1ZBDB

Structural basis of rab effector specificity: crystal structure of the small g protein rab3a complexed with the effector domain of rabphilin-3a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
b'EELTDEEKEIINRVIARAEKMETMEQERIGRLVDRLETMRKNVAGDGVNRCILCGEQLGMLGSASVVCEDCKKNVCTKCGVETSNNRPHPVWLCKICLEQREVWKRSGAWFFKGFPKQVLPQPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RABPHILIN-3A
publication title Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags G protein
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02318 FYVE_2 FYVE-type zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1zbdB00
5DKAA 4B86C 2ECNA 3LRQA 3U5OA 5H1UA 3U5PA 4WZ3B 2ZETC 4NN2A 4IC2A 5B78A 4AYCB 3LQIA 4YATA 2HDPA 4A0CD 2MNYA 3RPGC 4FO9A 2K1JA 2I50A 2VNFA 3T7LA 3DPLR 3O37A 2YUCA 1WESA 2KWKA 4I7DA 2BAYA 2G45A 2Y1MA 1LDJB 3RTRB 4ZUXU 1U6GB 4QF2A 4UP5A 2L80A 2NAAA 2K16A 2KREA 2C2LA 5AITA 2E6RA 3KV6A 2LQ6A 3O36A 4AYCA 5G04B 3HTKC 2LGLA 2YQLA 5FERA 2OXQC 5B8DA 3T6RA 3QZVA 3ASLA 2VPDA 3ZVYA 2EODA 2K4DA 1Z6UA 3O33A 1T1HA 3N9LA 4PPEA 2MIQA 1WEOA 3LQHA 2ECGA 3M99A 2E6SA 4F52B 5LCWB 5TDRA 2KWOA 4WA6A 2YHOA 3M63A 2Y1NA 3MHHA 4XI1A 1WIMA 3KNVA 4V3KC 2Y43A 2FUUA 2LV9A 4A49A 4GNEA 2ECTA 3HCTA 1MM2A 3IHPA 2KYUA 2MNZA 4UI9B 3GL6A 1WGMA 5C11A 2YHNA 5G0FA 4I7CA 2LXHC 2C2VS 1WFKA 2YSMA 3ZYQA 2MUMA 5LKUA 2JRJA 1X4JA 2CSZA 2EA6A 1N87A 2CSYA 2L43A 5B76A 1XWHA 4UP0A 4C9ZA 2PUYA 4LADB 2HYED 2CT2A 2MA5A 5TBNA 3M62A 2XEUA 4R2YA 3L1XA 3N9OA 2KGGA 5B75A 2KU3A 2M85A 1HYJA 2LGKA 3C6WA 1Z60A 2M1RA 3ZPV1 2D8SA 3I2DA 1V87A 3N9PA 1JOCA 3PHDA 4GNGA 2JMJA 3NG2A 2YURA 5TABA 4WZ0A 3N9QA 2L5UA 2AN6A 2F6JA 5B79A 4YADA 4FIPA 4YAXA 1LDKC 4S3OB 4YABA 1WEVA 4LJNA 4CA1A 1WILA 3MHSA 4GNDA 2L0BA 4QF3A 1VD4A 2LXPC 2M6MA 4MSXA 4ZDTA 1BORA 5D1KB 2MA6A 1FBVA 1RMDA 2H0DB 4ZQLA 4S3OC 4N3WA 1VFYA 1WEUA 1Z2QA 4A4CA 3O35A 2KWJA 2G6QA 2MD7B 2UZGA 2KWNA 5H1TA 4CCGX 2JMIA 2LRIC 1IYMA 1X4UA 3DQVR 2XB1A 3SHBA 2JMDA 3LQJA 2QJ0A 2F42A 2QICA 3HCSA 4LLBA 2F6NA 3KQIA 5J3XA 2VJEB 5D1MB 1JM7B 2YREA 4YC9A 2ECJA 4YBMA 1WE9A 2KFTA 3L11A 2H0DA 1WEEA 3EB5A 2ECIA 2ECWA 1MM3A 4PTBA 5H9MA 5LKXA 3L1ZB 2CKLB 4Q6FA 2YSJA 1HYIA 2RSDA 5G05B 4AUQB 5JG6A 5KH9A 4FK5A 2MT5A 4A4BA 2YW8A 4N4FA 2KE1A 4YBTA 2VPEA 3ZNIA 2G43A 2LGVA 3ZVZB 5H1VA 4BBQA 1F62A 5AIUA 1E4UA 3ZPVE 2YU4A 2KR4A 2VJEA 1G25A 5TRBA 1JM7A 4X3GA 3PURA 4AP4A 2PNXA 2EGPA 1VYXA 2MD8C 4W4UA 1CHCA 2CKLA 2ECVA 4LKAA 3VK6A 