1ZBDB

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
EELTDEEKEIINRVIARAEKMETMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSASVVCEDCKKNVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RABPHILIN-3A
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags G protein
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02318 FYVE_2 FYVE-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1zbdB00
3HTKC 2Y43A 3N9NA 4F52B 3SHBA 3ZVZB 4Q6FA 4WA6A 3PUQA 3MHSA 2ECNA 3N9QA 2JRJA 2VJFA 1JM7B 2ZETC 3ZVYA 4ZDTA 3O37A 1U6GB 2K1JA 3SOWA 3RPGC 1WE9A 1WFKA 4S3OC 1WGMA 2KR4A 3LQHA 3N9OA 2MNYA 1WEPA 3T6RA 2I50A 3ZYQA 5FB0A 3L1ZB 2F42A 1WEVA 3LQJA 2LQ6A 4AUQB 2MA6A 4L7XA 4X3GA 2HDPA 2UZGA 1VYXA 4AP4A 4LLBA 2LXHC 3RPGB 3SOXA 4S3OB 3FL2A 1K2FA 2KWOA 4FJCA 4C9ZA 4A0CD 4I7BA 3O35A 4P5OB 5DKAA 2KGIA 3O33A 4YATA 1N87A 2L80A 1G25A 4IC2A 2QIZA 3NG2A 5FEYA 3MHHA 5H9MA 3EB6A 2QJ0A 4FIPA 5TABA 3N9LA 2M3HA 2JMJA 2MA5A 5B8DA 4CA1A 3O70A 4TKPB 2PUYA 2KWKA 2YHOA 3DQVR 2ECVA 2YW8A 2JMIA 1HYJA 2VJEA 3DPLR 4LJNA 2Y1NA 2MD8C 5LKUA 5G04B 2YQLA 4AVXA 4FK5A 2HYED 5H1VA 3ZPV1 2LDRA 4YBSA 1JOCA 1IYMA 2VP7A 4YAXA 3KV5A 4YADA 3ASLA 4R8PK 2DX8A 5H1TA 1JM7A 3RTRB 1Z6UA 5B79A 2F6JA 1WEQA 4GNFA 4QF3A 3VK6A 3QZVA 4MVTA 2LV9A 4WZ0A 2KIZA 4B86C 5B78A 1X4JA 2YSJA 5JG6A 4ZUXU 4A49A 1WEWA 5B77A 2K4DA 1LDJB 2LRIC 5D1KB 2FUUA 4QF2A 4BBQA 2LXPC 5TDWA 2G45A 2YQMA 5KH3A 2KYUA 3M62A 2XB1A 4B7YC 2CKLA 2M6MA 4NN2A 4V3KC 2MUMA 3ZTGA 4A4BA 1WEUA 2YSMA 3U5PA 4LK9A 2CSZA 2KE1A 2YT5A 1Z60A 3ZNIA 4GB0A 3LQIA 4XI1A 4CCGX 2YYRA 4BHWA 2AN6A 2RSDA 2KFTA 2FSAA 2F6NA 2XEUA 5LKXA 2CKLB 4N4FA 2LGLA 3O7AA 5TDRA 2OXQC 3PHDA 1T1HA 2ECGA 1HYIA 4UP5A 3U5NA 2L5UA 2ECTA 5FERA 3SOUA 1MM2A 2C2LA 4PPEA 4YC9A 5LKTA 2KWJA 3M63A 4MSXA 2E6SA 3V43A 2MD7B 5LCWB 1RMDA 3C6WA 3O34A 4PTBA 2G6QA 1DVPA 3O36A 5J3XA 1F62A 5B75A 2VPBA 4I7DA 4LADB 3HCSA 4R2YA 2MT5A 1VD4A 1FP0A 5C11A 2MNZA 2KREA 2EODA 2K17A 2CT2A 2VPGA 4AYCB 2H0DA 1X4UA 2L75A 4UI9B 5I3LA 2EA6A 5AIUA 1FBVA 5TRBA 4W4UA 2L43A 4IC3A 1WESA 2YURA 1XWHA 2C2VS 2ECJA 3C5KA 2Y1MA 2KU3A 2H0DB 1MM3A 2E6RA 3M99A 1WEOA 4A4CA 1WILA 2CSYA 2PNXA 2VPDA 2YU4A 3GL6A 5FB1A 5G0FA 2YREA 4YBTA 3U5MA 2YHNA 2ECWA 4UP0A 5B76A 4GNDA 1V87A 2G43A 2M1RA 1WIMA 2ECIA 4I7CA 4L58A 4GNGA 3HCTA 5LKZA 5H1UA 2VJFB 2JMDA 1BORA 3LRQA 5G05B 2L0BA 1VFYA 4YABA 3KNVA 3EB5A 2M85A 2BAYA 2FUIA 2K16A 4V3LC 2LGVA 4FO9A 1WEEA 2LGKA 2EGPA 2IDAA 2RI7A 5TBNA 3ZPVE 4GNEA 5KH7A 4WZ3B 4WZ2A 4N3WA 2LGGA 2QICA 5C13A 2YUCA 3I2DA 4AYCA 5D1LB 4ZQLA 5EYAF 2NAAA 3KQIA 3KV6A 4O64A 3L1XA 1CHCA 3L11A 3U5OA 2KGGA 4R7EA 3N9MA 4YBMA 4LKAA 1ZBDB 2VNFA 3HCUA 3N9PA 5D1MB 5KH9A 2VJEB 1LDKC 3IHPA 1Z2QA 2KWNA 5DINA 1X4IA 3GV4A 3PURA 2VPEA 5AITA 3T7LA 2D8SA 1WENA 2LN0A 1WEMA 1E4UA 2MIQA
