5KH3A

Crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl)propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Histone deacetylase 6
publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 101
sequence length 101
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh3A00
4GNEA 2MA6A 2KU3A 4WZ2A 2AN6A 4R2YA 2K17A 4O64A 4ZQLA 4LK9A 2K4DA 2KWNA 4GNDA 3SOUA 4L7XA 3KQIA 2E6RA 3RTRB 2M1RA 2XEUA 1HYJA 4LADB 2JRJA 1U6GB 2MD7B 2I50A 5FERA 1WFKA 1RMDA 3PURA 4W4UA 2RSDA 4YABA 4ZDTA 4CCGX 3PHDA 4LLBA 4R7EA 3DPLR 2KWOA 5FB0A 1WE9A 2YUCA 2LRIC 2EA6A 2G45A 5B8DA 5H1VA 2FUIA 2YHOA 2YSMA 3PUQA 2KGGA 1T1HA 4A4BA 3HCTA 4MSXA 3O35A 2MA5A 3ZPV1 2XB1A 2CKLA 2LGVA 1JM7A 2VJFA 1VD4A 2LGKA 3FL2A 2KGIA 2YW8A 2KE1A 2KWKA 3L11A 1WEQA 4BBQA 2VPEA 4I7DA 2MNYA 4LJNA 5LKXA 4V3LC 4A49A 2L43A 2UZGA 3ZYQA 4WZ0A 2H0DB 4YC9A 2EODA 4BHWA 2PUYA 2M6MA 1WEUA 3EB5A 5D1KB 2G43A 1WEPA 2ECTA 3LQJA 2F6JA 5AIUA 2ECVA 4WZ3B 1V87A 1BORA 3C5KA 3N9QA 3SOXA 1F62A 5D1MB 2EGPA 2YHNA 2YQMA 3MHSA 1WEEA 2Y1MA 2MUMA 4FO9A 3ZTGA 4PTBA 3KNVA 3HCSA 1WILA 2QJ0A 3RPGB 1K2FA 4TKPB 3LQIA 3NG2A 1FP0A 4IC2A 3QZVA 2ECNA 1LDKC 3LRQA 2YT5A 3GV4A 3L1XA 5H9MA 2MT5A 2IDAA 4AYCA 5TABA 2LGLA 5B79A 3L1ZB 4CA1A 2JMIA 4F52B 4V3KC 2YYRA 2CSZA 4S3OB 2HDPA 2NAAA 4A4CA 2VJEB 2CT2A 2ECJA 5G04B 4FIPA 2JMJA 1X4UA 3O33A 3M63A 5C11A 4AVXA 2KWJA 4IC3A 5G0FA 5JG6A 1WEOA 3M62A 2E6SA 3GL6A 4GNFA 1Z60A 2QICA 2YSJA 2L75A 4AP4A 1WIMA 5TBNA 2F42A 5H1UA 3T6RA 2MD8C 2K1JA 5TDRA 3U5PA 4I7CA 4B86C 3VK6A 3KV5A 2YURA 4MVTA 4AUQB 5B75A 1E4UA 4N3WA 3O7AA 1DVPA 2ZETC 3ASLA 2LDRA 3N9LA 4ZUXU 2FSAA 2KR4A 1WGMA 2YQLA 3ZVYA 1VFYA 4YBTA 4UP0A 5I3LA 4YBSA 4P5OB 1X4JA 4QF2A 4YBMA 1WENA 4YATA 1WEVA 5KH3A 2G6QA 5DKAA 5EYAF 5B78A 4FK5A 3ZNIA 5LKTA 2D8SA 2M85A 1FBVA 3ZPVE 2CKLB 1WESA 4GB0A 4XI1A 2VP7A 1JM7B 2KREA 3N9OA 2BAYA 2HYED 3M99A 3O34A 2VJFB 4L58A 2MIQA 3N9PA 2YU4A 1MM2A 2C2VS 3IHPA 1IYMA 2ECGA 5LKZA 4S3OC 5AITA 3O37A 5FEYA 4NN2A 2M3HA 5H1TA 2QIZA 2KIZA 4Q6FA 2JMDA 1ZBDB 3V43A 5TDWA 5J3XA 5B76A 1WEWA 4FJCA 1CHCA 2LXHC 2RI7A 2C2LA 1WEMA 3ZVZB 2L80A 2VNFA 3SHBA 1X4IA 4WA6A 4YADA 2VPBA 3O36A 2LV9A 4AYCB 1MM3A 2VPDA 5C13A 2CSYA 1Z6UA 3MHHA 2F6NA 3LQHA 5D1LB 5TRBA 4LKAA 2LQ6A 4QF3A 1N87A 4YAXA 1XWHA 3T7LA 3SOWA 2LN0A 3HCUA 4C9ZA 4UP5A 5DINA 1Z2QA 2H0DA 2LXPC 4GNGA 3U5MA 2LGGA 1G25A 2K16A 2L0BA 2KFTA 4X3GA 4A0CD 4UI9B 3C6WA 4R8PK 2OXQC 5KH7A 5LKUA 3RPGC 3DQVR 3U5OA 5KH9A 2ECIA 2ECWA 4I7BA 5B77A 2Y43A 3HTKC 1HYIA 2L5UA 2PNXA 4N4FA 3N9MA 3N9NA 5LCWB 5G05B 3EB6A 3KV6A 1JOCA 1LDJB 3U5NA 2YREA 5FB1A 2FUUA 2MNZA 2Y1NA 4PPEA 2DX8A 2KYUA 3I2DA 1VYXA 2VJEA 2VPGA 4B7YC 3O70A