5KH3A 4IC3A 2YT5A 3O7AA 3N9NA 5FB1A 4P5OB 2VP7A 2FUIA 2KGIA 3KV5A 5D1LB 5KH7A 1WEWA 2QIZA 3PUQA 5I3LA 4R8PK 4GNFA 4R7EA 3HCUA 3ZTGA 2VJFB 3SOUA 2YQMA 3SOXA 4AVXA 5FB0A 4L58A 1WEPA 5EYAF 2YYRA 1WENA 4V3LC 4I7BA 1WEQA 4GB0A 1X4IA 3GV4A 3V43A 5FEYA 3C5KA 4O64A 2LGGA 4L7XA 2L75A 1DVPA 4FJCA 5C13A 4MVTA 3U5NA 2IDAA 1K2FA 4WZ2A 2K17A 3EB6A 4YBSA 3U5MA 5DINA 1FP0A 5LKTA 2FSAA 3SOWA 2DX8A 2M3HA 2VJFA 4LK9A 1ZBDB 1WEMA 3FL2A 2KIZA 2VPBA 5TDWA 5B77A 3N9MA 2LDRA 4BHWA 3O70A 2LN0A 3RPGB 2RI7A 2VPGA 4B7YC 4TKPB 3O34A 5LKZA
chains in the Genus database with same CATH superfamily
5DKAA 2FD4A 4B86C 2ECNA 3LRQA 3U5OA 5H1UA 3U5PA 2FFWA 4WZ3B 4OGEA 2ZETC 4NN2A 4IC2A 5B78A 4AYCB 3LQIA 4YATA 2HDPA 4A0CD 2MNYA 3RPGC 4FO9A 2K1JA 2I50A 2VNFA 3T7LA 3DPLR 2YVRA 3O37A 2YUCA 1WESA 2KWKA 4I7DA 2BAYA 2G45A 2Y1MA 1LDJB 3RTRB 4ZUXU 3PLWA 4OGCA 1U6GB 4QF2A 4UP5A 2L80A 2NAAA 2K16A 2KREA 2C2LA 5AITA 2E6RA 3KV6A 3DDTA 3SUBA 2OWAA 2LQ6A 3O36A 3FEHA 4AYCA 5G04B 3HTKC 2LGLA 2YQLA 5FERA 3FM8C 2OXQC 5B8DA 3T6RA 3QZVA 3ASLA 2VPDA 3ZVYA 2EODA 2K4DA 1Z6UA 3O33A 1T1HA 3N9LA 4PPEA 2MIQA 3O47A 1WEOA 3LQHA 2ECGA 3M99A 2E6SA 2B0OE 4F52B 5LCWB 3DWDA 5TDRA 2KWOA 4WA6A 2YHOA 3M63A 2Y1NA 3MHHA 4XI1A 1WIMA 3KNVA 4V3KC 2Y43A 2FUUA 2LV9A 5SVIB 4A49A 4GNEA 2ECTA 3HCTA 1MM2A 3IHPA 2KYUA 2MNZA 4UI9B 3GL6A 1WGMA 5C11A 2YHNA 3JUEA 5G0FA 4I7CA 2LXHC 2C2VS 1WFKA 2IQJA 2YSMA 3ZYQA 3M7KA 2MUMA 5LKUA 2JRJA 2KKYA 1X4JA 2CSZA 2EA6A 1N87A 2KKXA 2CSYA 2L43A 5B76A 1XWHA 2CRRA 4UP0A 4C9ZA 2PUYA 4LADB 2HYED 2CT2A 2MA5A 2LAUA 5SVIA 5TBNA 4F1PA 3M62A 2XEUA 4R2YA 2XP0A 2CSVA 5K3QA 3L1XA 3N9OA 2M13A 2EGMA 2KGGA 5B75A 2KU3A 3E2DA 2M85A 1HYJA 2LGKA 3C6WA 1Z60A 2M1RA 3ZPV1 2D8SA 3I2DA 2P57A 1V87A 3N9PA 1JOCA 3PHDA 2E61A 4GNGA 2JMJA 3NG2A 2YURA 5TABA 4WZ0A 3N9QA 2L5UA 2AN6A 2F6JA 5B79A 2JUNA 4YADA 3LDYA 4FIPA 4YAXA 3LJUX 1LDKC 4S3OB 4YABA 1WEVA 4LJNA 4CA1A 1WILA 2EXUA 3MHSA 2JM3A 3KDEC 4GNDA 2L0BA 4O62A 4QF3A 1VD4A 2LXPC 2M6MA 4MSXA 4ZDTA 1BORA 5D1KB 3FANA 2MA6A 1FBVA 1RMDA 2CONA 2H0DB 4ZQLA 2DSMA 4S3OC 4N3WA 1VFYA 1WEUA 1Z2QA 4Z0RA 4A4CA 3O35A 2KWJA 2G6QA 2MD7B 2UZGA 2KWNA 5H1TA 4CCGX 2XOZA 2JMIA 2LRIC 1MBMA 1IYMA 1X4UA 3DQVR 2XB1A 2XOYA 4QQ4A 3SHBA 2JMDA 3LQJA 2QJ0A 2F42A 2QICA 3HCSA 4LLBA 2F6NA 3KQIA 5J3XA 2VJEB 5D1MB 2CRWA 3T9KA 1JM7B 2YREA 4YC9A 2ECJA 4YBMA 3L11A 1WE9A 2KFTA 2H0DA 1WEEA 3EB5A 2ECIA 2ECWA 1MM3A 4PTBA 5H9MA 5LKXA 1DCQA 3L1ZB 3Q1DA 2CKLB 4Q6FA 2YSJA 