chains in the Genus database with same CATH superfamily
3HTKC 2Y43A 3N9NA 4F52B 3SHBA 3ZVZB 2XOCA 4Q6FA 4WA6A 3PUQA 2XP0A 3MHSA 2ECNA 3N9QA 2JRJA 2VJFA 1JM7B 2ZETC 3ZVYA 4ZDTA 3O37A 2M13A 1U6GB 2K1JA 4QQ4A 3SOWA 3RPGC 1WE9A 1WFKA 4S3OC 1WGMA 2KR4A 3LQHA 2JM3A 3LJUX 3N9OA 2MNYA 1WEPA 3T6RA 2I50A 3ZYQA 5FB0A 3L1ZB 2F42A 1WEVA 3JUEA 3LQJA 2LQ6A 4AUQB 2MA6A 4L7XA 4X3GA 2HDPA 2UZGA 1VYXA 2FFWA 4AP4A 3DDTA 4LLBA 2LXHC 3RPGB 3SOXA 4S3OB 3FL2A 1K2FA 2KWOA 3DWDA 1MBMA 4FJCA 4C9ZA 4A0CD 4I7BA 3O35A 4P5OB 5DKAA 2KGIA 3O33A 4YATA 1N87A 2L80A 1G25A 4IC2A 2QIZA 3NG2A 5FEYA 2FD4A 3MHHA 3O47A 5H9MA 3EB6A 2QJ0A 4FIPA 5SVIA 5TABA 3N9LA 2M3HA 2JMJA 2MA5A 2CSVA 5B8DA 4CA1A 3O70A 4O62A 2PUYA 4TKPB 2KWKA 2KKXA 2YHOA 2E61A 3DQVR 2IQJA 2ECVA 4OGEA 2YW8A 2JMIA 1HYJA 2VJEA 3DPLR 4LJNA 2DJAA 2Y1NA 2MD8C 4H9DA 2P57A 5LKUA 3FANA 5G04B 2YVRA 2CONA 3LVQE 2YQLA 4AVXA 4FK5A 2HYED 5H1VA 3ZPV1 2LDRA 4YBSA 1JOCA 1IYMA 2VP7A 4YAXA 3KV5A 4YADA 3ASLA 4R8PK 2DX8A 5H1TA 1JM7A 3RTRB 1Z6UA 5B79A 5K3QA 2F6JA 1WEQA 4GNFA 4QF3A 3VK6A 3QZVA 4MVTA 3LDYA 2LV9A 4WZ0A 2KIZA 4B86C 2DSMA 5B78A 1X4JA 2YSJA 5JG6A 4ZUXU 4A49A 1WEWA 5B77A 2K4DA 2OWAA 1LDJB 2LRIC 5D1KB 2FUUA 4QF2A 4BBQA 2LXPC 2KKYA 5TDWA 3M7KA 2G45A 2YQMA 5KH3A 2KYUA 3M62A 2XB1A 4B7YC 2CKLA 2M6MA 4NN2A 4V3KC 2MUMA 3ZTGA 4A4BA 1WEUA 2YSMA 3U5PA 4LK9A 2CSZA 2KE1A 2YT5A 1Z60A 3ZNIA 4GB0A 3LQIA 4XI1A 4CCGX 2YYRA 4BHWA 2AN6A 2RSDA 2KFTA 2FSAA 2F6NA 2XEUA 5LKXA 2JUNA 2CKLB 4N4FA 2LGLA 3O7AA 5TDRA 2OXQC 3PHDA 2LAUA 1T1HA 2ECGA 1HYIA 2XOZA 4UP5A 2D8UA 3U5NA 2L5UA 2ECTA 5FERA 3SOUA 3KDEC 1MM2A 2C2LA 4PPEA 4YC9A 5LKTA 2KWJA 3M63A 4MSXA 2E6SA 3V43A 2MD7B 5LCWB 3SUBA 1RMDA 3C6WA 3O34A 4PTBA 2G6QA 1DVPA 3O36A 5J3XA 1F62A 4Z0RA 5B75A 2VPBA 4I7DA 4LADB 3HCSA 4R2YA 2MT5A 1VD4A 1FP0A 5C11A 2MKEA 2MNZA 2KREA 2EODA 2K17A 2CT2A 4Z0OA 2VPGA 3FJUB 4AYCB 2H0DA 1X4UA 2L75A 4UI9B 5I3LA 4F1PA 2EA6A 2L7PA 5AIUA 3T9KA 1FBVA 5TRBA 4W4UA 2L43A 3Q1DA 4IC3A 1WESA 2YURA 1XWHA 2C2VS 2ECJA 3C5KA 2EGMA 3E2DA 2Y1MA 2KU3A 2H0DB 1MM3A 5SVYA 2E6RA 3M99A 1WEOA 4A4CA 1WILA 2CSYA 2PNXA 2VPDA 2YU4A 3GL6A 5FB1A 5G0FA 3FM8C 2YREA 3H7HA 4YBTA 3U5MA 2YHNA 2ECWA 4UP0A 3PLWA 5B76A 3FEHA 4GNDA 1V87A 2G43A 2M1RA 1WIMA 2ECIA 2XOYA 4I7CA 4L58A 4GNGA 3HCTA 5LKZA 5H1UA 2VJFB 2JMDA 2CRRA 1BORA 3LRQA 5G05B 2L0BA 1VFYA 4YABA 3KNVA 3EB5A 2M85A 2BAYA 2FUIA 1DCQA 2K16A 5SVXA 4V3LC 2LGVA 4FO9A 1WEEA 2LGKA 2EGPA 2IDAA 2RI7A 5TBNA 3ZPVE 2RR4A 4GNEA 5KH7A 2B0OE 4WZ3B 4WZ2A 4OGCA 2CRWA 4N3WA 2LGGA 2QICA 5C13A 2YUCA 3I2DA 4AYCA 5D1LB 3FAOA 4ZQLA 5EYAF 2NAAA 3KQIA 3LVRE 3KV6A 4O64A 5SVIB 3L1XA 1CHCA 3L11A 3MDBC 3U5OA 2KGGA 4R7EA 3N9MA 4YBMA 4LKAA 1ZBDB 2VNFA 3HCUA 3N9PA 5D1MB 5KH9A 2VJEB 1LDKC 2EXUA 3IHPA 1Z2QA 2KWNA 5DINA 1X4IA 3GV4A 3PURA 2VPEA 5AITA 3T7LA 2D8SA 1WENA 2LN0A 1WEMA 1E4UA 2MIQA
chains in the Genus database with same CATH topology
3HTKC 2Y43A 3N9NA 4F52B 3SHBA 3ZVZB 4Q6FA 4WA6A 3PUQA 3MHSA 2ECNA 3N9QA 2JRJA 2VJFA 1JM7B 2ZETC 3ZVYA 4ZDTA 3O37A 1U6GB 2K1JA 3SOWA 3RPGC 1WE9A 1WFKA 4S3OC 1WGMA 2KR4A 3LQHA 3N9OA 2MNYA 1WEPA 3T6RA 2I50A 3ZYQA 5FB0A 3L1ZB 2F42A 1WEVA 3LQJA 2LQ6A 4AUQB 2MA6A 4L7XA 4X3GA 2HDPA 2UZGA 1VYXA 4AP4A 4LLBA 2LXHC 3RPGB 3SOXA 4S3OB 3FL2A 1K2FA 2KWOA 4FJCA 4C9ZA 4A0CD 4I7BA 3O35A 4P5OB 5DKAA 2KGIA 3O33A 4YATA 1N87A 2L80A 1G25A 4IC2A 2QIZA 3NG2A 5FEYA 3MHHA 5H9MA 3EB6A 2QJ0A 4FIPA 5TABA 3N9LA 2M3HA 2JMJA 2MA5A 5B8DA 4CA1A 3O70A 4TKPB 2PUYA 2KWKA 2YHOA 3DQVR 2ECVA 2YW8A 2JMIA 1HYJA 2VJEA 3DPLR 4LJNA 2Y1NA 2MD8C 5LKUA 5G04B 2YQLA 4AVXA 4FK5A 2HYED 5H1VA 3ZPV1 2LDRA 4YBSA 1JOCA 1IYMA 2VP7A 4YAXA 3KV5A 4YADA 3ASLA 4R8PK 2DX8A 5H1TA 1JM7A 3RTRB 1Z6UA 5B79A 2F6JA 1WEQA 4GNFA 4QF3A 3VK6A 3QZVA 4MVTA 2LV9A 4WZ0A 2KIZA 4B86C 5B78A 1X4JA 2YSJA 5JG6A 4ZUXU 4A49A 1WEWA 5B77A 2K4DA 1LDJB 2LRIC 5D1KB 2FUUA 4QF2A 4BBQA 2LXPC 5TDWA 2G45A 2YQMA 5KH3A 2KYUA 3M62A 2XB1A 4B7YC 2CKLA 2M6MA 4NN2A 4V3KC 2MUMA 3ZTGA 4A4BA 1WEUA 2YSMA 3U5PA 4LK9A 2CSZA 2KE1A 2YT5A 1Z60A 3ZNIA 4GB0A 3LQIA 4XI1A 4CCGX 2YYRA 4BHWA 2AN6A 2RSDA 2KFTA 2FSAA 2F6NA 2XEUA 5LKXA 2CKLB 4N4FA 2LGLA 3O7AA 5TDRA 2OXQC 3PHDA 1T1HA 2ECGA 1HYIA 4UP5A 3U5NA 2L5UA 2ECTA 5FERA 3SOUA 1MM2A 2C2LA 4PPEA 4YC9A 5LKTA 2KWJA 3M63A 4MSXA 2E6SA 3V43A 2MD7B 5LCWB 1RMDA 3C6WA 3O34A 4PTBA 2G6QA 1DVPA 3O36A 5J3XA 1F62A 5B75A 2VPBA 4I7DA 4LADB 3HCSA 4R2YA 2MT5A 1VD4A 1FP0A 5C11A 2MNZA 2KREA 2EODA 2K17A 2CT2A 2VPGA 4AYCB 2H0DA 1X4UA 2L75A 4UI9B 5I3LA 2EA6A 5AIUA 1FBVA 5TRBA 4W4UA 2L43A 4IC3A 1WESA 