1ZBDB

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
EELTDEEKEIINRVIARAEKMETMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSASVVCEDCKKNVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags G protein
molecule keywords RABPHILIN-3A
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02318 FYVE_2 FYVE-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1zbdB00
4P5OB 3M63A 1LDKC 2FUUA 3PURA 5C11A 4LKAA 5KH3A 1ZBDB 3KV6A 4AYCA 2VPGA 2CKLA 2MA6A 2YSMA 1N87A 4V3LC 3SOUA 5G04B 4NN2A 4X3GA 1WENA 2L75A 3LQJA 3C6WA 1U6GB 2F6NA 2K16A 4GNGA 2G6QA 4S3OB 1WE9A 4FIPA 4YATA 2YW8A 4AP4A 5LKTA 4W4UA 4PTBA 2KWKA 4YBTA 1HYJA 3SOWA 3V43A 2ECVA 2KR4A 2G45A 2MT5A 5B78A 2LQ6A 2L0BA 2YT5A 2M85A 2VJFA 1WEVA 4UI9B 4IC2A 2MNYA 2LGVA 4I7BA 2DX8A 2M3HA 2H0DA 1Z6UA 3ZVYA 1WFKA 5LCWB 4BHWA 5FEYA 4R7EA 3LQIA 4A4CA 4R2YA 2LDRA 2ZETC 3O37A 5H1TA 1Z2QA 5B76A 2E6SA 4FO9A 4AUQB 5FB1A 4GNFA 2H0DB 4CCGX 5AITA 2LGGA 4I7DA 5TRBA 4AYCB 1MM2A 3C5KA 3EB6A 2I50A 3KNVA 5B77A 1X4UA 5TDWA 3EB5A 2LN0A 2VNFA 2MD8C 2NAAA 5TDRA 4ZDTA 1Z60A 5D1KB 1WILA 2M6MA 1FBVA 3N9PA 5H1VA 4WZ2A 3N9NA 4N4FA 5J3XA 3O35A 5TABA 2C2LA 3LQHA 2CKLB 3KV5A 5D1MB 2LV9A 2MIQA 3T7LA 2K17A 3PHDA 4N3WA 5D1LB 1WEQA 1X4JA 2PUYA 1WEMA 4UP0A 5B8DA 3ASLA 2MD7B 2YREA 5DKAA 3N9MA 4LLBA 3RPGB 2KGGA 2Y1MA 5G0FA 2L5UA 2ECJA 2VPDA 3U5PA 4Q6FA 3T6RA 1XWHA 4LK9A 2MUMA 4XI1A 3SOXA 4BBQA 2KREA 2LGLA 5AIUA 3DQVR 2LXPC 4CA1A 2EODA 1K2FA 1VYXA 4I7CA 2YQLA 4LJNA 5H1UA 2KFTA 1G25A 2UZGA 5LKZA 3ZPVE 3NG2A 2K1JA 1VFYA 4L7XA 2E6RA 2IDAA 5B79A 3L11A 3RPGC 3O70A 2MA5A 1F62A 1JM7A 3HCSA 3ZPV1 1IYMA 2G43A 3RTRB 5H9MA 2C2VS 4B7YC 5DINA 2Y43A 4PPEA 4LADB 4UP5A 2CSYA 1FP0A 1WEOA 1JOCA 2KU3A 1WEPA 3HCUA 5C13A 3N9LA 3SHBA 4A4BA 3ZVZB 5EYAF 4A0CD 2JRJA 4V3KC 2YHNA 2LGKA 4F52B 3N9OA 2LRIC 4L58A 4WZ0A 1T1HA 1LDJB 3O34A 5FB0A 4WA6A 2L43A 2RI7A 3VK6A 1RMDA 3PUQA 2OXQC 2VPEA 1HYIA 4WZ3B 2QIZA 1VD4A 2KWJA 5B75A 4YAXA 4C9ZA 2YHOA 3FL2A 2YUCA 2CSZA 2ECIA 3ZYQA 2EGPA 2D8SA 5LKXA 2VJFB 2VJEA 3HCTA 2ECNA 1WEWA 5KH9A 3KQIA 2ECWA 3M62A 5JG6A 1BORA 4GNDA 2M1RA 2FUIA 2XEUA 1WIMA 1V87A 2F6JA 1X4IA 2XB1A 2KGIA 2JMJA 3GL6A 3M99A 4S3OC 4GB0A 3L1ZB 1DVPA 2RSDA 4TKPB 3GV4A 4AVXA 4IC3A 2EA6A 1WESA 5I3LA 3L1XA 4MSXA 3O7AA 4FJCA 2JMIA 4YC9A 2K4DA 4ZUXU 2VJEB 5TBNA 4O64A 2YYRA 2YU4A 4R8PK 2YQMA 1CHCA 3U5MA 3I2DA 3U5NA 3U5OA 3QZVA 4MVTA 3O33A 2KE1A 3MHSA 3DPLR 2ECGA 2AN6A 4YBMA 1MM3A 4QF3A 2KYUA 2LXHC 2QJ0A 2JMDA 3IHPA 2HYED 2CT2A 3O36A 2BAYA 2VP7A 2PNXA 4B86C 2Y1NA 2YURA 5G05B 1E4UA 4A49A 2FSAA 4YBSA 4GNEA 4YABA 3LRQA 4YADA 1WEEA 2KIZA 2L80A 5FERA 3N9QA 3ZNIA 4FK5A 2VPBA 1WGMA 5LKUA 1WEUA 3ZTGA 3HTKC 5KH7A 4ZQLA 2MNZA 2HDPA 2F42A 1JM7B 4QF2A 2KWNA 2ECTA 2QICA 2YSJA 3MHHA 2KWOA