chains in the Genus database with same CATH superfamily
4GNEA 2MA6A 2KU3A 4WZ2A 2AN6A 4R2YA 2K17A 4O64A 4ZQLA 3H7HA 4LK9A 2K4DA 2KWNA 4GNDA 3T9KA 3SOUA 4L7XA 3KQIA 2E6RA 3RTRB 2M1RA 2XEUA 1HYJA 2E61A 4LADB 2JRJA 1U6GB 2MD7B 2I50A 5FERA 1WFKA 1RMDA 3PURA 4W4UA 2RSDA 4YABA 4ZDTA 4CCGX 3PHDA 4LLBA 4R7EA 3DPLR 2KWOA 3O47A 5FB0A 1WE9A 5K3QA 2YUCA 2LRIC 2EA6A 2G45A 5B8DA 5H1VA 2FUIA 2YHOA 2YSMA 3PUQA 2KGGA 1T1HA 4A4BA 3HCTA 4MSXA 3O35A 2MA5A 3ZPV1 2XB1A 2CKLA 2LGVA 1JM7A 2DJAA 4OGCA 2VJFA 2XP0A 1VD4A 5SVXA 2LGKA 3FL2A 2KGIA 2YW8A 2KE1A 2KWKA 3L11A 1WEQA 4BBQA 2P57A 2VPEA 4I7DA 2MNYA 4LJNA 5LKXA 4V3LC 2IQJA 4Z0RA 4A49A 2L43A 2UZGA 3ZYQA 4WZ0A 2H0DB 4YC9A 2EODA 4BHWA 2PUYA 2M6MA 3LVQE 1WEUA 3EB5A 4F1PA 5D1KB 2G43A 1WEPA 2ECTA 3LQJA 2F6JA 3FAOA 5AIUA 2ECVA 4WZ3B 1V87A 1BORA 3C5KA 3N9QA 3DDTA 3SOXA 1F62A 5D1MB 2EGPA 2YHNA 2YQMA 3MHSA 1WEEA 2Y1MA 2MUMA 4FO9A 3ZTGA 4PTBA 3KNVA 3HCSA 1WILA 2QJ0A 3RPGB 2LAUA 1K2FA 4TKPB 1DCQA 3LJUX 3LQIA 3NG2A 1FP0A 4IC2A 3QZVA 2ECNA 1LDKC 3LRQA 3M7KA 2YT5A 2RR4A 5SVIA 3GV4A 4H9DA 3L1XA 5H9MA 3SUBA 2MT5A 2IDAA 4AYCA 5TABA 2LGLA 3FANA 5B79A 3L1ZB 4CA1A 2FD4A 2JMIA 4F52B 4V3KC 2YYRA 2CSZA 4S3OB 2HDPA 2NAAA 2JUNA 4A4CA 2CRWA 2VJEB 2L7PA 2CT2A 3PLWA 2ECJA 5G04B 4FIPA 2JMJA 1X4UA 3O33A 3M63A 5C11A 4AVXA 2KWJA 3JUEA 4IC3A 5G0FA 5JG6A 4QQ4A 1WEOA 5SVIB 3M62A 2E6SA 3GL6A 4GNFA 1Z60A 2QICA 2YSJA 2L75A 4AP4A 1WIMA 5TBNA 4O62A 2F42A 5H1UA 3T6RA 2MD8C 2K1JA 5TDRA 3U5PA 4I7CA 4B86C 3VK6A 3KV5A 2YURA 4MVTA 4AUQB 2JM3A 5B75A 2XOYA 1E4UA 4N3WA 3O7AA 1DVPA 2ZETC 3ASLA 2LDRA 3N9LA 4ZUXU 2XOZA 2FSAA 2KR4A 1WGMA 2DSMA 2B0OE 2YQLA 3ZVYA 1VFYA 4YBTA 4UP0A 5I3LA 4YBSA 4P5OB 1X4JA 3Q1DA 4QF2A 4YBMA 2OWAA 1WENA 4YATA 1WEVA 5KH3A 2G6QA 5DKAA 5EYAF 5B78A 4FK5A 3ZNIA 5LKTA 2D8SA 2M85A 4OGEA 2M13A 1FBVA 3ZPVE 2CKLB 1WESA 4GB0A 4XI1A 2D8UA 2VP7A 1JM7B 2KREA 3N9OA 2BAYA 2HYED 3M99A 3O34A 2VJFB 4L58A 2MIQA 3N9PA 2YU4A 1MM2A 2C2VS 3IHPA 1IYMA 3FEHA 2CRRA 2KKXA 2ECGA 5LKZA 4S3OC 5AITA 3O37A 5FEYA 4NN2A 2M3HA 1MBMA 5H1TA 2QIZA 2KIZA 4Q6FA 2JMDA 1ZBDB 3V43A 5TDWA 5J3XA 5B76A 1WEWA 4FJCA 1CHCA 2LXHC 5SVYA 2RI7A 2C2LA 4Z0OA 1WEMA 3ZVZB 3E2DA 2L80A 