CKL A;  5D1M B;  5EYA F;  3ZVZ B;  4UP0 A;  2F42 A;  2E6R A;  1WEN A;  3QZV A;  2K16 A;  4ZUX U;  4AVX A;  2ECW A;  5B78 A;  5B79 A;  2QIZ A;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  2JRJ A;  3RTR B;  5H9M A;  2K4D A;  4I7C A;  3KNV A;  2KGG A;  2LDR A;  2G43 A;  2JMI A;  3HTK C;  5C11 A;  4UP5 A;  4FIP A;  1V87 A;  3GL6 A;  4AYC B;  5FB1 A;  3EB6 A;  2L43 A;  2JMD A;  4YAX A;  2G6Q A;  2YRE A;  5KH7 A;  2QJ0 A;  3HCT A;  5G0F A;  3O7A A;  1WFK A;  5AIT A;  2VPD A;  1HYI A;  2K1J A;  1Z2Q A;  2M6M A;  3U5O A;  3U5M A;  4N3W A;  3PUR A;  2NAA A;  2RI7 A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  2YUC A;  2EOD A;  4AUQ B;  4CA1 A;  5I3L A;  4GNF A;  4MSX A;  2KWK A;  2YQM A;  2I50 A;  4W4U A;  2LXH C;  1WIM A;  5LCW B;  1WIL A;  5DIN A;  3ZYQ A;  4A4B A;  2UZG A;  5B76 A;  4YAD A;  4AYC A;  4CCG X;  2FUI A;  2DX8 A;  5D1K B;  3O36 A;  4YC9 A;  2MUM A;  2LQ6 A;  3C6W A;  1BOR A;  3L1X A;  1IYM A;  4ZQL A;  5J3X A;  1WEQ A;  2M1R A;  4XI1 A;  1X4I A;  3O70 A;  4LK9 A;  4GB0 A;  2C2V S;  3KV5 A;  4IC2 A;  3N9M A;  2EA6 A;  1XWH A;  2HYE D;  4F52 B;  3HCS A;  4LAD B;  2Y1M A;  2MA5 A;  4GNE A;  4YAB A;  1MM2 A;  1Z60 A;  3U5P A;  1Z6U A;  3T7L A;  2ECV A;  3N9N A;  1N87 A;  3ZPV E;  2VPE A;  1DVP A;  3MHH A;  2KFT A;  4V3L C;  5H1V A;  2PNX A;  2LGV A;  2G45 A;  3LRQ A;  4P5O B;  4GND A;  4QF3 A;  2KR4 A;  4WA6 A;  4B7Y C;  3I2D A;  2KU3 A;  2LRI C;  2MA6 A;  4YBT A;  2L0B A;  4PTB A;  4R8P K;  2YW8 A;  2LV9 A;  1T1H A;  5D1L B;  2M85 A;  1FP0 A;  1WES A;  2IDA A;  2Y43 A;  4WZ3 B;  4TKP B;  3O33 A;  2E6S A;  3LQJ A;  1WEP A;  4L7X A;  4A49 A;  1HYJ A;  4YBM A;  2CKL B;  2MD8 C;  1JM7 B;  3MHS A;  2VJF B;  1WE9 A;  4B86 C;  1G25 A;  2VPB A;  2YSJ A; 
#chains in the Genus database with same CATH topology
 1WEO A;  3SUB A;  5H1U A;  3NG2 A;  4O64 A;  4LKA A;  3U5N A;  5KH3 A;  3JUE A;  3LQH A;  2KGI A;  1WEM A;  1VFY A;  2M13 A;  2YHO A;  2L5U A;  2KWJ A;  2B0O E;  4N4F A;  4R2Y A;  4AP4 A;  1JOC A;  5FB0 A;  2CSZ A;  2DSM A;  2MIQ A;  2EGP A;  3PLW A;  4L58 A;  3T9K A;  2KRE A;  2KWO A;  1WEU A;  1MM3 A;  2FUU A;  2H0D A;  2K17 A;  2RR4 A;  1WGM A;  2VJF A;  2XB1 A;  2MD7 B;  5G04 B;  1E4U A;  2M3H A;  2JM3 A;  5LKX A;  2ECJ A;  2OXQ C;  4WZ2 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  4H9D A;  3PHD A;  5LKT A;  3SOW A;  2LAU