chains in the Genus database with same CATH superfamily
3FAOA 4P5OB 3M63A 1LDKC 2XP0A 4O62A 2CSVA 2FUUA 3PURA 5C11A 4LKAA 5KH3A 1ZBDB 3KV6A 4AYCA 2VPGA 2CKLA 2IQJA 2XOYA 2MA6A 2YSMA 1N87A 4V3LC 3SOUA 5G04B 3FM8C 5SVIA 4NN2A 4X3GA 1WENA 2L75A 3LQJA 3C6WA 1U6GB 2F6NA 2K16A 4GNGA 2G6QA 3JUEA 4Z0OA 4S3OB 1WE9A 4FIPA 2M13A 4YATA 2YW8A 4AP4A 2L7PA 5LKTA 2DSMA 4W4UA 4PTBA 2KWKA 4YBTA 1HYJA 3SOWA 3V43A 2ECVA 2KR4A 2G45A 2MT5A 5B78A 2LQ6A 2L0BA 2YT5A 3DDTA 2M85A 3LJUX 3FJUB 4H9DA 2VJFA 1WEVA 4UI9B 4IC2A 2MNYA 2LGVA 4I7BA 2DX8A 2M3HA 2H0DA 1Z6UA 3LVRE 3ZVYA 1WFKA 3Q1DA 5LCWB 4BHWA 5FEYA 4R7EA 3LQIA 4A4CA 4R2YA 2LDRA 2ZETC 3O37A 5H1TA 1Z2QA 2D8UA 5B76A 2E6SA 4FO9A 4QQ4A 4AUQB 2KKYA 2DJAA 5FB1A 4GNFA 2H0DB 4CCGX 5AITA 2MKEA 2LGGA 4I7DA 2OWAA 5TRBA 4AYCB 1MM2A 3C5KA 3EB6A 2I50A 3KNVA 5B77A 3FANA 1X4UA 5TDWA 3EB5A 2LN0A 2VNFA 2MD8C 2NAAA 5TDRA 4ZDTA 1Z60A 5D1KB 1WILA 2M6MA 1FBVA 3N9PA 5H1VA 4WZ2A 3N9NA 4N4FA 5J3XA 3O35A 5TABA 2C2LA 3LQHA 5SVYA 2CKLB 3KV5A 5D1MB 2LV9A 2MIQA 3T7LA 2K17A 3E2DA 2B0OE 3PHDA 4N3WA 2P57A 3FEHA 5D1LB 1WEQA 1X4JA 2PUYA 1WEMA 2XOCA 1DCQA 4UP0A 5B8DA 3ASLA 2MD7B 2YREA 5DKAA 2CONA 2JUNA 5SVIB 2CRRA 3N9MA 4LLBA 3RPGB 2KGGA 2Y1MA 5G0FA 2L5UA 2ECJA 2VPDA 3U5PA 4Q6FA 3T6RA 2YVRA 1XWHA 4LK9A 2MUMA 4XI1A 3SOXA 4BBQA 2KREA 2LGLA 5AIUA 3DQVR 2LXPC 4CA1A 2EODA 1K2FA 1VYXA 4I7CA 2YQLA 4LJNA 5H1UA 2KFTA 1G25A 2UZGA 5LKZA 2EGMA 3ZPVE 3NG2A 2K1JA 1VFYA 4L7XA 2E6RA 2IDAA 5B79A 3L11A 3RPGC 3O70A 2MA5A 4OGCA 1F62A 4OGEA 1JM7A 3HCSA 3ZPV1 2JM3A 2FD4A 1IYMA 2G43A 3RTRB 5H9MA 2C2VS 4B7YC 5DINA 2Y43A 4PPEA 3PLWA 4LADB 4UP5A 2CSYA 1FP0A 1WEOA 1JOCA 2KU3A 1WEPA 3HCUA 5C13A 3N9LA 3SHBA 4A4BA 3ZVZB 5EYAF 4A0CD 2JRJA 4V3KC 2YHNA 2LGKA 2KKXA 4F52B 3N9OA 2LRIC 4L58A 4WZ0A 1T1HA 1LDJB 3O34A 5FB0A 4WA6A 2L43A 2RI7A 3VK6A 1RMDA 3PUQA 2OXQC 2VPEA 1HYIA 4WZ3B 3MDBC 2QIZA 1VD4A 2KWJA 4F1PA 5B75A 4YAXA 4C9ZA 2YHOA 3T9KA 3FL2A 2YUCA 2CSZA 2ECIA 3ZYQA 2EGPA 2D8SA 5LKXA 2VJFB 2VJEA 3HCTA 2FFWA 2ECNA 1WEWA 5KH9A 3KQIA 3SUBA 2ECWA 3M62A 5JG6A 1BORA 4GNDA 2M1RA 2FUIA 2LAUA 2XEUA 1WIMA 1V87A 