2VNFA 3SHBA 3LVRE 1X4IA 4WA6A 4YADA 2VPBA 3O36A 2LV9A 4AYCB 1MM3A 2VPDA 5C13A 2CSYA 1Z6UA 3MHHA 2F6NA 3LQHA 5D1LB 3FM8C 5TRBA 4LKAA 2LQ6A 4QF3A 1N87A 4YAXA 1XWHA 3LDYA 3FJUB 2YVRA 2MKEA 3T7LA 3SOWA 2LN0A 3HCUA 4C9ZA 4UP5A 5DINA 1Z2QA 2H0DA 2LXPC 3KDEC 4GNGA 2EXUA 3U5MA 2LGGA 1G25A 2K16A 2L0BA 2CONA 2KFTA 4X3GA 4A0CD 3MDBC 4UI9B 3C6WA 4R8PK 2OXQC 5KH7A 5LKUA 2EGMA 2CSVA 3RPGC 3DQVR 3U5OA 5KH9A 2ECIA 2ECWA 4I7BA 5B77A 2Y43A 3HTKC 1HYIA 2L5UA 2FFWA 2PNXA 2KKYA 4N4FA 3N9MA 3N9NA 5G05B 5LCWB 3EB6A 3KV6A 1JOCA 1LDJB 3U5NA 2YREA 2XOCA 5FB1A 2FUUA 2MNZA 2Y1NA 4PPEA 2DX8A 2KYUA 3I2DA 1VYXA 2VJEA 2VPGA 4B7YC 3O70A 3DWDA
chains in the Genus database with same CATH topology
4GNEA 2MA6A 2KU3A 4WZ2A 2AN6A 4R2YA 2K17A 4O64A 4ZQLA 4LK9A 2K4DA 2KWNA 4GNDA 3SOUA 4L7XA 3KQIA 2E6RA 3RTRB 2M1RA 2XEUA 1HYJA 4LADB 2JRJA 1U6GB 2MD7B 2I50A 5FERA 1WFKA 1RMDA 3PURA 4W4UA 2RSDA 4YABA 4ZDTA 4CCGX 3PHDA 4LLBA 4R7EA 3DPLR 2KWOA 5FB0A 1WE9A 2YUCA 2LRIC 2EA6A 2G45A 5B8DA 5H1VA 2FUIA 2YHOA 2YSMA 3PUQA 2KGGA 1T1HA 4A4BA 3HCTA 4MSXA 3O35A 2MA5A 3ZPV1 2XB1A 2CKLA 2LGVA 1JM7A 2VJFA 1VD4A 2LGKA 3FL2A 2KGIA 2YW8A 2KE1A 2KWKA 3L11A 1WEQA 4BBQA 2VPEA 4I7DA 2MNYA 4LJNA 5LKXA 4V3LC 4A49A 2L43A 2UZGA 3ZYQA 4WZ0A 2H0DB 4YC9A 2EODA 4BHWA 2PUYA 2M6MA 1WEUA 3EB5A 5D1KB 2G43A 1WEPA 2ECTA 3LQJA 2F6JA 5AIUA 2ECVA 4WZ3B 1V87A 1BORA 3C5KA 3N9QA 3SOXA 1F62A 5D1MB 2EGPA 2YHNA 2YQMA 3MHSA 1WEEA 2Y1MA 2MUMA 4FO9A 3ZTGA 4PTBA 3KNVA 3HCSA 1WILA 2QJ0A 3RPGB 1K2FA 4TKPB 3LQIA 3NG2A 1FP0A 4IC2A 3QZVA 2ECNA 1LDKC 3LRQA 2YT5A 3GV4A 3L1XA 5H9MA 2MT5A 2IDAA 4AYCA 5TABA 2LGLA 5B79A 3L1ZB 4CA1A 2JMIA 4F52B 4V3KC 2YYRA 2CSZA 4S3OB 2HDPA 2NAAA 4A4CA 2VJEB 2CT2A 2ECJA 5G04B 4FIPA 2JMJA 1X4UA 3O33A 3M63A 5C11A 4AVXA 2KWJA 4IC3A 5G0FA 5JG6A 1WEOA 3M62A 2E6SA 3GL6A 4GNFA 1Z60A 2QICA 2YSJA 2L75A 4AP4A 1WIMA 5TBNA 2F42A 5H1UA 3T6RA 2MD8C 2K1JA 5TDRA 3U5PA 4I7CA 4B86C 3VK6A 3KV5A 2YURA 4MVTA 4AUQB 5B75A 1E4UA 4N3WA 3O7AA 1DVPA 2ZETC 3ASLA 2LDRA 3N9LA 4ZUXU 2FSAA 2KR4A 1WGMA 2YQLA 3ZVYA 1VFYA 4YBTA 4UP0A 5I3LA 4YBSA 4P5OB 1X4JA 4QF2A 4YBMA 1WENA 4YATA 1WEVA 5KH3A 2G6QA 5DKAA 5EYAF 5B78A 4FK5A 3ZNIA 5LKTA 2D8SA 2M85A 1FBVA 3ZPVE 2CKLB 1WESA 4GB0A 4XI1A 2VP7A 1JM7B 2KREA 3N9OA 2BAYA 2HYED 3M99A 3O34A 2VJFB 4L58A 2MIQA 3N9PA 2YU4A 1MM2A 2C2VS 3IHPA 1IYMA 2ECGA 5LKZA 4S3OC 5AITA 3O37A 5FEYA 4NN2A 2M3HA 5H1TA 2QIZA 2KIZA 4Q6FA 