1HYIA 3MDBC 2RSDA 5G05B 4AUQB 5JG6A 5KH9A 4FK5A 2MT5A 2D8UA 4A4BA 2YW8A 4N4FA 2KE1A 4YBTA 2VPEA 2DJAA 2G43A 3ZNIA 2LGVA 3ZVZB 5H1VA 4BBQA 1F62A 5AIUA 1E4UA 3ZPVE 2YU4A 2KR4A 2VJEA 1G25A 5TRBA 1JM7A 4X3GA 3LVRE 3PURA 4AP4A 2PNXA 2EGPA 1VYXA 2MD8C 4W4UA 1CHCA 2CKLA 2ECVA 4LKAA 5SVXA 3VK6A 5KH3A 4IC3A 2YT5A 3O7AA 3N9NA 5FB1A 4P5OB 2VP7A 2FUIA 2KGIA 3LVQE 3KV5A 5D1LB 4Z0OA 5KH7A 1WEWA 2QIZA 3PUQA 5I3LA 4R8PK 4GNFA 2XOCA 4R7EA 3HCUA 2MKEA 3ZTGA 2VJFB 3SOUA 2YQMA 3SOXA 4AVXA 2RR4A 5FB0A 4L58A 1WEPA 5EYAF 2YYRA 2L7PA 1WENA 4V3LC 4I7BA 1WEQA 4GB0A 1X4IA 3GV4A 3V43A 5FEYA 3C5KA 4O64A 2LGGA 4L7XA 2L75A 1DVPA 4FJCA 5C13A 4MVTA 3FJUB 2IDAA 1K2FA 4WZ2A 3U5NA 2K17A 3EB6A 4YBSA 3U5MA 5DINA 1FP0A 5LKTA 2FSAA 3SOWA 2DX8A 2M3HA 2VJFA 4LK9A 5SVYA 1ZBDB 1WEMA 3FL2A 2KIZA 2VPBA 5TDWA 5B77A 3N9MA 2LDRA 4BHWA 3H7HA 3O70A 4H9DA 2LN0A 3RPGB 2RI7A 2VPGA 4B7YC 4TKPB 3O34A 5LKZA 3FAOA
chains in the Genus database with same CATH topology
5DKAA 4B86C 2ECNA 3LRQA 3U5OA 5H1UA 3U5PA 4WZ3B 2ZETC 4NN2A 4IC2A 5B78A 4AYCB 3LQIA 4YATA 2HDPA 4A0CD 2MNYA 3RPGC 4FO9A 2K1JA 2I50A 2VNFA 3T7LA 3DPLR 3O37A 2YUCA 1WESA 2KWKA 4I7DA 2BAYA 2G45A 2Y1MA 1LDJB 3RTRB 4ZUXU 1U6GB 4QF2A 4UP5A 2L80A 2NAAA 2K16A 2KREA 2C2LA 5AITA 2E6RA 3KV6A 2LQ6A 3O36A 4AYCA 5G04B 3HTKC 2LGLA 2YQLA 5FERA 2OXQC 5B8DA 3T6RA 3QZVA 3ASLA 2VPDA 3ZVYA 2EODA 2K4DA 1Z6UA 3O33A 1T1HA 3N9LA 4PPEA 2MIQA 1WEOA 3LQHA 2ECGA 3M99A 2E6SA 4F52B 5LCWB 5TDRA 2KWOA 4WA6A 2YHOA 3M63A 2Y1NA 3MHHA 4XI1A 1WIMA 3KNVA 4V3KC 2Y43A 2FUUA 2LV9A 4A49A 4GNEA 2ECTA 3HCTA 1MM2A 3IHPA 2KYUA 2MNZA 4UI9B 3GL6A 1WGMA 5C11A 2YHNA 5G0FA 4I7CA 2LXHC 2C2VS 1WFKA 2YSMA 3ZYQA 2MUMA 5LKUA 2JRJA 1X4JA 2CSZA 2EA6A 1N87A 2CSYA 2L43A 5B76A 1XWHA 4UP0A 4C9ZA 2PUYA 4LADB 2HYED 2CT2A 2MA5A 5TBNA 3M62A 2XEUA 4R2YA 3L1XA 3N9OA 2KGGA 5B75A 2KU3A 2M85A 1HYJA 2LGKA 3C6WA 1Z60A 2M1RA 3ZPV1 2D8SA 3I2DA 1V87A 3N9PA 1JOCA 3PHDA 4GNGA 2JMJA 3NG2A 2YURA 5TABA 4WZ0A 3N9QA 2L5UA 2AN6A 2F6JA 5B79A 4YADA 4FIPA 4YAXA 1LDKC 4S3OB 4YABA 1WEVA 4LJNA 4CA1A 1WILA 3MHSA 4GNDA 2L0BA 4QF3A 1VD4A 2LXPC 2M6MA 4MSXA 4ZDTA 1BORA 5D1KB 2MA6A 1FBVA 1RMDA 2H0DB 4ZQLA 4S3OC 4N3WA 1VFYA 1WEUA 1Z2QA 4A4CA 3O35A 2KWJA 2G6QA 2MD7B 2UZGA 2KWNA 5H1TA 4CCGX 2JMIA 2LRIC 1IYMA 1X4UA 3DQVR 2XB1A 3SHBA 2JMDA 3LQJA 2QJ0A 2F42A 2QICA 3HCSA 4LLBA 2F6NA 3KQIA 5J3XA 2VJEB 5D1MB 1JM7B 2YREA 4YC9A 2ECJA 4YBMA 1WE9A 2KFTA 3L11A 2H0DA 1WEEA 3EB5A 2ECIA 2ECWA 1MM3A 