2YURA 1XWHA 2C2VS 2ECJA 3C5KA 2Y1MA 2KU3A 2H0DB 1MM3A 2E6RA 3M99A 1WEOA 4A4CA 1WILA 2CSYA 2PNXA 2VPDA 2YU4A 3GL6A 5FB1A 5G0FA 2YREA 4YBTA 3U5MA 2YHNA 2ECWA 4UP0A 5B76A 4GNDA 1V87A 2G43A 2M1RA 1WIMA 2ECIA 4I7CA 4L58A 4GNGA 3HCTA 5LKZA 5H1UA 2VJFB 2JMDA 1BORA 3LRQA 5G05B 2L0BA 1VFYA 4YABA 3KNVA 3EB5A 2M85A 2BAYA 2FUIA 2K16A 4V3LC 2LGVA 4FO9A 1WEEA 2LGKA 2EGPA 2IDAA 2RI7A 5TBNA 3ZPVE 4GNEA 5KH7A 4WZ3B 4WZ2A 4N3WA 2LGGA 2QICA 5C13A 2YUCA 3I2DA 4AYCA 5D1LB 4ZQLA 5EYAF 2NAAA 3KQIA 3KV6A 4O64A 3L1XA 1CHCA 3L11A 3U5OA 2KGGA 4R7EA 3N9MA 4YBMA 4LKAA 1ZBDB 2VNFA 3HCUA 3N9PA 5D1MB 5KH9A 2VJEB 1LDKC 3IHPA 1Z2QA 2KWNA 5DINA 1X4IA 3GV4A 3PURA 2VPEA 5AITA 3T7LA 2D8SA 1WENA 2LN0A 1WEMA 1E4UA 2MIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HTK C;  2Y43 A;  3N9N A;  4F52 B;  3SHB A;  3ZVZ B;  4Q6F A;  4WA6 A;  3PUQ A;  3MHS A;  2ECN A;  3N9Q A;  2JRJ A;  2VJF A;  1JM7 B;  2ZET C;  3ZVY A;  4ZDT A;  3O37 A;  1U6G B;  2K1J A;  3SOW A;  3RPG C;  1WE9 A;  1WFK A;  4S3O C;  1WGM A;  2KR4 A;  3LQH A;  3N9O A;  2MNY A;  1WEP A;  3T6R A;  2I50 A;  3ZYQ A;  5FB0 A;  3L1Z B;  2F42 A;  1WEV A;  3LQJ A;  2LQ6 A;  4AUQ B;  2MA6 A;  4L7X A;  4X3G A;  2HDP A;  2UZG A;  1VYX A;  4AP4 A;  4LLB A;  2LXH C;  3RPG B;  3SOX A;  4S3O B;  3FL2 A;  1K2F A;  2KWO A;  4FJC A;  4C9Z A;  4A0C D;  4I7B A;  3O35 A;  4P5O B;  5DKA A;  2KGI A;  3O33 A;  4YAT A;  1N87 A;  2L80 A;  1G25 A;  4IC2 A;  2QIZ A;  3NG2 A;  5FEY A;  3MHH A;  5H9M A;  3EB6 A;  2QJ0 A;  4FIP A;  5TAB A;  3N9L A;  2M3H A;  2JMJ A;  2MA5 A;  5B8D A;  4CA1 A;  3O70 A;  4TKP B;  2PUY A;  2KWK A;  2YHO A;  3DQV R;  2ECV A;  2YW8 A;  2JMI A;  1HYJ A;  2VJE A;  3DPL R;  4LJN A;  2Y1N A;  2MD8 C;  5LKU A;  5G04 B;  2YQL A;  4AVX A;  4FK5 A;  2HYE D;  5H1V A;  3ZPV 1;  2LDR A;  4YBS A;  1JOC A;  1IYM A;  2VP7 A;  4YAX A;  3KV5 A;  4YAD A;  3ASL A;  4R8P K;  2DX8 A;  5H1T A;  1JM7 A;  3RTR B;  1Z6U A;  5B79 A;  2F6J A;  1WEQ A;  4GNF A;  4QF3 A;  3VK6 A;  3QZV A;  4MVT A;  2LV9 A;  4WZ0 A;  2KIZ A;  4B86 C;  5B78 A;  1X4J A;  2YSJ A;  5JG6 A;  4ZUX U;  4A49 A;  1WEW A;  5B77 A;  2K4D A;  1LDJ B;  2LRI C;  5D1K B;  2FUU A;  4QF2 A;  4BBQ A;  2LXP C;  5TDW A;  2G45 A;  2YQM A;  5KH3 A;  2KYU A;  3M62 A;  2XB1 A;  4B7Y C;  2CKL A;  2M6M A;  4NN2 A;  4V3K C;  2MUM A;  3ZTG A;  4A4B A;  1WEU A;  2YSM A;  3U5P A;  4LK9 A;  2CSZ A;  2KE1 A;  2YT5 