2JMDA 1ZBDB 3V43A 5TDWA 5J3XA 5B76A 1WEWA 4FJCA 1CHCA 2LXHC 2RI7A 2C2LA 1WEMA 3ZVZB 2L80A 2VNFA 3SHBA 1X4IA 4WA6A 4YADA 2VPBA 3O36A 2LV9A 4AYCB 1MM3A 2VPDA 5C13A 2CSYA 1Z6UA 3MHHA 2F6NA 3LQHA 5D1LB 5TRBA 4LKAA 2LQ6A 4QF3A 1N87A 4YAXA 1XWHA 3T7LA 3SOWA 2LN0A 3HCUA 4C9ZA 4UP5A 5DINA 1Z2QA 2H0DA 2LXPC 4GNGA 3U5MA 2LGGA 1G25A 2K16A 2L0BA 2KFTA 4X3GA 4A0CD 4UI9B 3C6WA 4R8PK 2OXQC 5KH7A 5LKUA 3RPGC 3DQVR 3U5OA 5KH9A 2ECIA 2ECWA 4I7BA 5B77A 2Y43A 3HTKC 1HYIA 2L5UA 2PNXA 4N4FA 3N9MA 3N9NA 5LCWB 5G05B 3EB6A 3KV6A 1JOCA 1LDJB 3U5NA 2YREA 5FB1A 2FUUA 2MNZA 2Y1NA 4PPEA 2DX8A 2KYUA 3I2DA 1VYXA 2VJEA 2VPGA 4B7YC 3O70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNE A;  2MA6 A;  2KU3 A;  4WZ2 A;  2AN6 A;  4R2Y A;  2K17 A;  4O64 A;  4ZQL A;  4LK9 A;  2K4D A;  2KWN A;  4GND A;  3SOU A;  4L7X A;  3KQI A;  2E6R A;  3RTR B;  2M1R A;  2XEU A;  1HYJ A;  4LAD B;  2JRJ A;  1U6G B;  2MD7 B;  2I50 A;  5FER A;  1WFK A;  1RMD A;  3PUR A;  4W4U A;  2RSD A;  4YAB A;  4ZDT A;  4CCG X;  3PHD A;  4LLB A;  4R7E A;  3DPL R;  2KWO A;  5FB0 A;  1WE9 A;  2YUC A;  2LRI C;  2EA6 A;  2G45 A;  5B8D A;  5H1V A;  2FUI A;  2YHO A;  2YSM A;  3PUQ A;  2KGG A;  1T1H A;  4A4B A;  3HCT A;  4MSX A;  3O35 A;  2MA5 A;  3ZPV 1;  2XB1 A;  2CKL A;  2LGV A;  1JM7 A;  2VJF A;  1VD4 A;  2LGK A;  3FL2 A;  2KGI A;  2YW8 A;  2KE1 A;  2KWK A;  3L11 A;  1WEQ A;  4BBQ A;  2VPE A;  4I7D A;  2MNY A;  4LJN A;  5LKX A;  4V3L C;  4A49 A;  2L43 A;  2UZG A;  3ZYQ A;  4WZ0 A;  2H0D B;  4YC9 A;  2EOD A;  4BHW A;  2PUY A;  2M6M A;  1WEU A;  3EB5 A;  5D1K B;  2G43 A;  1WEP A;  2ECT A;  3LQJ A;  2F6J A;  5AIU A;  2ECV A;  4WZ3 B;  1V87 A;  1BOR A;  3C5K A;  3N9Q A;  3SOX A;  1F62 A;  5D1M B;  2EGP A;  2YHN A;  2YQM A;  3MHS A;  1WEE A;  2Y1M A;  2MUM A;  4FO9 A;  3ZTG A;  4PTB A;  3KNV A;  3HCS A;  1WIL A;  2QJ0 A;  3RPG B;  1K2F A;  4TKP B;  3LQI A;  3NG2 A;  1FP0 A;  4IC2 A;  3QZV A;  2ECN A;  1LDK C;  3LRQ A;  2YT5 A;  3GV4 A;  3L1X A;  5H9M A;  2MT5 A;  2IDA A;  4AYC A;  5TAB A;  2LGL A;  5B79 A;  3L1Z B;  4CA1 A;  2JMI A;  4F52 B;  4V3K C;  2YYR A;  2CSZ A;  4S3O B;  2HDP A;  2NAA A;  4A4C A;  2VJE B;  2CT2 A;  2ECJ A;  5G04 B;  4FIP A;  2JMJ A;  1X4U A;  3O33 A;  3M63 A;  5C11 A;  4AVX A;  2KWJ A;  4IC3 A;  5G0F A;  5JG6 A;  1WEO A;  3M62 A;  2E6S A;  3GL6 A;  4GNF A;  1Z60 A;  2QIC A;  2YSJ A;  2L75 A;  4AP4 A;  