2F6JA 1X4IA 2XB1A 2KGIA 2JMJA 3GL6A 3M99A 5SVXA 3M7KA 4S3OC 4GB0A 2E61A 3L1ZB 1DVPA 2RSDA 4TKPB 3GV4A 4AVXA 2CRWA 4IC3A 2EA6A 1WESA 5I3LA 3L1XA 4MSXA 2XOZA 3O7AA 4FJCA 2JMIA 2RR4A 4YC9A 2K4DA 4ZUXU 2VJEB 5TBNA 4O64A 4Z0RA 2YYRA 2YU4A 4R8PK 2YQMA 1CHCA 3U5MA 3I2DA 3U5NA 3U5OA 3QZVA 4MVTA 3O33A 2KE1A 3MHSA 3O47A 3DPLR 2ECGA 2AN6A 4YBMA 3LVQE 1MM3A 3H7HA 2EXUA 4QF3A 2KYUA 2LXHC 2QJ0A 2JMDA 3IHPA 2HYED 2CT2A 3O36A 2BAYA 2VP7A 2PNXA 4B86C 2Y1NA 2YURA 5G05B 1E4UA 4A49A 2FSAA 4YBSA 4GNEA 4YABA 3LRQA 3DWDA 4YADA 1WEEA 2KIZA 2L80A 5FERA 3N9QA 3ZNIA 4FK5A 2VPBA 1WGMA 5LKUA 3KDEC 1WEUA 3ZTGA 3HTKC 5KH7A 4ZQLA 2MNZA 2HDPA 2F42A 1JM7B 4QF2A 2KWNA 3LDYA 2ECTA 1MBMA 2QICA 2YSJA 3MHHA 2KWOA 5K3QA
chains in the Genus database with same CATH topology
4P5OB 3M63A 1LDKC 2FUUA 3PURA 5C11A 4LKAA 5KH3A 1ZBDB 3KV6A 4AYCA 2VPGA 2CKLA 2MA6A 2YSMA 1N87A 4V3LC 3SOUA 5G04B 4NN2A 4X3GA 1WENA 2L75A 3LQJA 3C6WA 1U6GB 2F6NA 2K16A 4GNGA 2G6QA 4S3OB 1WE9A 4FIPA 4YATA 2YW8A 4AP4A 5LKTA 4W4UA 4PTBA 2KWKA 4YBTA 1HYJA 3SOWA 3V43A 2ECVA 2KR4A 2G45A 2MT5A 5B78A 2LQ6A 2L0BA 2YT5A 2M85A 2VJFA 1WEVA 4UI9B 4IC2A 2MNYA 2LGVA 4I7BA 2DX8A 2M3HA 2H0DA 1Z6UA 3ZVYA 1WFKA 5LCWB 4BHWA 5FEYA 4R7EA 3LQIA 4A4CA 4R2YA 2LDRA 2ZETC 3O37A 5H1TA 1Z2QA 5B76A 2E6SA 4FO9A 4AUQB 5FB1A 4GNFA 2H0DB 4CCGX 5AITA 2LGGA 4I7DA 5TRBA 4AYCB 1MM2A 3C5KA 3EB6A 2I50A 3KNVA 5B77A 1X4UA 5TDWA 3EB5A 2LN0A 2VNFA 2MD8C 2NAAA 5TDRA 4ZDTA 1Z60A 5D1KB 1WILA 2M6MA 1FBVA 3N9PA 5H1VA 4WZ2A 3N9NA 4N4FA 5J3XA 3O35A 5TABA 2C2LA 3LQHA 2CKLB 3KV5A 5D1MB 2LV9A 2MIQA 3T7LA 2K17A 3PHDA 4N3WA 5D1LB 1WEQA 1X4JA 2PUYA 1WEMA 4UP0A 5B8DA 3ASLA 2MD7B 2YREA 5DKAA 3N9MA 4LLBA 3RPGB 2KGGA 2Y1MA 5G0FA 2L5UA 2ECJA 2VPDA 3U5PA 4Q6FA 3T6RA 1XWHA 4LK9A 2MUMA 4XI1A 3SOXA 4BBQA 2KREA 2LGLA 5AIUA 3DQVR 2LXPC 4CA1A 2EODA 1K2FA 1VYXA 4I7CA 2YQLA 4LJNA 5H1UA 2KFTA 1G25A 2UZGA 5LKZA 3ZPVE 3NG2A 2K1JA 1VFYA 4L7XA 2E6RA 2IDAA 5B79A 3L11A 3RPGC 3O70A 2MA5A 1F62A 1JM7A 3HCSA 3ZPV1 1IYMA 2G43A 3RTRB 5H9MA 2C2VS 4B7YC 5DINA 2Y43A 4PPEA 4LADB 4UP5A 2CSYA 1FP0A 1WEOA 1JOCA 2KU3A 1WEPA 3HCUA 5C13A 3N9LA 3SHBA 4A4BA 3ZVZB 5EYAF 4A0CD 2JRJA 4V3KC 2YHNA 2LGKA 4F52B 3N9OA 2LRIC 4L58A 4WZ0A 1T1HA 1LDJB 3O34A 5FB0A 4WA6A 2L43A 2RI7A 3VK6A 1RMDA 3PUQA 2OXQC 2VPEA 1HYIA 4WZ3B 2QIZA 1VD4A 2KWJA 5B75A 4YAXA 4C9ZA 2YHOA 3FL2A 2YUCA 2CSZA 2ECIA 3ZYQA 2EGPA 2D8SA 5LKXA 2VJFB 2VJEA 3HCTA 2ECNA 