A;  1Z60 A;  3ZNI A;  4GB0 A;  3LQI A;  4XI1 A;  4CCG X;  2YYR A;  4BHW A;  2AN6 A;  2RSD A;  2KFT A;  2FSA A;  2F6N A;  2XEU A;  5LKX A;  2CKL B;  4N4F A;  2LGL A;  3O7A A;  5TDR A;  2OXQ C;  3PHD A;  1T1H A;  2ECG A;  1HYI A;  4UP5 A;  3U5N A;  2L5U A;  2ECT A;  5FER A;  3SOU A;  1MM2 A;  2C2L A;  4PPE A;  4YC9 A;  5LKT A;  2KWJ A;  3M63 A;  4MSX A;  2E6S A;  3V43 A;  2MD7 B;  5LCW B;  1RMD A;  3C6W A;  3O34 A;  4PTB A;  2G6Q A;  1DVP A;  3O36 A;  5J3X A;  1F62 A;  5B75 A;  2VPB A;  4I7D A;  4LAD B;  3HCS A;  4R2Y A;  2MT5 A;  1VD4 A;  1FP0 A;  5C11 A;  2MNZ A;  2KRE A;  2EOD A;  2K17 A;  2CT2 A;  2VPG A;  4AYC B;  2H0D A;  1X4U A;  2L75 A;  4UI9 B;  5I3L A;  2EA6 A;  5AIU A;  1FBV A;  5TRB A;  4W4U A;  2L43 A;  4IC3 A;  1WES A;  2YUR A;  1XWH A;  2C2V S;  2ECJ A;  3C5K A;  2Y1M A;  2KU3 A;  2H0D B;  1MM3 A;  2E6R A;  3M99 A;  1WEO A;  4A4C A;  1WIL A;  2CSY A;  2PNX A;  2VPD A;  2YU4 A;  3GL6 A;  5FB1 A;  5G0F A;  2YRE A;  4YBT A;  3U5M A;  2YHN A;  2ECW A;  4UP0 A;  5B76 A;  4GND A;  1V87 A;  2G43 A;  2M1R A;  1WIM A;  2ECI A;  4I7C A;  4L58 A;  4GNG A;  3HCT A;  5LKZ A;  5H1U A;  2VJF B;  2JMD A;  1BOR A;  3LRQ A;  5G05 B;  2L0B A;  1VFY A;  4YAB A;  3KNV A;  3EB5 A;  2M85 A;  2BAY A;  2FUI A;  2K16 A;  4V3L C;  2LGV A;  4FO9 A;  1WEE A;  2LGK A;  2EGP A;  2IDA A;  2RI7 A;  5TBN A;  3ZPV E;  4GNE A;  5KH7 A;  4WZ3 B;  4WZ2 A;  4N3W A;  2LGG A;  2QIC A;  5C13 A;  2YUC A;  3I2D A;  4AYC A;  5D1L B;  4ZQL A;  5EYA F;  2NAA A;  3KQI A;  3KV6 A;  4O64 A;  3L1X A;  1CHC A;  3L11 A;  3U5O A;  2KGG A;  4R7E A;  3N9M A;  4YBM A;  4LKA A;  1ZBD B;  2VNF A;  3HCU A;  3N9P A;  5D1M B;  5KH9 A;  2VJE B;  1LDK C;  3IHP A;  1Z2Q A;  2KWN A;  5DIN A;  1X4I A;  3GV4 A;  3PUR A;  2VPE A;  5AIT A;  3T7L A;  2D8S A;  1WEN A;  2LN0 A;  1WEM A;  1E4U A;  2MIQ A; 
#chains in the Genus database with same CATH topology
 3HTK C;  2Y43 A;  3N9N A;  4F52 B;  3SHB A;  3ZVZ B;  2XOC A;  4Q6F A;  4WA6 A;  3PUQ A;  2XP0 A;  3MHS A;  2ECN A;  3N9Q A;  2JRJ A;  2VJF A;  1JM7 B;  2ZET C;  3ZVY A;  4ZDT A;  3O37 A;  2M13 A;  1U6G B;  2K1J A;  4QQ4 A;  3SOW A;  3RPG C;  1WE9 A;  1WFK A;  4S3O C;  1WGM A;  2KR4 A;  3LQH A;  2JM3 A;  3LJU X;  3N9O A;  2MNY A;  1WEP A;  3T6R A;  2I50 A;  3ZYQ A;  5FB0 A;  3L1Z B;  2F42 A;  1WEV A;  3JUE A;  3LQJ A;  2LQ6 A;  4AUQ B;  2MA6 A;  4L7X A;  4X3G A;  2HDP