4PTBA 5H9MA 5LKXA 3L1ZB 2CKLB 4Q6FA 2YSJA 1HYIA 2RSDA 5G05B 4AUQB 5JG6A 5KH9A 4FK5A 2MT5A 4A4BA 2YW8A 4N4FA 2KE1A 4YBTA 2VPEA 3ZNIA 2G43A 2LGVA 3ZVZB 5H1VA 4BBQA 1F62A 5AIUA 1E4UA 3ZPVE 2YU4A 2KR4A 2VJEA 1G25A 5TRBA 1JM7A 4X3GA 3PURA 4AP4A 2PNXA 2EGPA 1VYXA 2MD8C 4W4UA 1CHCA 2CKLA 2ECVA 4LKAA 3VK6A 5KH3A 4IC3A 2YT5A 3O7AA 3N9NA 5FB1A 4P5OB 2VP7A 2FUIA 2KGIA 3KV5A 5D1LB 5KH7A 1WEWA 2QIZA 3PUQA 5I3LA 4R8PK 4GNFA 4R7EA 3HCUA 3ZTGA 2VJFB 3SOUA 2YQMA 3SOXA 4AVXA 5FB0A 4L58A 1WEPA 5EYAF 2YYRA 1WENA 4V3LC 4I7BA 1WEQA 4GB0A 1X4IA 3GV4A 3V43A 5FEYA 3C5KA 4O64A 2LGGA 4L7XA 2L75A 1DVPA 4FJCA 5C13A 4MVTA 3U5NA 2IDAA 1K2FA 4WZ2A 2K17A 3EB6A 4YBSA 3U5MA 5DINA 1FP0A 5LKTA 2FSAA 3SOWA 2DX8A 2M3HA 2VJFA 4LK9A 1ZBDB 1WEMA 3FL2A 2KIZA 2VPBA 5TDWA 5B77A 3N9MA 2LDRA 4BHWA 3O70A 2LN0A 3RPGB 2RI7A 2VPGA 4B7YC 4TKPB 3O34A 5LKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKA A;  4B86 C;  2ECN A;  3LRQ A;  3U5O A;  5H1U A;  3U5P A;  4WZ3 B;  2ZET C;  4NN2 A;  4IC2 A;  5B78 A;  4AYC B;  3LQI A;  4YAT A;  2HDP A;  4A0C D;  2MNY A;  3RPG C;  4FO9 A;  2K1J A;  2I50 A;  2VNF A;  3T7L A;  3DPL R;  3O37 A;  2YUC A;  1WES A;  2KWK A;  4I7D A;  2BAY A;  2G45 A;  2Y1M A;  1LDJ B;  3RTR B;  4ZUX U;  1U6G B;  4QF2 A;  4UP5 A;  2L80 A;  2NAA A;  2K16 A;  2KRE A;  2C2L A;  5AIT A;  2E6R A;  3KV6 A;  2LQ6 A;  3O36 A;  4AYC A;  5G04 B;  3HTK C;  2LGL A;  2YQL A;  5FER A;  2OXQ C;  5B8D A;  3T6R A;  3QZV A;  3ASL A;  2VPD A;  3ZVY A;  2EOD A;  2K4D A;  1Z6U A;  3O33 A;  1T1H A;  3N9L A;  4PPE A;  2MIQ A;  1WEO A;  3LQH A;  2ECG A;  3M99 A;  2E6S A;  4F52 B;  5LCW B;  5TDR A;  2KWO A;  4WA6 A;  2YHO A;  3M63 A;  2Y1N A;  3MHH A;  4XI1 A;  1WIM A;  3KNV A;  4V3K C;  2Y43 A;  2FUU A;  2LV9 A;  4A49 A;  4GNE A;  2ECT A;  3HCT A;  1MM2 A;  3IHP A;  2KYU A;  2MNZ A;  4UI9 B;  3GL6 A;  1WGM A;  5C11 A;  2YHN A;  5G0F A;  4I7C A;  2LXH C;  2C2V S;  1WFK A;  2YSM A;  3ZYQ A;  2MUM A;  5LKU A;  2JRJ A;  1X4J A;  2CSZ A;  2EA6 A;  1N87 A;  2CSY A;  2L43 A;  5B76 A;  1XWH A;  4UP0 A;  4C9Z A;  2PUY A;  4LAD B;  2HYE D;  2CT2 A;  2MA5 A;  5TBN A;  3M62 A;  2XEU A;  4R2Y A;  3L1X A;  3N9O A;  2KGG A;  5B75 A;  2KU3 A;  2M85 A;  1HYJ A;  2LGK A;  3C6W A;  1Z60 A;  2M1R A;  3ZPV 1;  2D8S A;  3I2D A;  1V87 A;  3N9P A;  1JOC A;  3PHD A;  4GNG A;  2JMJ A;  3NG2 A;  2YUR A;  5TAB A;  4WZ0 A;  3N9Q A;  2L5U A;  2AN6 A;  2F6J A;  5B79 A;  4YAD