1WEWA 5KH9A 3KQIA 2ECWA 3M62A 5JG6A 1BORA 4GNDA 2M1RA 2FUIA 2XEUA 1WIMA 1V87A 2F6JA 1X4IA 2XB1A 2KGIA 2JMJA 3GL6A 3M99A 4S3OC 4GB0A 3L1ZB 1DVPA 2RSDA 4TKPB 3GV4A 4AVXA 4IC3A 2EA6A 1WESA 5I3LA 3L1XA 4MSXA 3O7AA 4FJCA 2JMIA 4YC9A 2K4DA 4ZUXU 2VJEB 5TBNA 4O64A 2YYRA 2YU4A 4R8PK 2YQMA 1CHCA 3U5MA 3I2DA 3U5NA 3U5OA 3QZVA 4MVTA 3O33A 2KE1A 3MHSA 3DPLR 2ECGA 2AN6A 4YBMA 1MM3A 4QF3A 2KYUA 2LXHC 2QJ0A 2JMDA 3IHPA 2HYED 2CT2A 3O36A 2BAYA 2VP7A 2PNXA 4B86C 2Y1NA 2YURA 5G05B 1E4UA 4A49A 2FSAA 4YBSA 4GNEA 4YABA 3LRQA 4YADA 1WEEA 2KIZA 2L80A 5FERA 3N9QA 3ZNIA 4FK5A 2VPBA 1WGMA 5LKUA 1WEUA 3ZTGA 3HTKC 5KH7A 4ZQLA 2MNZA 2HDPA 2F42A 1JM7B 4QF2A 2KWNA 2ECTA 2QICA 2YSJA 3MHHA 2KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5O B;  3M63 A;  1LDK C;  2FUU A;  3PUR A;  5C11 A;  4LKA A;  5KH3 A;  1ZBD B;  3KV6 A;  4AYC A;  2VPG A;  2CKL A;  2MA6 A;  2YSM A;  1N87 A;  4V3L C;  3SOU A;  5G04 B;  4NN2 A;  4X3G A;  1WEN A;  2L75 A;  3LQJ A;  3C6W A;  1U6G B;  2F6N A;  2K16 A;  4GNG A;  2G6Q A;  4S3O B;  1WE9 A;  4FIP A;  4YAT A;  2YW8 A;  4AP4 A;  5LKT A;  4W4U A;  4PTB A;  2KWK A;  4YBT A;  1HYJ A;  3SOW A;  3V43 A;  2ECV A;  2KR4 A;  2G45 A;  2MT5 A;  5B78 A;  2LQ6 A;  2L0B A;  2YT5 A;  2M85 A;  2VJF A;  1WEV A;  4UI9 B;  4IC2 A;  2MNY A;  2LGV A;  4I7B A;  2DX8 A;  2M3H A;  2H0D A;  1Z6U A;  3ZVY A;  1WFK A;  5LCW B;  4BHW A;  5FEY A;  4R7E A;  3LQI A;  4A4C A;  4R2Y A;  2LDR A;  2ZET C;  3O37 A;  5H1T A;  1Z2Q A;  5B76 A;  2E6S A;  4FO9 A;  4AUQ B;  5FB1 A;  4GNF A;  2H0D B;  4CCG X;  5AIT A;  2LGG A;  4I7D A;  5TRB A;  4AYC B;  1MM2 A;  3C5K A;  3EB6 A;  2I50 A;  3KNV A;  5B77 A;  1X4U A;  5TDW A;  3EB5 A;  2LN0 A;  2VNF A;  2MD8 C;  2NAA A;  5TDR A;  4ZDT A;  1Z60 A;  5D1K B;  1WIL A;  2M6M A;  1FBV A;  3N9P A;  5H1V A;  4WZ2 A;  3N9N A;  4N4F A;  5J3X A;  3O35 A;  5TAB A;  2C2L A;  3LQH A;  2CKL B;  3KV5 A;  5D1M B;  2LV9 A;  2MIQ A;  3T7L A;  2K17 A;  3PHD A;  4N3W A;  5D1L B;  1WEQ A;  1X4J A;  2PUY A;  1WEM A;  4UP0 A;  5B8D A;  3ASL A;  2MD7 B;  2YRE A;  5DKA A;  3N9M A;  4LLB A;  3RPG B;  2KGG A;  2Y1M A;  5G0F A;  2L5U A;  2ECJ A;  2VPD A;  3U5P A;  4Q6F A;  3T6R A;  1XWH A;  4LK9 A;  2MUM A;  4XI1 A;  3SOX A;  4BBQ A;  2KRE A;  2LGL A;  5AIU A;  3DQV R;  2LXP C;  4CA1 A;  2EOD A;  1K2F A;  1VYX A;  4I7C A;  2YQL A;  4LJN A;  5H1U A;  2KFT A;  1G25 A;  2UZG A;  5LKZ A;  3ZPV E;  3NG2 A;  2K1J A;  1VFY A;  4L7X A;  2E6R A;  2IDA A;  5B79 A;  3L11 A;  3RPG C;  3O70 A;  2MA5 A;  1F62 A;  1JM7 A;  3HCS A;  3ZPV 1;  1IYM A;  2G43 A;  3RTR B;  5H9M A;  2C2V S;  4B7Y C;  5DIN A;  2Y43 A;  4PPE A;  4LAD B;  4UP5 A;  2CSY A;  1FP0 A;  1WEO A;  1JOC A;  2KU3 A;  1WEP A;  3HCU A;  5C13 A;  3N9L A;  3SHB A;  4A4B A;  3ZVZ B;  5EYA F;  4A0C D;  2JRJ A;  4V3K C;  2YHN A;  2LGK A;  4F52 B;  3N9O A;  2LRI C;  4L58 A;  4WZ0 A;  1T1H A;  1LDJ B;  3O34 A;  5FB0 A;  4WA6 A;  2L43 A;  2RI7 A;  3VK6 A;  1RMD A;  3PUQ A;  2OXQ C;  2VPE A;  1HYI A;  4WZ3 B;  2QIZ A;  1VD4 A;  2KWJ A;  5B75 A;  4YAX A;  4C9Z A;  2YHO A;  3FL2 A;  2YUC A;  2CSZ A;  2ECI A;  3ZYQ A;  2EGP A;  2D8S A;  5LKX A;  2VJF B;  2VJE A;  3HCT A;  2ECN A;  1WEW A;  5KH9 A;  3KQI A;  2ECW A;  3M62 A;  5JG6 A;  1BOR A;  4GND A;  2M1R A;  2FUI A;  2XEU A;  1WIM A;  1V87 A;  2F6J A;  1X4I A;  2XB1 A;  2KGI A;  2JMJ A;  3GL6 A;  3M99 A;  4S3O C;  4GB0 A;  3L1Z B;  1DVP A;  2RSD A;  4TKP B;  3GV4 A;  4AVX A;  4IC3 A;  2EA6 A;  1WES A;  5I3L A;  3L1X A;  4MSX A;  3O7A A;  4FJC A;  2JMI A;  4YC9 A;  2K4D A;  4ZUX U;  2VJE B;  5TBN A;  4O64 A;  2YYR A;  2YU4 A;  4R8P K;  2YQM A;  1CHC A;  3U5M A;  3I2D A;  3U5N A;  3U5O A;  3QZV A;  4MVT A;  3O33 A;  2KE1 A;  3MHS A;  3DPL R;  2ECG A;  2AN6 A;  4YBM A;  1MM3 A;  4QF3 A;  2KYU A;  2LXH C;  2QJ0 A;  2JMD A;  3IHP A;  2HYE D;  2CT2 A;  3O36 A;  2BAY A;  2VP7 A;  2PNX A;  4B86 C;  2Y1N A;  2YUR A;  5G05 B;  1E4U A;  4A49 A;  2FSA A;  4YBS A;  4GNE A;  4YAB A;  3LRQ A;  4YAD A;  1WEE A;  2KIZ A;  2L80 A;  5FER A;  3N9Q A;  3ZNI A;  4FK5 A;  2VPB A;  1WGM A;  5LKU A;  1WEU A;  3ZTG A;  3HTK C;  5KH7 A;  4ZQL A;  2MNZ A;  2HDP A;  2F42 A;  1JM7 B;  4QF2 A;  2KWN A;  2ECT A;  2QIC A;  2YSJ A;  3MHH A;  2KWO A; 
#chains in the Genus database with same CATH topology
 3FAO A;  4P5O B;  3M63 A;  1LDK C;  2XP0 A;  4O62 A;  2CSV A;  2FUU A;  3PUR A;  5C11 A;  4LKA A;  5KH3 A;  1ZBD B;  3KV6 A;  4AYC A;  2VPG A;  2CKL A;  2IQJ A;  2XOY A;  2MA6 A;  2YSM A;  1N87 A;  4V3L C;  3SOU A;  5G04 B;  3FM8 C;  5SVI A;  4NN2 A;  4X3G A;  1WEN A;  2L75 A;  3LQJ A;  3C6W A;  1U6G B;  2F6N A;  2K16 A;  4GNG A;  2G6Q A;  3JUE A;  4Z0O A;  4S3O B;  1WE9 A;  4FIP A;  2M13 A;  4YAT A;  2YW8 A;  4AP4 A;  2L7P A;  5LKT A;  2DSM A;  4W4U A;  4PTB A;  2KWK A;  4YBT A;  