1WIM A;  5TBN A;  2F42 A;  5H1U A;  3T6R A;  2MD8 C;  2K1J A;  5TDR A;  3U5P A;  4I7C A;  4B86 C;  3VK6 A;  3KV5 A;  2YUR A;  4MVT A;  4AUQ B;  5B75 A;  1E4U A;  4N3W A;  3O7A A;  1DVP A;  2ZET C;  3ASL A;  2LDR A;  3N9L A;  4ZUX U;  2FSA A;  2KR4 A;  1WGM A;  2YQL A;  3ZVY A;  1VFY A;  4YBT A;  4UP0 A;  5I3L A;  4YBS A;  4P5O B;  1X4J A;  4QF2 A;  4YBM A;  1WEN A;  4YAT A;  1WEV A;  5KH3 A;  2G6Q A;  5DKA A;  5EYA F;  5B78 A;  4FK5 A;  3ZNI A;  5LKT A;  2D8S A;  2M85 A;  1FBV A;  3ZPV E;  2CKL B;  1WES A;  4GB0 A;  4XI1 A;  2VP7 A;  1JM7 B;  2KRE A;  3N9O A;  2BAY A;  2HYE D;  3M99 A;  3O34 A;  2VJF B;  4L58 A;  2MIQ A;  3N9P A;  2YU4 A;  1MM2 A;  2C2V S;  3IHP A;  1IYM A;  2ECG A;  5LKZ A;  4S3O C;  5AIT A;  3O37 A;  5FEY A;  4NN2 A;  2M3H A;  5H1T A;  2QIZ A;  2KIZ A;  4Q6F A;  2JMD A;  1ZBD B;  3V43 A;  5TDW A;  5J3X A;  5B76 A;  1WEW A;  4FJC A;  1CHC A;  2LXH C;  2RI7 A;  2C2L A;  1WEM A;  3ZVZ B;  2L80 A;  2VNF A;  3SHB A;  1X4I A;  4WA6 A;  4YAD A;  2VPB A;  3O36 A;  2LV9 A;  4AYC B;  1MM3 A;  2VPD A;  5C13 A;  2CSY A;  1Z6U A;  3MHH A;  2F6N A;  3LQH A;  5D1L B;  5TRB A;  4LKA A;  2LQ6 A;  4QF3 A;  1N87 A;  4YAX A;  1XWH A;  3T7L A;  3SOW A;  2LN0 A;  3HCU A;  4C9Z A;  4UP5 A;  5DIN A;  1Z2Q A;  2H0D A;  2LXP C;  4GNG A;  3U5M A;  2LGG A;  1G25 A;  2K16 A;  2L0B A;  2KFT A;  4X3G A;  4A0C D;  4UI9 B;  3C6W A;  4R8P K;  2OXQ C;  5KH7 A;  5LKU A;  3RPG C;  3DQV R;  3U5O A;  5KH9 A;  2ECI A;  2ECW A;  4I7B A;  5B77 A;  2Y43 A;  3HTK C;  1HYI A;  2L5U A;  2PNX A;  4N4F A;  3N9M A;  3N9N A;  5LCW B;  5G05 B;  3EB6 A;  3KV6 A;  1JOC A;  1LDJ B;  3U5N A;  2YRE A;  5FB1 A;  2FUU A;  2MNZ A;  2Y1N A;  4PPE A;  2DX8 A;  2KYU A;  3I2D A;  1VYX A;  2VJE A;  2VPG A;  4B7Y C;  3O70 A; 
#chains in the Genus database with same CATH topology
 4GNE A;  2MA6 A;  2KU3 A;  4WZ2 A;  2AN6 A;  4R2Y A;  2K17 A;  4O64 A;  4ZQL A;  3H7H A;  4LK9 A;  2K4D A;  2KWN A;  4GND A;  3T9K A;  3SOU A;  4L7X A;  3KQI A;  2E6R A;  3RTR B;  2M1R A;  2XEU A;  1HYJ A;  2E61 A;  4LAD B;  2JRJ A;  1U6G B;  2MD7 B;  2I50 A;  5FER A;  1WFK A;  1RMD A;  3PUR A;  4W4U A;  2RSD A;  4YAB A;  4ZDT A;  4CCG X;  3PHD A;  4LLB A;  4R7E A;  3DPL R;  2KWO A;  3O47 A;  5FB0 A;  1WE9 A;  5K3Q A;  2YUC A;  2LRI C;  2EA6 A;  2G45 A;  5B8D A;  5H1V A;  2FUI A;  2YHO A;  2YSM A;  3PUQ A;  2KGG A;  