A;  2QIC A;  4IC3 A;  5G05 B;  1F62 A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  1JM7 A;  5TBN A;  3N9L A;  5TDR A;  3SHB A;  5LKZ A;  3H7H A;  5TDW A;  1WEV A;  3FEH A;  3M63 A;  2MNZ A;  2YUR A;  3C5K A;  1X4U A;  2XOY A;  2LXP C;  3IHP A;  2LGG A;  2YYR A;  2VP7 A;  3O35 A;  2XOZ A;  2MT5 A;  5B77 A;  2F6N A;  3SOX A;  5B8D A;  1CHC A;  2MNY A;  2HDP A;  5B75 A;  1VD4 A;  2VJE A;  4QQ4 A;  3EB5 A;  4V3K C;  3SOU A;  4BHW A;  3ZPV 1;  4LLB A;  3ZTG A;  2YQL A;  2KYU A;  2BAY A;  3DDT A;  3FAO A;  3DPL R;  3GV4 A;  2DJA A;  1FBV A;  3DWD A;  2ZET C;  2CON A;  3T6R A;  4R7E A;  2PUY A;  2ECT A;  5DKA A;  2D8S A;  3VK6 A;  1MBM A;  1WEW A;  1VYX A;  3FL2 A;  3LQI A;  3ZNI A;  3L1Z B;  4FJC A;  3M62 A;  4NN2 A;  2RSD A;  4FO9 A;  3O34 A;  4FK5 A;  4LJN A;  4S3O B;  2IQJ A;  2XP0 A;  3RPG B;  4UI9 B;  2H0D B;  2KIZ A;  5TAB A;  4PPE A;  4Q6F A;  4QF2 A;  2KE1 A;  5FEY A;  1LDK C;  4X3G A;  2CSY A;  2VJE B;  2FSA A;  3M7K A;  1RMD A;  2FD4 A;  4I7D A;  2ECI A;  3V43 A;  2YU4 A;  4BBQ A;  2JMJ A;  1ZBD B;  3L11 A;  2CSV A;  5LKU A;  2Y1N A;  2EXU A;  2L75 A;  5AIU A;  3KQI A;  2JUN A;  2LN0 A;  3N9Q A;  5H1T A;  4YAT A;  5FER A;  3RPG C;  5TRB A;  3HCU A;  4I7B A;  4S3O C;  4OGE A;  2VNF A;  2XEU A;  2L80 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  2CRW A;  4A4C A;  4MVT A;  4WZ0 A;  5SVI B;  2AN6 A;  3ASL A;  5C13 A;  2LGK A;  2YSM A;  3E2D A;  2YHN A;  3M99 A;  3KV6 A;  5JG6 A;  4YBS A;  5SVX A;  3DQV R;  2CKL A;  5D1M B;  5EYA F;  3ZVZ B;  4UP0 A;  3LVR E;  2F42 A;  2E6R A;  1WEN A;  3QZV A;  2K16 A;  4ZUX U;  4AVX A;  2OWA A;  2ECW A;  5B78 A;  5B79 A;  2QIZ A;  3LVQ E;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  2JRJ A;  3RTR B;  4F1P A;  5H9M A;  2K4D A;  4I7C A;  3KNV A;  2KGG A;  2LDR A;  2G43 A;  2JMI A;  3HTK C;  5C11 A;  4UP5 A;  4FIP A;  1V87 A;  3GL6 A;  4AYC B;  5FB1 A;  3EB6 A;  2EGM A;  2KKX A;  2L43 A;  2JMD A;  5K3Q A;  4YAX A;  2G6Q A;  2XOC A;  2YRE A;  5KH7 A;  2QJ0 A;  3HCT A;  2FFW A;  2YVR A;  5G0F A;  3O7A A;  1WFK A;  5AIT A;  2VPD A;  1HYI A;  2K1J A;  1Z2Q A;  2M6M A;  3U5O A;  3U5M A;  4N3W A;  3MDB C;  3PUR A;  2NAA A;  2RI7 A;  2L7P A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  2YUC A;  2EOD A;  4AUQ B;  4CA1 A;  5I3L A;  4GNF A;  4MSX A;  2KWK A;  2E61 A;  2YQM A;  4O62 A;  2MKE A;  2I50 