1HYJ A;  3SOW A;  3V43 A;  2ECV A;  2KR4 A;  2G45 A;  2MT5 A;  5B78 A;  2LQ6 A;  2L0B A;  2YT5 A;  3DDT A;  2M85 A;  3LJU X;  3FJU B;  4H9D A;  2VJF A;  1WEV A;  4UI9 B;  4IC2 A;  2MNY A;  2LGV A;  4I7B A;  2DX8 A;  2M3H A;  2H0D A;  1Z6U A;  3LVR E;  3ZVY A;  1WFK A;  3Q1D A;  5LCW B;  4BHW A;  5FEY A;  4R7E A;  3LQI A;  4A4C A;  4R2Y A;  2LDR A;  2ZET C;  3O37 A;  5H1T A;  1Z2Q A;  2D8U A;  5B76 A;  2E6S A;  4FO9 A;  4QQ4 A;  4AUQ B;  2KKY A;  2DJA A;  5FB1 A;  4GNF A;  2H0D B;  4CCG X;  5AIT A;  2MKE A;  2LGG A;  4I7D A;  2OWA A;  5TRB A;  4AYC B;  1MM2 A;  3C5K A;  3EB6 A;  2I50 A;  3KNV A;  5B77 A;  3FAN A;  1X4U A;  5TDW A;  3EB5 A;  2LN0 A;  2VNF A;  2MD8 C;  2NAA A;  5TDR A;  4ZDT A;  1Z60 A;  5D1K B;  1WIL A;  2M6M A;  1FBV A;  3N9P A;  5H1V A;  4WZ2 A;  3N9N A;  4N4F A;  5J3X A;  3O35 A;  5TAB A;  2C2L A;  3LQH A;  5SVY A;  2CKL B;  3KV5 A;  5D1M B;  2LV9 A;  2MIQ A;  3T7L A;  2K17 A;  3E2D A;  2B0O E;  3PHD A;  4N3W A;  2P57 A;  3FEH A;  5D1L B;  1WEQ A;  1X4J A;  2PUY A;  1WEM A;  2XOC A;  1DCQ A;  4UP0 A;  5B8D A;  3ASL A;  2MD7 B;  2YRE A;  5DKA A;  2CON A;  2JUN A;  5SVI B;  2CRR A;  3N9M A;  4LLB A;  3RPG B;  2KGG A;  2Y1M A;  5G0F A;  2L5U A;  2ECJ A;  2VPD A;  3U5P A;  4Q6F A;  3T6R A;  2YVR A;  1XWH A;  4LK9 A;  2MUM A;  4XI1 A;  3SOX A;  4BBQ A;  2KRE A;  2LGL A;  5AIU A;  3DQV R;  2LXP C;  4CA1 A;  2EOD A;  1K2F A;  1VYX A;  4I7C A;  2YQL A;  4LJN A;  5H1U A;  2KFT A;  1G25 A;  2UZG A;  5LKZ A;  2EGM A;  3ZPV E;  3NG2 A;  2K1J A;  1VFY A;  4L7X A;  2E6R A;  2IDA A;  5B79 A;  3L11 A;  3RPG C;  3O70 A;  2MA5 A;  4OGC A;  1F62 A;  4OGE A;  1JM7 A;  3HCS A;  3ZPV 1;  2JM3 A;  2FD4 A;  1IYM A;  2G43 A;  3RTR B;  5H9M A;  2C2V S;  4B7Y C;  5DIN A;  2Y43 A;  4PPE A;  3PLW A;  4LAD B;  4UP5 A;  2CSY A;  1FP0 A;  1WEO A;  1JOC A;  2KU3 A;  1WEP A;  3HCU A;  5C13 A;  3N9L A;  3SHB A;  4A4B A;  3ZVZ B;  5EYA F;  4A0C D;  2JRJ A;  4V3K C;  2YHN A;  2LGK A;  2KKX A;  4F52 B;  3N9O A;  2LRI C;  4L58 A;  4WZ0 A;  1T1H A;  1LDJ B;  3O34 A;  5FB0 A;  4WA6 A;  2L43 A;  2RI7 A;  3VK6 A;  1RMD A;  3PUQ A;  2OXQ C;  2VPE A;  1HYI A;  4WZ3 B;  3MDB C;  2QIZ A;  1VD4 A;  2KWJ A;  4F1P A;  5B75 A;  4YAX A;  4C9Z A;  2YHO A;  3T9K A;  3FL2 A;  2YUC A;  2CSZ A;  2ECI A;  3ZYQ A;  2EGP A;  2D8S A;  5LKX A;  2VJF B;  2VJE A;  3HCT A;  2FFW A;  2ECN A;  1WEW A;  5KH9 