A;  4FIP A;  4YAX A;  1LDK C;  4S3O B;  4YAB A;  1WEV A;  4LJN A;  4CA1 A;  1WIL A;  3MHS A;  4GND A;  2L0B A;  4QF3 A;  1VD4 A;  2LXP C;  2M6M A;  4MSX A;  4ZDT A;  1BOR A;  5D1K B;  2MA6 A;  1FBV A;  1RMD A;  2H0D B;  4ZQL A;  4S3O C;  4N3W A;  1VFY A;  1WEU A;  1Z2Q A;  4A4C A;  3O35 A;  2KWJ A;  2G6Q A;  2MD7 B;  2UZG A;  2KWN A;  5H1T A;  4CCG X;  2JMI A;  2LRI C;  1IYM A;  1X4U A;  3DQV R;  2XB1 A;  3SHB A;  2JMD A;  3LQJ A;  2QJ0 A;  2F42 A;  2QIC A;  3HCS A;  4LLB A;  2F6N A;  3KQI A;  5J3X A;  2VJE B;  5D1M B;  1JM7 B;  2YRE A;  4YC9 A;  2ECJ A;  4YBM A;  1WE9 A;  2KFT A;  3L11 A;  2H0D A;  1WEE A;  3EB5 A;  2ECI A;  2ECW A;  1MM3 A;  4PTB A;  5H9M A;  5LKX A;  3L1Z B;  2CKL B;  4Q6F A;  2YSJ A;  1HYI A;  2RSD A;  5G05 B;  4AUQ B;  5JG6 A;  5KH9 A;  4FK5 A;  2MT5 A;  4A4B A;  2YW8 A;  4N4F A;  2KE1 A;  4YBT A;  2VPE A;  3ZNI A;  2G43 A;  2LGV A;  3ZVZ B;  5H1V A;  4BBQ A;  1F62 A;  5AIU A;  1E4U A;  3ZPV E;  2YU4 A;  2KR4 A;  2VJE A;  1G25 A;  5TRB A;  1JM7 A;  4X3G A;  3PUR A;  4AP4 A;  2PNX A;  2EGP A;  1VYX A;  2MD8 C;  4W4U A;  1CHC A;  2CKL A;  2ECV A;  4LKA A;  3VK6 A;  5KH3 A;  4IC3 A;  2YT5 A;  3O7A A;  3N9N A;  5FB1 A;  4P5O B;  2VP7 A;  2FUI A;  2KGI A;  3KV5 A;  5D1L B;  5KH7 A;  1WEW A;  2QIZ A;  3PUQ A;  5I3L A;  4R8P K;  4GNF A;  4R7E A;  3HCU A;  3ZTG A;  2VJF B;  3SOU A;  2YQM A;  3SOX A;  4AVX A;  5FB0 A;  4L58 A;  1WEP A;  5EYA F;  2YYR A;  1WEN A;  4V3L C;  4I7B A;  1WEQ A;  4GB0 A;  1X4I A;  3GV4 A;  3V43 A;  5FEY A;  3C5K A;  4O64 A;  2LGG A;  4L7X A;  2L75 A;  1DVP A;  4FJC A;  5C13 A;  4MVT A;  3U5N A;  2IDA A;  1K2F A;  4WZ2 A;  2K17 A;  3EB6 A;  4YBS A;  3U5M A;  5DIN A;  1FP0 A;  5LKT A;  2FSA A;  3SOW A;  2DX8 A;  2M3H A;  2VJF A;  4LK9 A;  1ZBD B;  1WEM A;  3FL2 A;  2KIZ A;  2VPB A;  5TDW A;  5B77 A;  3N9M A;  2LDR A;  4BHW A;  3O70 A;  2LN0 A;  3RPG B;  2RI7 A;  2VPG A;  4B7Y C;  4TKP B;  3O34 A;  5LKZ A; 
#chains in the Genus database with same CATH topology
 5DKA A;  2FD4 A;  4B86 C;  2ECN A;  3LRQ A;  3U5O A;  5H1U A;  3U5P A;  2FFW A;  4WZ3 B;  4OGE A;  2ZET C;  4NN2 A;  4IC2 A;  5B78 A;  4AYC B;  3LQI A;  4YAT A;  2HDP A;  4A0C D;  2MNY A;  3RPG C;  4FO9 A;  2K1J A;  2I50 A;  2VNF A;  3T7L A;  3DPL R;  2YVR A;  3O37 A;  2YUC A;  1WES A;  2KWK A;  4I7D A;  2BAY A;  2G45 A;  2Y1M A;  1LDJ B;  3RTR B;  4ZUX U;  3PLW A;  4OGC A;  1U6G B;  4QF2 A;  