A;  4W4U A;  2KKY A;  2LXH C;  1WIM A;  5LCW B;  1DCQ A;  1WIL A;  5SVI A;  5DIN A;  3ZYQ A;  4A4B A;  2UZG A;  5B76 A;  4YAD A;  4AYC A;  4CCG X;  2FUI A;  2DX8 A;  5D1K B;  3O36 A;  2P57 A;  3FAN A;  4YC9 A;  2MUM A;  2D8U A;  2LQ6 A;  3C6W A;  3Q1D A;  1BOR A;  3L1X A;  1IYM A;  4ZQL A;  3LJU X;  5J3X A;  1WEQ A;  2M1R A;  4XI1 A;  1X4I A;  3O70 A;  5SVY A;  4LK9 A;  4GB0 A;  3O47 A;  4Z0R A;  2C2V S;  3KV5 A;  4IC2 A;  3N9M A;  2EA6 A;  1XWH A;  2HYE D;  4F52 B;  3HCS A;  4LAD B;  2Y1M A;  2MA5 A;  2CRR A;  4GNE A;  4YAB A;  1MM2 A;  1Z60 A;  3U5P A;  1Z6U A;  3T7L A;  2ECV A;  3N9N A;  1N87 A;  4OGC A;  3ZPV E;  2VPE A;  1DVP A;  3MHH A;  3FJU B;  2KFT A;  4V3L C;  5H1V A;  2PNX A;  3KDE C;  2LGV A;  2G45 A;  3LRQ A;  4P5O B;  4GND A;  4QF3 A;  2KR4 A;  4WA6 A;  4B7Y C;  4Z0O A;  3I2D A;  2KU3 A;  3FM8 C;  2LRI C;  2MA6 A;  4YBT A;  2L0B A;  4PTB A;  4R8P K;  2YW8 A;  2LV9 A;  1T1H A;  5D1L B;  2M85 A;  1FP0 A;  3LDY A;  1WES A;  2IDA A;  2Y43 A;  4WZ3 B;  4TKP B;  3O33 A;  2E6S A;  3LQJ A;  1WEP A;  4L7X A;  4A49 A;  1HYJ A;  4YBM A;  2CKL B;  2MD8 C;  1JM7 B;  3MHS A;  2VJF B;  1WE9 A;  4B86 C;  1G25 A;  2VPB A;  2YSJ A; 
#chains in the Genus database with same CATH homology
 1WEO A;  5H1U A;  3NG2 A;  4O64 A;  4LKA A;  3U5N A;  5KH3 A;  3LQH A;  2KGI A;  1WEM A;  1VFY A;  2YHO A;  2L5U A;  2KWJ A;  4N4F A;  4R2Y A;  4AP4 A;  1JOC A;  5FB0 A;  2CSZ A;  2MIQ A;  2EGP A;  4L58 A;  2KRE A;  2KWO A;  1WEU A;  1MM3 A;  2FUU A;  2H0D A;  2K17 A;  1WGM A;  2VJF A;  2XB1 A;  2MD7 B;  5G04 B;  1E4U A;  2M3H A;  5LKX A;  2ECJ A;  2OXQ C;  4WZ2 A;  4C9Z A;  1WEE A;  2C2L A;  3N9P A;  2VPG A;  3PHD A;  5LKT A;  3SOW A;  2QIC A;  4IC3 A;  5G05 B;  1F62 A;  4GNG A;  1K2F A;  2ECN A;  3O37 A;  1JM7 A;  5TBN A;  3N9L A;  5TDR A;  3SHB A;  5LKZ A;  5TDW A;  1WEV A;  3M63 A;  2MNZ A;  2YUR A;  1X4U A;  3C5K A;  2LXP C;  3IHP A;  2LGG A;  2YYR A;  2VP7 A;  3O35 A;  2MT5 A;  5B77 A;  2F6N A;  3SOX A;  5B8D A;  1CHC A;  2MNY A;  2HDP A;  5B75 A;  1VD4 A;  2VJE A;  3EB5 A;  4V3K C;  3SOU A;  4BHW A;  3ZPV 1;  4LLB A;  3ZTG A;  2YQL A;  2KYU A;  2BAY A;  3DPL R;  3GV4 A;  1FBV A;  2ZET C;  3T6R A;  4R7E A;  2PUY A;  2ECT A;  5DKA A;  2D8S A;  3VK6 A;  1WEW A;  1VYX A;  3FL2 A;  3LQI A;  3ZNI A;  3L1Z B;  4FJC A;  3M62 A;  4NN2 A;  2RSD A;  4FO9 A;  3O34 A;  4FK5 A;  4LJN