A;  3KQI A;  3SUB A;  2ECW A;  3M62 A;  5JG6 A;  1BOR A;  4GND A;  2M1R A;  2FUI A;  2LAU A;  2XEU A;  1WIM A;  1V87 A;  2F6J A;  1X4I A;  2XB1 A;  2KGI A;  2JMJ A;  3GL6 A;  3M99 A;  5SVX A;  3M7K A;  4S3O C;  4GB0 A;  2E61 A;  3L1Z B;  1DVP A;  2RSD A;  4TKP B;  3GV4 A;  4AVX A;  2CRW A;  4IC3 A;  2EA6 A;  1WES A;  5I3L A;  3L1X A;  4MSX A;  2XOZ A;  3O7A A;  4FJC A;  2JMI A;  2RR4 A;  4YC9 A;  2K4D A;  4ZUX U;  2VJE B;  5TBN A;  4O64 A;  4Z0R A;  2YYR A;  2YU4 A;  4R8P K;  2YQM A;  1CHC A;  3U5M A;  3I2D A;  3U5N A;  3U5O A;  3QZV A;  4MVT A;  3O33 A;  2KE1 A;  3MHS A;  3O47 A;  3DPL R;  2ECG A;  2AN6 A;  4YBM A;  3LVQ E;  1MM3 A;  3H7H A;  2EXU A;  4QF3 A;  2KYU A;  2LXH C;  2QJ0 A;  2JMD A;  3IHP A;  2HYE D;  2CT2 A;  3O36 A;  2BAY A;  2VP7 A;  2PNX A;  4B86 C;  2Y1N A;  2YUR A;  5G05 B;  1E4U A;  4A49 A;  2FSA A;  4YBS A;  4GNE A;  4YAB A;  3LRQ A;  3DWD A;  4YAD A;  1WEE A;  2KIZ A;  2L80 A;  5FER A;  3N9Q A;  3ZNI A;  4FK5 A;  2VPB A;  1WGM A;  5LKU A;  3KDE C;  1WEU A;  3ZTG A;  3HTK C;  5KH7 A;  4ZQL A;  2MNZ A;  2HDP A;  2F42 A;  1JM7 B;  4QF2 A;  2KWN A;  3LDY A;  2ECT A;  1MBM A;  2QIC A;  2YSJ A;  3MHH A;  2KWO A;  5K3Q A; 
#chains in the Genus database with same CATH homology
 4P5O B;  3M63 A;  1LDK C;  2FUU A;  3PUR A;  5C11 A;  4LKA A;  5KH3 A;  1ZBD B;  3KV6 A;  4AYC A;  2VPG A;  2CKL A;  2MA6 A;  2YSM A;  1N87 A;  4V3L C;  3SOU A;  5G04 B;  4NN2 A;  4X3G A;  1WEN A;  2L75 A;  3LQJ A;  3C6W A;  1U6G B;  2F6N A;  2K16 A;  4GNG A;  2G6Q A;  4S3O B;  1WE9 A;  4FIP A;  4YAT A;  2YW8 A;  4AP4 A;  5LKT A;  4W4U A;  4PTB A;  2KWK A;  4YBT A;  1HYJ A;  3SOW A;  3V43 A;  2ECV A;  2KR4 A;  2G45 A;  2MT5 A;  5B78 A;  2LQ6 A;  2L0B A;  2YT5 A;  2M85 A;  2VJF A;  1WEV A;  4UI9 B;  4IC2 A;  2MNY A;  2LGV A;  4I7B A;  2DX8 A;  2M3H A;  2H0D A;  1Z6U A;  3ZVY A;  1WFK A;  5LCW B;  4BHW A;  5FEY A;  4R7E A;  3LQI A;  4A4C A;  4R2Y A;  2LDR A;  2ZET C;  3O37 A;  5H1T A;  1Z2Q A;  5B76 A;  2E6S A;  4FO9 A;  4AUQ B;  5FB1 A;  4GNF A;  2H0D B;  4CCG X;  5AIT A;  2LGG A;  4I7D A;  5TRB A;  4AYC B;  1MM2 A;  3C5K A;  3EB6 A;  2I50 A;  3KNV A;  5B77 A;  1X4U A;  5TDW A;  3EB5 A;  2LN0 A;  2VNF A;  2MD8 C;  2NAA A;  5TDR A;  4ZDT A;  1Z60 A;  5D1K B;  1WIL A;  2M6M A;  1FBV A;  3N9P A;  5H1V A;  4WZ2 A;  3N9N A;  4N4F A;  5J3X A;  3O35 A;  5TAB A;  2C2L A;  3LQH A;  