1T1H A;  4A4B A;  3HCT A;  4MSX A;  3O35 A;  2MA5 A;  3ZPV 1;  2XB1 A;  2CKL A;  2LGV A;  1JM7 A;  2DJA A;  4OGC A;  2VJF A;  2XP0 A;  1VD4 A;  5SVX A;  2LGK A;  3FL2 A;  2KGI A;  2YW8 A;  2KE1 A;  2KWK A;  3L11 A;  1WEQ A;  4BBQ A;  2P57 A;  2VPE A;  4I7D A;  2MNY A;  4LJN A;  5LKX A;  4V3L C;  2IQJ A;  4Z0R A;  4A49 A;  2L43 A;  2UZG A;  3ZYQ A;  4WZ0 A;  2H0D B;  4YC9 A;  2EOD A;  4BHW A;  2PUY A;  2M6M A;  3LVQ E;  1WEU A;  3EB5 A;  4F1P A;  5D1K B;  2G43 A;  1WEP A;  2ECT A;  3LQJ A;  2F6J A;  3FAO A;  5AIU A;  2ECV A;  4WZ3 B;  1V87 A;  1BOR A;  3C5K A;  3N9Q A;  3DDT A;  3SOX A;  1F62 A;  5D1M B;  2EGP A;  2YHN A;  2YQM A;  3MHS A;  1WEE A;  2Y1M A;  2MUM A;  4FO9 A;  3ZTG A;  4PTB A;  3KNV A;  3HCS A;  1WIL A;  2QJ0 A;  3RPG B;  2LAU A;  1K2F A;  4TKP B;  1DCQ A;  3LJU X;  3LQI A;  3NG2 A;  1FP0 A;  4IC2 A;  3QZV A;  2ECN A;  1LDK C;  3LRQ A;  3M7K A;  2YT5 A;  2RR4 A;  5SVI A;  3GV4 A;  4H9D A;  3L1X A;  5H9M A;  3SUB A;  2MT5 A;  2IDA A;  4AYC A;  5TAB A;  2LGL A;  3FAN A;  5B79 A;  3L1Z B;  4CA1 A;  2FD4 A;  2JMI A;  4F52 B;  4V3K C;  2YYR A;  2CSZ A;  4S3O B;  2HDP A;  2NAA A;  2JUN A;  4A4C A;  2CRW A;  2VJE B;  2L7P A;  2CT2 A;  3PLW A;  2ECJ A;  5G04 B;  4FIP A;  2JMJ A;  1X4U A;  3O33 A;  3M63 A;  5C11 A;  4AVX A;  2KWJ A;  3JUE A;  4IC3 A;  5G0F A;  5JG6 A;  4QQ4 A;  1WEO A;  5SVI B;  3M62 A;  2E6S A;  3GL6 A;  4GNF A;  1Z60 A;  2QIC A;  2YSJ A;  2L75 A;  4AP4 A;  1WIM A;  5TBN A;  4O62 A;  2F42 A;  5H1U A;  3T6R A;  2MD8 C;  2K1J A;  5TDR A;  3U5P A;  4I7C A;  4B86 C;  3VK6 A;  3KV5 A;  2YUR A;  4MVT A;  4AUQ B;  2JM3 A;  5B75 A;  2XOY A;  1E4U A;  4N3W A;  3O7A A;  1DVP A;  2ZET C;  3ASL A;  2LDR A;  3N9L A;  4ZUX U;  2XOZ A;  2FSA A;  2KR4 A;  1WGM A;  2DSM A;  2B0O E;  2YQL A;  3ZVY A;  1VFY A;  4YBT A;  4UP0 A;  5I3L A;  4YBS A;  4P5O B;  1X4J A;  3Q1D A;  4QF2 A;  4YBM A;  2OWA A;  1WEN A;  4YAT A;  1WEV A;  5KH3 A;  2G6Q A;  5DKA A;  5EYA F;  5B78 A;  4FK5 A;  3ZNI A;  5LKT A;  2D8S A;  2M85 A;  4OGE A;  2M13 A;  1FBV A;  3ZPV E;  2CKL B;  1WES A;  4GB0 A;  4XI1 A;  2D8U A;  2VP7 A;  1JM7 B;  2KRE A;  3N9O A;  2BAY A;  2HYE D;  3M99 A;  3O34 A;  2VJF B;  4L58 A;  2MIQ A;  3N9P A;  2YU4 A;  1MM2 A;  2C2V S;  3IHP A;  1IYM A;  3FEH A;  2CRR A;  2KKX A;  2ECG A;  5LKZ A;  4S3O C;  5AIT A;  3O37 A;  5FEY A;  4NN2 A;  2M3H A;  1MBM