4UP5 A;  2L80 A;  2NAA A;  2K16 A;  2KRE A;  2C2L A;  5AIT A;  2E6R A;  3KV6 A;  3DDT A;  3SUB A;  2OWA A;  2LQ6 A;  3O36 A;  3FEH A;  4AYC A;  5G04 B;  3HTK C;  2LGL A;  2YQL A;  5FER A;  3FM8 C;  2OXQ C;  5B8D A;  3T6R A;  3QZV A;  3ASL A;  2VPD A;  3ZVY A;  2EOD A;  2K4D A;  1Z6U A;  3O33 A;  1T1H A;  3N9L A;  4PPE A;  2MIQ A;  3O47 A;  1WEO A;  3LQH A;  2ECG A;  3M99 A;  2E6S A;  2B0O E;  4F52 B;  5LCW B;  3DWD A;  5TDR A;  2KWO A;  4WA6 A;  2YHO A;  3M63 A;  2Y1N A;  3MHH A;  4XI1 A;  1WIM A;  3KNV A;  4V3K C;  2Y43 A;  2FUU A;  2LV9 A;  5SVI B;  4A49 A;  4GNE A;  2ECT A;  3HCT A;  1MM2 A;  3IHP A;  2KYU A;  2MNZ A;  4UI9 B;  3GL6 A;  1WGM A;  5C11 A;  2YHN A;  3JUE A;  5G0F A;  4I7C A;  2LXH C;  2C2V S;  1WFK A;  2IQJ A;  2YSM A;  3ZYQ A;  3M7K A;  2MUM A;  5LKU A;  2JRJ A;  2KKY A;  1X4J A;  2CSZ A;  2EA6 A;  1N87 A;  2KKX A;  2CSY A;  2L43 A;  5B76 A;  1XWH A;  2CRR A;  4UP0 A;  4C9Z A;  2PUY A;  4LAD B;  2HYE D;  2CT2 A;  2MA5 A;  2LAU A;  5SVI A;  5TBN A;  4F1P A;  3M62 A;  2XEU A;  4R2Y A;  2XP0 A;  2CSV A;  5K3Q A;  3L1X A;  3N9O A;  2M13 A;  2EGM A;  2KGG A;  5B75 A;  2KU3 A;  3E2D A;  2M85 A;  1HYJ A;  2LGK A;  3C6W A;  1Z60 A;  2M1R A;  3ZPV 1;  2D8S A;  3I2D A;  2P57 A;  1V87 A;  3N9P A;  1JOC A;  3PHD A;  2E61 A;  4GNG A;  2JMJ A;  3NG2 A;  2YUR A;  5TAB A;  4WZ0 A;  3N9Q A;  2L5U A;  2AN6 A;  2F6J A;  5B79 A;  2JUN A;  4YAD A;  3LDY A;  4FIP A;  4YAX A;  3LJU X;  1LDK C;  4S3O B;  4YAB A;  1WEV A;  4LJN A;  4CA1 A;  1WIL A;  2EXU A;  3MHS A;  2JM3 A;  3KDE C;  4GND A;  2L0B A;  4O62 A;  4QF3 A;  1VD4 A;  2LXP C;  2M6M A;  4MSX A;  4ZDT A;  1BOR A;  5D1K B;  3FAN A;  2MA6 A;  1FBV A;  1RMD A;  2CON A;  2H0D B;  4ZQL A;  2DSM A;  4S3O C;  4N3W A;  1VFY A;  1WEU A;  1Z2Q A;  4Z0R A;  4A4C A;  3O35 A;  2KWJ A;  2G6Q A;  2MD7 B;  2UZG A;  2KWN A;  5H1T A;  4CCG X;  2XOZ A;  2JMI A;  2LRI C;  1MBM A;  1IYM A;  1X4U A;  3DQV R;  2XB1 A;  2XOY A;  4QQ4 A;  3SHB A;  2JMD A;  3LQJ A;  2QJ0 A;  2F42 A;  2QIC A;  3HCS A;  4LLB A;  2F6N A;  3KQI A;  5J3X A;  2VJE B;  5D1M B;  2CRW A;  3T9K A;  1JM7 B;  2YRE A;  4YC9 A;  2ECJ A;  4YBM A;  3L11 A;  1WE9 A;  2KFT A;  2H0D A;  1WEE A;  3EB5 A;  2ECI A;  2ECW A;  1MM3 A;  4PTB A;  5H9M A;  5LKX A;  1DCQ A;  3L1Z B;  3Q1D A;  2CKL B;  4Q6F A;  2YSJ A;  1HYI A;  3MDB C;  2RSD A;  5G05 B;  4AUQ B;  5JG6 A;  5KH9 A;  4FK5 A;  2MT5 A;  2D8U A;  