2CKL B;  3KV5 A;  5D1M B;  2LV9 A;  2MIQ A;  3T7L A;  2K17 A;  3PHD A;  4N3W A;  5D1L B;  1WEQ A;  1X4J A;  2PUY A;  1WEM A;  4UP0 A;  5B8D A;  3ASL A;  2MD7 B;  2YRE A;  5DKA A;  3N9M A;  4LLB A;  3RPG B;  2KGG A;  2Y1M A;  5G0F A;  2L5U A;  2ECJ A;  2VPD A;  3U5P A;  4Q6F A;  3T6R A;  1XWH A;  4LK9 A;  2MUM A;  4XI1 A;  3SOX A;  4BBQ A;  2KRE A;  2LGL A;  5AIU A;  3DQV R;  2LXP C;  4CA1 A;  2EOD A;  1K2F A;  1VYX A;  4I7C A;  2YQL A;  4LJN A;  5H1U A;  2KFT A;  1G25 A;  2UZG A;  5LKZ A;  3ZPV E;  3NG2 A;  2K1J A;  1VFY A;  4L7X A;  2E6R A;  2IDA A;  5B79 A;  3L11 A;  3RPG C;  3O70 A;  2MA5 A;  1F62 A;  1JM7 A;  3HCS A;  3ZPV 1;  1IYM A;  2G43 A;  3RTR B;  5H9M A;  2C2V S;  4B7Y C;  5DIN A;  2Y43 A;  4PPE A;  4LAD B;  4UP5 A;  2CSY A;  1FP0 A;  1WEO A;  1JOC A;  2KU3 A;  1WEP A;  3HCU A;  5C13 A;  3N9L A;  3SHB A;  4A4B A;  3ZVZ B;  5EYA F;  4A0C D;  2JRJ A;  4V3K C;  2YHN A;  2LGK A;  4F52 B;  3N9O A;  2LRI C;  4L58 A;  4WZ0 A;  1T1H A;  1LDJ B;  3O34 A;  5FB0 A;  4WA6 A;  2L43 A;  2RI7 A;  3VK6 A;  1RMD A;  3PUQ A;  2OXQ C;  2VPE A;  1HYI A;  4WZ3 B;  2QIZ A;  1VD4 A;  2KWJ A;  5B75 A;  4YAX A;  4C9Z A;  2YHO A;  3FL2 A;  2YUC A;  2CSZ A;  2ECI A;  3ZYQ A;  2EGP A;  2D8S A;  5LKX A;  2VJF B;  2VJE A;  3HCT A;  2ECN A;  1WEW A;  5KH9 A;  3KQI A;  2ECW A;  3M62 A;  5JG6 A;  1BOR A;  4GND A;  2M1R A;  2FUI A;  2XEU A;  1WIM A;  1V87 A;  2F6J A;  1X4I A;  2XB1 A;  2KGI A;  2JMJ A;  3GL6 A;  3M99 A;  4S3O C;  4GB0 A;  3L1Z B;  1DVP A;  2RSD A;  4TKP B;  3GV4 A;  4AVX A;  4IC3 A;  2EA6 A;  1WES A;  5I3L A;  3L1X A;  4MSX A;  3O7A A;  4FJC A;  2JMI A;  4YC9 A;  2K4D A;  4ZUX U;  2VJE B;  5TBN A;  4O64 A;  2YYR A;  2YU4 A;  4R8P K;  2YQM A;  1CHC A;  3U5M A;  3I2D A;  3U5N A;  3U5O A;  3QZV A;  4MVT A;  3O33 A;  2KE1 A;  3MHS A;  3DPL R;  2ECG A;  2AN6 A;  4YBM A;  1MM3 A;  4QF3 A;  2KYU A;  2LXH C;  2QJ0 A;  2JMD A;  3IHP A;  2HYE D;  2CT2 A;  3O36 A;  2BAY A;  2VP7 A;  2PNX A;  4B86 C;  2Y1N A;  2YUR A;  5G05 B;  1E4U A;  4A49 A;  2FSA A;  4YBS A;  4GNE A;  4YAB A;  3LRQ A;  4YAD A;  1WEE A;  2KIZ A;  2L80 A;  5FER A;  3N9Q A;  3ZNI A;  4FK5 A;  2VPB A;  1WGM A;  5LKU A;  1WEU A;  3ZTG A;  3HTK C;  5KH7 A;  4ZQL A;  2MNZ A;  2HDP A;  2F42 A;  1JM7 B;  4QF2 A;  2KWN A;  2ECT A;  2QIC A;  2YSJ A;  3MHH A;  2KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...