A;  5H1T A;  2QIZ A;  2KIZ A;  4Q6F A;  2JMD A;  1ZBD B;  3V43 A;  5TDW A;  5J3X A;  5B76 A;  1WEW A;  4FJC A;  1CHC A;  2LXH C;  5SVY A;  2RI7 A;  2C2L A;  4Z0O A;  1WEM A;  3ZVZ B;  3E2D A;  2L80 A;  2VNF A;  3SHB A;  3LVR E;  1X4I A;  4WA6 A;  4YAD A;  2VPB A;  3O36 A;  2LV9 A;  4AYC B;  1MM3 A;  2VPD A;  5C13 A;  2CSY A;  1Z6U A;  3MHH A;  2F6N A;  3LQH A;  5D1L B;  3FM8 C;  5TRB A;  4LKA A;  2LQ6 A;  4QF3 A;  1N87 A;  4YAX A;  1XWH A;  3LDY A;  3FJU B;  2YVR A;  2MKE A;  3T7L A;  3SOW A;  2LN0 A;  3HCU A;  4C9Z A;  4UP5 A;  5DIN A;  1Z2Q A;  2H0D A;  2LXP C;  3KDE C;  4GNG A;  2EXU A;  3U5M A;  2LGG A;  1G25 A;  2K16 A;  2L0B A;  2CON A;  2KFT A;  4X3G A;  4A0C D;  3MDB C;  4UI9 B;  3C6W A;  4R8P K;  2OXQ C;  5KH7 A;  5LKU A;  2EGM A;  2CSV A;  3RPG C;  3DQV R;  3U5O A;  5KH9 A;  2ECI A;  2ECW A;  4I7B A;  5B77 A;  2Y43 A;  3HTK C;  1HYI A;  2L5U A;  2FFW A;  2PNX A;  2KKY A;  4N4F A;  3N9M A;  3N9N A;  5G05 B;  5LCW B;  3EB6 A;  3KV6 A;  1JOC A;  1LDJ B;  3U5N A;  2YRE A;  2XOC A;  5FB1 A;  2FUU A;  2MNZ A;  2Y1N A;  4PPE A;  2DX8 A;  2KYU A;  3I2D A;  1VYX A;  2VJE A;  2VPG A;  4B7Y C;  3O70 A;  3DWD A; 
#chains in the Genus database with same CATH homology
 4GNE A;  2MA6 A;  2KU3 A;  4WZ2 A;  2AN6 A;  4R2Y A;  2K17 A;  4O64 A;  4ZQL A;  4LK9 A;  2K4D A;  2KWN A;  4GND A;  3SOU A;  4L7X A;  3KQI A;  2E6R A;  3RTR B;  2M1R A;  2XEU A;  1HYJ A;  4LAD B;  2JRJ A;  1U6G B;  2MD7 B;  2I50 A;  5FER A;  1WFK A;  1RMD A;  3PUR A;  4W4U A;  2RSD A;  4YAB A;  4ZDT A;  4CCG X;  3PHD A;  4LLB A;  4R7E A;  3DPL R;  2KWO A;  5FB0 A;  1WE9 A;  2YUC A;  2LRI C;  2EA6 A;  2G45 A;  5B8D A;  5H1V A;  2FUI A;  2YHO A;  2YSM A;  3PUQ A;  2KGG A;  1T1H A;  4A4B A;  3HCT A;  4MSX A;  3O35 A;  2MA5 A;  3ZPV 1;  2XB1 A;  2CKL A;  2LGV A;  1JM7 A;  2VJF A;  1VD4 A;  2LGK A;  3FL2 A;  2KGI A;  2YW8 A;  2KE1 A;  2KWK A;  3L11 A;  1WEQ A;  4BBQ A;  2VPE A;  4I7D A;  2MNY A;  4LJN A;  5LKX A;  4V3L C;  4A49 A;  2L43 A;  2UZG A;  3ZYQ A;  4WZ0 A;  2H0D B;  4YC9 A;  2EOD A;  4BHW A;  2PUY A;  2M6M A;  1WEU A;  3EB5 A;  5D1K B;  2G43 A;  1WEP A;  2ECT A;  3LQJ A;  2F6J A;  5AIU A;  2ECV A;  4WZ3 B;  1V87 A;  1BOR A;  3C5K A;  3N9Q A;  3SOX A;  1F62 A;  5D1M B;  2EGP A;  2YHN A;  2YQM A;  3MHS A;  1WEE A;  2Y1M A;  2MUM A;  4FO9 A;  3ZTG A;  4PTB A;  3KNV A;  3HCS A;  1WIL