4A4B A;  2YW8 A;  4N4F A;  2KE1 A;  4YBT A;  2VPE A;  2DJA A;  2G43 A;  3ZNI A;  2LGV A;  3ZVZ B;  5H1V A;  4BBQ A;  1F62 A;  5AIU A;  1E4U A;  3ZPV E;  2YU4 A;  2KR4 A;  2VJE A;  1G25 A;  5TRB A;  1JM7 A;  4X3G A;  3LVR E;  3PUR A;  4AP4 A;  2PNX A;  2EGP A;  1VYX A;  2MD8 C;  4W4U A;  1CHC A;  2CKL A;  2ECV A;  4LKA A;  5SVX A;  3VK6 A;  5KH3 A;  4IC3 A;  2YT5 A;  3O7A A;  3N9N A;  5FB1 A;  4P5O B;  2VP7 A;  2FUI A;  2KGI A;  3LVQ E;  3KV5 A;  5D1L B;  4Z0O A;  5KH7 A;  1WEW A;  2QIZ A;  3PUQ A;  5I3L A;  4R8P K;  4GNF A;  2XOC A;  4R7E A;  3HCU A;  2MKE A;  3ZTG A;  2VJF B;  3SOU A;  2YQM A;  3SOX A;  4AVX A;  2RR4 A;  5FB0 A;  4L58 A;  1WEP A;  5EYA F;  2YYR A;  2L7P A;  1WEN A;  4V3L C;  4I7B A;  1WEQ A;  4GB0 A;  1X4I A;  3GV4 A;  3V43 A;  5FEY A;  3C5K A;  4O64 A;  2LGG A;  4L7X A;  2L75 A;  1DVP A;  4FJC A;  5C13 A;  4MVT A;  3FJU B;  2IDA A;  1K2F A;  4WZ2 A;  3U5N A;  2K17 A;  3EB6 A;  4YBS A;  3U5M A;  5DIN A;  1FP0 A;  5LKT A;  2FSA A;  3SOW A;  2DX8 A;  2M3H A;  2VJF A;  4LK9 A;  5SVY A;  1ZBD B;  1WEM A;  3FL2 A;  2KIZ A;  2VPB A;  5TDW A;  5B77 A;  3N9M A;  2LDR A;  4BHW A;  3H7H A;  3O70 A;  4H9D A;  2LN0 A;  3RPG B;  2RI7 A;  2VPG A;  4B7Y C;  4TKP B;  3O34 A;  5LKZ A;  3FAO A; 
#chains in the Genus database with same CATH homology
 5DKA A;  4B86 C;  2ECN A;  3LRQ A;  3U5O A;  5H1U A;  3U5P A;  4WZ3 B;  2ZET C;  4NN2 A;  4IC2 A;  5B78 A;  4AYC B;  3LQI A;  4YAT A;  2HDP A;  4A0C D;  2MNY A;  3RPG C;  4FO9 A;  2K1J A;  2I50 A;  2VNF A;  3T7L A;  3DPL R;  3O37 A;  2YUC A;  1WES A;  2KWK A;  4I7D A;  2BAY A;  2G45 A;  2Y1M A;  1LDJ B;  3RTR B;  4ZUX U;  1U6G B;  4QF2 A;  4UP5 A;  2L80 A;  2NAA A;  2K16 A;  2KRE A;  2C2L A;  5AIT A;  2E6R A;  3KV6 A;  2LQ6 A;  3O36 A;  4AYC A;  5G04 B;  3HTK C;  2LGL A;  2YQL A;  5FER A;  2OXQ C;  5B8D A;  3T6R A;  3QZV A;  3ASL A;  2VPD A;  3ZVY A;  2EOD A;  2K4D A;  1Z6U A;  3O33 A;  1T1H A;  3N9L A;  4PPE A;  2MIQ A;  1WEO A;  3LQH A;  2ECG A;  3M99 A;  2E6S A;  4F52 B;  5LCW B;  5TDR A;  2KWO A;  4WA6 A;  2YHO A;  3M63 A;  2Y1N A;  3MHH A;  4XI1 A;  1WIM A;  3KNV A;  4V3K C;  2Y43 A;  2FUU A;  2LV9 A;  4A49 A;  4GNE A;  2ECT A;  3HCT A;  1MM2 A;  3IHP A;  2KYU A;  2MNZ A;  4UI9 B;  3GL6 A;  1WGM A;  5C11 A;  2YHN A;  5G0F A;  4I7C A;  2LXH C;  2C2V S;  1WFK A;  2YSM A;  3ZYQ A;  2MUM A;  5LKU A;  2JRJ A;  1X4J A;  2CSZ A;  2EA6 A;  1N87 