A;  2UZG A;  1VYX A;  2FFW A;  4AP4 A;  3DDT A;  4LLB A;  2LXH C;  3RPG B;  3SOX A;  4S3O B;  3FL2 A;  1K2F A;  2KWO A;  3DWD A;  1MBM A;  4FJC A;  4C9Z A;  4A0C D;  4I7B A;  3O35 A;  4P5O B;  5DKA A;  2KGI A;  3O33 A;  4YAT A;  1N87 A;  2L80 A;  1G25 A;  4IC2 A;  2QIZ A;  3NG2 A;  5FEY A;  2FD4 A;  3MHH A;  3O47 A;  5H9M A;  3EB6 A;  2QJ0 A;  4FIP A;  5SVI A;  5TAB A;  3N9L A;  2M3H A;  2JMJ A;  2MA5 A;  2CSV A;  5B8D A;  4CA1 A;  3O70 A;  4O62 A;  2PUY A;  4TKP B;  2KWK A;  2KKX A;  2YHO A;  2E61 A;  3DQV R;  2IQJ A;  2ECV A;  4OGE A;  2YW8 A;  2JMI A;  1HYJ A;  2VJE A;  3DPL R;  4LJN A;  2DJA A;  2Y1N A;  2MD8 C;  4H9D A;  2P57 A;  5LKU A;  3FAN A;  5G04 B;  2YVR A;  2CON A;  3LVQ E;  2YQL A;  4AVX A;  4FK5 A;  2HYE D;  5H1V A;  3ZPV 1;  2LDR A;  4YBS A;  1JOC A;  1IYM A;  2VP7 A;  4YAX A;  3KV5 A;  4YAD A;  3ASL A;  4R8P K;  2DX8 A;  5H1T A;  1JM7 A;  3RTR B;  1Z6U A;  5B79 A;  5K3Q A;  2F6J A;  1WEQ A;  4GNF A;  4QF3 A;  3VK6 A;  3QZV A;  4MVT A;  3LDY A;  2LV9 A;  4WZ0 A;  2KIZ A;  4B86 C;  2DSM A;  5B78 A;  1X4J A;  2YSJ A;  5JG6 A;  4ZUX U;  4A49 A;  1WEW A;  5B77 A;  2K4D A;  2OWA A;  1LDJ B;  2LRI C;  5D1K B;  2FUU A;  4QF2 A;  4BBQ A;  2LXP C;  2KKY A;  5TDW A;  3M7K A;  2G45 A;  2YQM A;  5KH3 A;  2KYU A;  3M62 A;  2XB1 A;  4B7Y C;  2CKL A;  2M6M A;  4NN2 A;  4V3K C;  2MUM A;  3ZTG A;  4A4B A;  1WEU A;  2YSM A;  3U5P A;  4LK9 A;  2CSZ A;  2KE1 A;  2YT5 A;  1Z60 A;  3ZNI A;  4GB0 A;  3LQI A;  4XI1 A;  4CCG X;  2YYR A;  4BHW A;  2AN6 A;  2RSD A;  2KFT A;  2FSA A;  2F6N A;  2XEU A;  5LKX A;  2JUN A;  2CKL B;  4N4F A;  2LGL A;  3O7A A;  5TDR A;  2OXQ C;  3PHD A;  2LAU A;  1T1H A;  2ECG A;  1HYI A;  2XOZ A;  4UP5 A;  2D8U A;  3U5N A;  2L5U A;  2ECT A;  5FER A;  3SOU A;  3KDE C;  1MM2 A;  2C2L A;  4PPE A;  4YC9 A;  5LKT A;  2KWJ A;  3M63 A;  4MSX A;  2E6S A;  3V43 A;  2MD7 B;  5LCW B;  3SUB A;  1RMD A;  3C6W A;  3O34 A;  4PTB A;  2G6Q A;  1DVP A;  3O36 A;  5J3X A;  1F62 A;  4Z0R A;  5B75 A;  2VPB A;  4I7D A;  4LAD B;  3HCS A;  4R2Y A;  2MT5 A;  1VD4 A;  1FP0 A;  5C11 A;  2MKE A;  2MNZ A;  2KRE A;  2EOD A;  2K17 A;  2CT2 A;  4Z0O A;  2VPG A;  3FJU B;  4AYC B;  2H0D A;  1X4U A;  2L75 A;  4UI9 B;  5I3L A;  4F1P A;  2EA6 A;  2L7P A;  5AIU A;  3T9K A;  1FBV A;  5TRB A;  4W4U A;  2L43 A;  3Q1D A;  4IC3 A;  1WES A;  2YUR A;  1XWH A;  2C2V S;  2ECJ A;  3C5K A;  2EGM