A;  2QJ0 A;  3RPG B;  1K2F A;  4TKP B;  3LQI A;  3NG2 A;  1FP0 A;  4IC2 A;  3QZV A;  2ECN A;  1LDK C;  3LRQ A;  2YT5 A;  3GV4 A;  3L1X A;  5H9M A;  2MT5 A;  2IDA A;  4AYC A;  5TAB A;  2LGL A;  5B79 A;  3L1Z B;  4CA1 A;  2JMI A;  4F52 B;  4V3K C;  2YYR A;  2CSZ A;  4S3O B;  2HDP A;  2NAA A;  4A4C A;  2VJE B;  2CT2 A;  2ECJ A;  5G04 B;  4FIP A;  2JMJ A;  1X4U A;  3O33 A;  3M63 A;  5C11 A;  4AVX A;  2KWJ A;  4IC3 A;  5G0F A;  5JG6 A;  1WEO A;  3M62 A;  2E6S A;  3GL6 A;  4GNF A;  1Z60 A;  2QIC A;  2YSJ A;  2L75 A;  4AP4 A;  1WIM A;  5TBN A;  2F42 A;  5H1U A;  3T6R A;  2MD8 C;  2K1J A;  5TDR A;  3U5P A;  4I7C A;  4B86 C;  3VK6 A;  3KV5 A;  2YUR A;  4MVT A;  4AUQ B;  5B75 A;  1E4U A;  4N3W A;  3O7A A;  1DVP A;  2ZET C;  3ASL A;  2LDR A;  3N9L A;  4ZUX U;  2FSA A;  2KR4 A;  1WGM A;  2YQL A;  3ZVY A;  1VFY A;  4YBT A;  4UP0 A;  5I3L A;  4YBS A;  4P5O B;  1X4J A;  4QF2 A;  4YBM A;  1WEN A;  4YAT A;  1WEV A;  5KH3 A;  2G6Q A;  5DKA A;  5EYA F;  5B78 A;  4FK5 A;  3ZNI A;  5LKT A;  2D8S A;  2M85 A;  1FBV A;  3ZPV E;  2CKL B;  1WES A;  4GB0 A;  4XI1 A;  2VP7 A;  1JM7 B;  2KRE A;  3N9O A;  2BAY A;  2HYE D;  3M99 A;  3O34 A;  2VJF B;  4L58 A;  2MIQ A;  3N9P A;  2YU4 A;  1MM2 A;  2C2V S;  3IHP A;  1IYM A;  2ECG A;  5LKZ A;  4S3O C;  5AIT A;  3O37 A;  5FEY A;  4NN2 A;  2M3H A;  5H1T A;  2QIZ A;  2KIZ A;  4Q6F A;  2JMD A;  1ZBD B;  3V43 A;  5TDW A;  5J3X A;  5B76 A;  1WEW A;  4FJC A;  1CHC A;  2LXH C;  2RI7 A;  2C2L A;  1WEM A;  3ZVZ B;  2L80 A;  2VNF A;  3SHB A;  1X4I A;  4WA6 A;  4YAD A;  2VPB A;  3O36 A;  2LV9 A;  4AYC B;  1MM3 A;  2VPD A;  5C13 A;  2CSY A;  1Z6U A;  3MHH A;  2F6N A;  3LQH A;  5D1L B;  5TRB A;  4LKA A;  2LQ6 A;  4QF3 A;  1N87 A;  4YAX A;  1XWH A;  3T7L A;  3SOW A;  2LN0 A;  3HCU A;  4C9Z A;  4UP5 A;  5DIN A;  1Z2Q A;  2H0D A;  2LXP C;  4GNG A;  3U5M A;  2LGG A;  1G25 A;  2K16 A;  2L0B A;  2KFT A;  4X3G A;  4A0C D;  4UI9 B;  3C6W A;  4R8P K;  2OXQ C;  5KH7 A;  5LKU A;  3RPG C;  3DQV R;  3U5O A;  5KH9 A;  2ECI A;  2ECW A;  4I7B A;  5B77 A;  2Y43 A;  3HTK C;  1HYI A;  2L5U A;  2PNX A;  4N4F A;  3N9M A;  3N9N A;  5LCW B;  5G05 B;  3EB6 A;  3KV6 A;  1JOC A;  1LDJ B;  3U5N A;  2YRE A;  5FB1 A;  2FUU A;  2MNZ A;  2Y1N A;  4PPE A;  2DX8 A;  2KYU A;  3I2D A;  1VYX A;  2VJE A;  2VPG A;  4B7Y C;  3O70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...