A;  2CSY A;  2L43 A;  5B76 A;  1XWH A;  4UP0 A;  4C9Z A;  2PUY A;  4LAD B;  2HYE D;  2CT2 A;  2MA5 A;  5TBN A;  3M62 A;  2XEU A;  4R2Y A;  3L1X A;  3N9O A;  2KGG A;  5B75 A;  2KU3 A;  2M85 A;  1HYJ A;  2LGK A;  3C6W A;  1Z60 A;  2M1R A;  3ZPV 1;  2D8S A;  3I2D A;  1V87 A;  3N9P A;  1JOC A;  3PHD A;  4GNG A;  2JMJ A;  3NG2 A;  2YUR A;  5TAB A;  4WZ0 A;  3N9Q A;  2L5U A;  2AN6 A;  2F6J A;  5B79 A;  4YAD A;  4FIP A;  4YAX A;  1LDK C;  4S3O B;  4YAB A;  1WEV A;  4LJN A;  4CA1 A;  1WIL A;  3MHS A;  4GND A;  2L0B A;  4QF3 A;  1VD4 A;  2LXP C;  2M6M A;  4MSX A;  4ZDT A;  1BOR A;  5D1K B;  2MA6 A;  1FBV A;  1RMD A;  2H0D B;  4ZQL A;  4S3O C;  4N3W A;  1VFY A;  1WEU A;  1Z2Q A;  4A4C A;  3O35 A;  2KWJ A;  2G6Q A;  2MD7 B;  2UZG A;  2KWN A;  5H1T A;  4CCG X;  2JMI A;  2LRI C;  1IYM A;  1X4U A;  3DQV R;  2XB1 A;  3SHB A;  2JMD A;  3LQJ A;  2QJ0 A;  2F42 A;  2QIC A;  3HCS A;  4LLB A;  2F6N A;  3KQI A;  5J3X A;  2VJE B;  5D1M B;  1JM7 B;  2YRE A;  4YC9 A;  2ECJ A;  4YBM A;  1WE9 A;  2KFT A;  3L11 A;  2H0D A;  1WEE A;  3EB5 A;  2ECI A;  2ECW A;  1MM3 A;  4PTB A;  5H9M A;  5LKX A;  3L1Z B;  2CKL B;  4Q6F A;  2YSJ A;  1HYI A;  2RSD A;  5G05 B;  4AUQ B;  5JG6 A;  5KH9 A;  4FK5 A;  2MT5 A;  4A4B A;  2YW8 A;  4N4F A;  2KE1 A;  4YBT A;  2VPE A;  3ZNI A;  2G43 A;  2LGV A;  3ZVZ B;  5H1V A;  4BBQ A;  1F62 A;  5AIU A;  1E4U A;  3ZPV E;  2YU4 A;  2KR4 A;  2VJE A;  1G25 A;  5TRB A;  1JM7 A;  4X3G A;  3PUR A;  4AP4 A;  2PNX A;  2EGP A;  1VYX A;  2MD8 C;  4W4U A;  1CHC A;  2CKL A;  2ECV A;  4LKA A;  3VK6 A;  5KH3 A;  4IC3 A;  2YT5 A;  3O7A A;  3N9N A;  5FB1 A;  4P5O B;  2VP7 A;  2FUI A;  2KGI A;  3KV5 A;  5D1L B;  5KH7 A;  1WEW A;  2QIZ A;  3PUQ A;  5I3L A;  4R8P K;  4GNF A;  4R7E A;  3HCU A;  3ZTG A;  2VJF B;  3SOU A;  2YQM A;  3SOX A;  4AVX A;  5FB0 A;  4L58 A;  1WEP A;  5EYA F;  2YYR A;  1WEN A;  4V3L C;  4I7B A;  1WEQ A;  4GB0 A;  1X4I A;  3GV4 A;  3V43 A;  5FEY A;  3C5K A;  4O64 A;  2LGG A;  4L7X A;  2L75 A;  1DVP A;  4FJC A;  5C13 A;  4MVT A;  3U5N A;  2IDA A;  1K2F A;  4WZ2 A;  2K17 A;  3EB6 A;  4YBS A;  3U5M A;  5DIN A;  1FP0 A;  5LKT A;  2FSA A;  3SOW A;  2DX8 A;  2M3H A;  2VJF A;  4LK9 A;  1ZBD B;  1WEM A;  3FL2 A;  2KIZ A;  2VPB A;  5TDW A;  5B77 A;  3N9M A;  2LDR A;  4BHW A;  3O70 A;  2LN0 A;  3RPG B;  2RI7 A;  2VPG A;  4B7Y C;  4TKP B;  3O34 A;  5LKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...