A;  3E2D A;  2Y1M A;  2KU3 A;  2H0D B;  1MM3 A;  5SVY A;  2E6R A;  3M99 A;  1WEO A;  4A4C A;  1WIL A;  2CSY A;  2PNX A;  2VPD A;  2YU4 A;  3GL6 A;  5FB1 A;  5G0F A;  3FM8 C;  2YRE A;  3H7H A;  4YBT A;  3U5M A;  2YHN A;  2ECW A;  4UP0 A;  3PLW A;  5B76 A;  3FEH A;  4GND A;  1V87 A;  2G43 A;  2M1R A;  1WIM A;  2ECI A;  2XOY A;  4I7C A;  4L58 A;  4GNG A;  3HCT A;  5LKZ A;  5H1U A;  2VJF B;  2JMD A;  2CRR A;  1BOR A;  3LRQ A;  5G05 B;  2L0B A;  1VFY A;  4YAB A;  3KNV A;  3EB5 A;  2M85 A;  2BAY A;  2FUI A;  1DCQ A;  2K16 A;  5SVX A;  4V3L C;  2LGV A;  4FO9 A;  1WEE A;  2LGK A;  2EGP A;  2IDA A;  2RI7 A;  5TBN A;  3ZPV E;  2RR4 A;  4GNE A;  5KH7 A;  2B0O E;  4WZ3 B;  4WZ2 A;  4OGC A;  2CRW A;  4N3W A;  2LGG A;  2QIC A;  5C13 A;  2YUC A;  3I2D A;  4AYC A;  5D1L B;  3FAO A;  4ZQL A;  5EYA F;  2NAA A;  3KQI A;  3LVR E;  3KV6 A;  4O64 A;  5SVI B;  3L1X A;  1CHC A;  3L11 A;  3MDB C;  3U5O A;  2KGG A;  4R7E A;  3N9M A;  4YBM A;  4LKA A;  1ZBD B;  2VNF A;  3HCU A;  3N9P A;  5D1M B;  5KH9 A;  2VJE B;  1LDK C;  2EXU A;  3IHP A;  1Z2Q A;  2KWN A;  5DIN A;  1X4I A;  3GV4 A;  3PUR A;  2VPE A;  5AIT A;  3T7L A;  2D8S A;  1WEN A;  2LN0 A;  1WEM A;  1E4U A;  2MIQ A; 
#chains in the Genus database with same CATH homology
 3HTK C;  2Y43 A;  3N9N A;  4F52 B;  3SHB A;  3ZVZ B;  4Q6F A;  4WA6 A;  3PUQ A;  3MHS A;  2ECN A;  3N9Q A;  2JRJ A;  2VJF A;  1JM7 B;  2ZET C;  3ZVY A;  4ZDT A;  3O37 A;  1U6G B;  2K1J A;  3SOW A;  3RPG C;  1WE9 A;  1WFK A;  4S3O C;  1WGM A;  2KR4 A;  3LQH A;  3N9O A;  2MNY A;  1WEP A;  3T6R A;  2I50 A;  3ZYQ A;  5FB0 A;  3L1Z B;  2F42 A;  1WEV A;  3LQJ A;  2LQ6 A;  4AUQ B;  2MA6 A;  4L7X A;  4X3G A;  2HDP A;  2UZG A;  1VYX A;  4AP4 A;  4LLB A;  2LXH C;  3RPG B;  3SOX A;  4S3O B;  3FL2 A;  1K2F A;  2KWO A;  4FJC A;  4C9Z A;  4A0C D;  4I7B A;  3O35 A;  4P5O B;  5DKA A;  2KGI A;  3O33 A;  4YAT A;  1N87 A;  2L80 A;  1G25 A;  4IC2 A;  2QIZ A;  3NG2 A;  5FEY A;  3MHH A;  5H9M A;  3EB6 A;  2QJ0 A;  4FIP A;  5TAB A;  3N9L A;  2M3H A;  2JMJ A;  2MA5 A;  5B8D A;  4CA1 A;  3O70 A;  4TKP B;  2PUY A;  2KWK A;  2YHO A;  3DQV R;  2ECV A;  2YW8 A;  2JMI A;  1HYJ A;  2VJE A;  3DPL R;  4LJN A;  2Y1N A;  2MD8 C;  5LKU A;  5G04 B;  2YQL A;  4AVX A;  4FK5 A;  2HYE D;  5H1V A;  3ZPV 1;  2LDR A;  4YBS A;  1JOC A;  1IYM A;  2VP7 A;  4YAX A;  3KV5 A;  4YAD A;  3ASL A;  4R8P K;  2DX8 A;  5H1T