A;  4S3O B;  3RPG B;  4UI9 B;  2H0D B;  2KIZ A;  5TAB A;  4PPE A;  4Q6F A;  4QF2 A;  2KE1 A;  5FEY A;  1LDK C;  4X3G A;  2CSY A;  2VJE B;  2FSA A;  1RMD A;  3V43 A;  4I7D A;  2ECI A;  2YU4 A;  4BBQ A;  2JMJ A;  1ZBD B;  3L11 A;  5LKU A;  2Y1N A;  2L75 A;  5AIU A;  3KQI A;  2LN0 A;  3N9Q A;  5H1T A;  4YAT A;  5FER A;  3RPG C;  5TRB A;  3HCU A;  4I7B A;  4S3O C;  2VNF A;  2XEU A;  2L80 A;  2CT2 A;  3ZVY A;  2F6J A;  2KWN A;  4A4C A;  4MVT A;  4WZ0 A;  2AN6 A;  3ASL A;  5C13 A;  2LGK A;  2YSM A;  2YHN A;  3M99 A;  3KV6 A;  5JG6 A;  4YBS A;  3DQV R;  2CKL A;  5D1M B;  5EYA F;  3ZVZ B;  4UP0 A;  2F42 A;  2E6R A;  1WEN A;  3QZV A;  2K16 A;  4ZUX U;  4AVX A;  2ECW A;  5B78 A;  5B79 A;  2QIZ A;  3PUQ A;  1U6G B;  5KH9 A;  2ECG A;  3N9O A;  4A0C D;  2JRJ A;  3RTR B;  5H9M A;  2K4D A;  4I7C A;  3KNV A;  2KGG A;  2LDR A;  2G43 A;  2JMI A;  3HTK C;  5C11 A;  4UP5 A;  4FIP A;  1V87 A;  3GL6 A;  4AYC B;  5FB1 A;  3EB6 A;  2L43 A;  2JMD A;  4YAX A;  2G6Q A;  2YRE A;  5KH7 A;  2QJ0 A;  3HCT A;  5G0F A;  3O7A A;  1WFK A;  5AIT A;  2VPD A;  1HYI A;  2K1J A;  1Z2Q A;  2M6M A;  3U5O A;  3U5M A;  4N3W A;  3PUR A;  2NAA A;  2RI7 A;  1LDJ B;  4ZDT A;  2YT5 A;  1X4J A;  2LGL A;  2YUC A;  2EOD A;  4AUQ B;  4CA1 A;  5I3L A;  4GNF A;  4MSX A;  2KWK A;  2YQM A;  2I50 A;  4W4U A;  2LXH C;  1WIM A;  5LCW B;  1WIL A;  5DIN A;  3ZYQ A;  4A4B A;  2UZG A;  5B76 A;  4YAD A;  4AYC A;  4CCG X;  2FUI A;  2DX8 A;  5D1K B;  3O36 A;  4YC9 A;  2MUM A;  2LQ6 A;  3C6W A;  1BOR A;  3L1X A;  1IYM A;  4ZQL A;  5J3X A;  1WEQ A;  2M1R A;  4XI1 A;  1X4I A;  3O70 A;  4LK9 A;  4GB0 A;  2C2V S;  3KV5 A;  4IC2 A;  3N9M A;  2EA6 A;  1XWH A;  2HYE D;  4F52 B;  3HCS A;  4LAD B;  2Y1M A;  2MA5 A;  4GNE A;  4YAB A;  1MM2 A;  1Z60 A;  3U5P A;  1Z6U A;  3T7L A;  2ECV A;  3N9N A;  1N87 A;  3ZPV E;  2VPE A;  1DVP A;  3MHH A;  2KFT A;  4V3L C;  5H1V A;  2PNX A;  2LGV A;  2G45 A;  3LRQ A;  4P5O B;  4GND A;  4QF3 A;  2KR4 A;  4WA6 A;  4B7Y C;  3I2D A;  2KU3 A;  2LRI C;  2MA6 A;  4YBT A;  2L0B A;  4PTB A;  4R8P K;  2YW8 A;  2LV9 A;  1T1H A;  5D1L B;  2M85 A;  1FP0 A;  1WES A;  2IDA A;  2Y43 A;  4WZ3 B;  4TKP B;  3O33 A;  2E6S A;  3LQJ A;  1WEP A;  4L7X A;  4A49 A;  1HYJ A;  4YBM A;  2CKL B;  2MD8 C;  1JM7 B;  3MHS A;  2VJF B;  1WE9 A;  4B86 C;  1G25 A;  2VPB A;  2YSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...