A;  1JM7 A;  3RTR B;  1Z6U A;  5B79 A;  2F6J A;  1WEQ A;  4GNF A;  4QF3 A;  3VK6 A;  3QZV A;  4MVT A;  2LV9 A;  4WZ0 A;  2KIZ A;  4B86 C;  5B78 A;  1X4J A;  2YSJ A;  5JG6 A;  4ZUX U;  4A49 A;  1WEW A;  5B77 A;  2K4D A;  1LDJ B;  2LRI C;  5D1K B;  2FUU A;  4QF2 A;  4BBQ A;  2LXP C;  5TDW A;  2G45 A;  2YQM A;  5KH3 A;  2KYU A;  3M62 A;  2XB1 A;  4B7Y C;  2CKL A;  2M6M A;  4NN2 A;  4V3K C;  2MUM A;  3ZTG A;  4A4B A;  1WEU A;  2YSM A;  3U5P A;  4LK9 A;  2CSZ A;  2KE1 A;  2YT5 A;  1Z60 A;  3ZNI A;  4GB0 A;  3LQI A;  4XI1 A;  4CCG X;  2YYR A;  4BHW A;  2AN6 A;  2RSD A;  2KFT A;  2FSA A;  2F6N A;  2XEU A;  5LKX A;  2CKL B;  4N4F A;  2LGL A;  3O7A A;  5TDR A;  2OXQ C;  3PHD A;  1T1H A;  2ECG A;  1HYI A;  4UP5 A;  3U5N A;  2L5U A;  2ECT A;  5FER A;  3SOU A;  1MM2 A;  2C2L A;  4PPE A;  4YC9 A;  5LKT A;  2KWJ A;  3M63 A;  4MSX A;  2E6S A;  3V43 A;  2MD7 B;  5LCW B;  1RMD A;  3C6W A;  3O34 A;  4PTB A;  2G6Q A;  1DVP A;  3O36 A;  5J3X A;  1F62 A;  5B75 A;  2VPB A;  4I7D A;  4LAD B;  3HCS A;  4R2Y A;  2MT5 A;  1VD4 A;  1FP0 A;  5C11 A;  2MNZ A;  2KRE A;  2EOD A;  2K17 A;  2CT2 A;  2VPG A;  4AYC B;  2H0D A;  1X4U A;  2L75 A;  4UI9 B;  5I3L A;  2EA6 A;  5AIU A;  1FBV A;  5TRB A;  4W4U A;  2L43 A;  4IC3 A;  1WES A;  2YUR A;  1XWH A;  2C2V S;  2ECJ A;  3C5K A;  2Y1M A;  2KU3 A;  2H0D B;  1MM3 A;  2E6R A;  3M99 A;  1WEO A;  4A4C A;  1WIL A;  2CSY A;  2PNX A;  2VPD A;  2YU4 A;  3GL6 A;  5FB1 A;  5G0F A;  2YRE A;  4YBT A;  3U5M A;  2YHN A;  2ECW A;  4UP0 A;  5B76 A;  4GND A;  1V87 A;  2G43 A;  2M1R A;  1WIM A;  2ECI A;  4I7C A;  4L58 A;  4GNG A;  3HCT A;  5LKZ A;  5H1U A;  2VJF B;  2JMD A;  1BOR A;  3LRQ A;  5G05 B;  2L0B A;  1VFY A;  4YAB A;  3KNV A;  3EB5 A;  2M85 A;  2BAY A;  2FUI A;  2K16 A;  4V3L C;  2LGV A;  4FO9 A;  1WEE A;  2LGK A;  2EGP A;  2IDA A;  2RI7 A;  5TBN A;  3ZPV E;  4GNE A;  5KH7 A;  4WZ3 B;  4WZ2 A;  4N3W A;  2LGG A;  2QIC A;  5C13 A;  2YUC A;  3I2D A;  4AYC A;  5D1L B;  4ZQL A;  5EYA F;  2NAA A;  3KQI A;  3KV6 A;  4O64 A;  3L1X A;  1CHC A;  3L11 A;  3U5O A;  2KGG A;  4R7E A;  3N9M A;  4YBM A;  4LKA A;  1ZBD B;  2VNF A;  3HCU A;  3N9P A;  5D1M B;  5KH9 A;  2VJE B;  1LDK C;  3IHP A;  1Z2Q A;  2KWN A;  5DIN A;  1X4I A;  3GV4 A;  3PUR A;  2VPE A;  5AIT A;  3T7L A;  2D8S A;  1WEN A;  2LN0 A;  1WEM A;  1E4U A;  2MIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...