5KH3A

Crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl)propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
b'SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone deacetylase 6
publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 101
sequence length 101
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh3A00
2Y1NA 5H9MA 2CKLB 3EB6A 4YC9A 2RI7A 2VPGA 2QICA 4R7EA 5FEYA 2H0DB 2L43A 2YU4A 5FB0A 2KIZA 2YREA 1WEWA 2YUCA 4R8PK 2ECNA 4C9ZA 2YHOA 2PUYA 2ECWA 1WE9A 3LQIA 4FJCA 3L11A 4GNGA 4WZ3B 2EGPA 1WFKA 5KH9A 2LQ6A 3MHSA 4A4BA 2MT5A 5B77A 4V3LC 2KGIA 3M63A 5G04B 3ZVYA 2PNXA 4QF3A 5H1UA 2G43A 5LKXA 1VYXA 3ZYQA 4GB0A 2LV9A 2FUUA 2UZGA 1RMDA 3N9QA 4YAXA 2C2VS 2RSDA 2D8SA 2I50A 4N3WA 2LXHC 4IC3A 2YQMA 2VPEA 3EB5A 2LXPC 5D1MB 1E4UA 3O35A 5LCWB 2MIQA 3RPGC 2MNZA 5FB1A 3C6WA 1X4UA 2HYED 2CKLA 2E6SA 2CSYA 3IHPA 4AP4A 2YURA 3I2DA 1FP0A 1LDKC 1K2FA 4YBSA 2M3HA 2H0DA 4BBQA 1WEMA 3NG2A 4S3OB 5C13A 2LGKA 3DPLR 3GL6A 4I7BA 4LJNA 4Q6FA 5TRBA 4GNDA 4CCGX 2MNYA 2E6RA 2VPBA 2M6MA 5KH3A 2KGGA 5H1TA 1WEVA 5LKTA 4A4CA 5C11A 2ECJA 3C5KA 2VP7A 1ZBDB 2IDAA 3T6RA 4GNEA 1MM2A 2HDPA 4TKPB 2LRIC 1JOCA 5TDRA 5LKUA 2ECTA 2YHNA 2MA5A 3KV6A 2KU3A 2JRJA 4PTBA 1V87A 2LGVA 3O37A 1DVPA 2G6QA 4FK5A 4NN2A 1Z2QA 4B7YC 2KWNA 3DQVR 4X3GA 1G25A 5B78A 3SOWA 5AITA 2KR4A 4LLBA 5G05B 1CHCA 3T7LA 1VD4A 4P5OB 4LK9A 4WA6A 1N87A 4I7CA 3U5OA 1WESA 2LDRA 4B86C 2MD7B 2YYRA 2CSZA 3GV4A 3PURA 1XWHA 3O34A 1FBVA 1HYIA 1VFYA 3RPGB 4BHWA 2XEUA 3KQIA 2VJEB 4CA1A 2EA6A 1WILA 2FSAA 2XB1A 3SOUA 2KREA 5B75A 5TDWA 4PPEA 3N9PA 4MVTA 3ZPVE 2NAAA 2KE1A 2F6NA 1U6GB 2ECGA 4WZ2A 2KWJA 4YBMA 3ZTGA 5AIUA 1LDJB 3N9NA 4A0CD 3PUQA 2F42A 2M85A 4F52B 2MUMA 2K16A 3N9LA 2DX8A 2ZETC 3HCSA 1WEQA 3U5PA 1WEPA 5D1LB 3LQJA 4L7XA 3L1ZB 2FUIA 4R2YA 2ECIA 1WEOA 4I7DA 2EODA 3KNVA 3MHHA 1X4IA 2QIZA 2JMIA 2KWKA 2L80A 2L0BA 3LRQA 3VK6A 4YABA 4YADA 4S3OC 4FO9A 3QZVA 2VJFB 5H1VA 5FERA 3U5MA 1JM7B 3FL2A 5EYAF 4A49A 1X4JA 4WZ0A 2YSJA 4IC2A 4AUQB 2VJEA 3O7AA 5KH7A 1IYMA 3RTRB 2L75A 2LGLA 4UP0A 2MA6A 2QJ0A 2K4DA 4ZQLA 2K17A 3ZVZB 2MD8C 3PHDA 2JMJA 5B76A 2Y1MA 3M99A 3SHBA 4AYCB 5B8DA 4ZDTA 4UI9B 5I3LA 2KFTA 4LADB 4YBTA 2ECVA 2Y43A 4W4UA 4AVXA 4L58A 2KYUA 4N4FA 2LN0A 2VNFA 1MM3A 5TABA 2AN6A 2BAYA 2JMDA 2G45A 4QF2A 1Z6UA 3O36A 1F62A 3KV5A 3V43A 5J3XA 3HCUA 4V3KC 5LKZA 2VPDA 4O64A 2YT5A 2C2LA 5B79A 3O33A 1WGMA 4MSXA 2K1JA 2M1RA 2OXQC 4UP5A 1WIMA 1WENA 2F6JA 2YW8A 3O70A 3LQHA 2VJFA 3SOXA 4ZUXU 3ZPV1 1JM7A 1T1HA 2CT2A 3N9MA 3M62A 2YQLA 5DINA 4GNFA 5D1KB 5JG6A 2YSMA 1Z60A 5G0FA 4YATA 1WEUA 3U5NA 3L1XA 2KWOA 3ASLA 4LKAA 5DKAA 1WEEA 4FIPA 3ZNIA 5TBNA 3HTKC 2LGGA 3N9OA 4AYCA 1BORA 3HCTA 2L5UA 1HYJA 4XI1A
chains in the Genus database with same CATH superfamily
2Y1NA 5H9MA 2CKLB 3EB6A 5SVXA 3FEHA 4YC9A 2RI7A 3PLWA 2VPGA 2QICA 4R7EA 2LAUA 5FEYA 2H0DB 2L43A 2YU4A 5FB0A 2KIZA 2YREA 1WEWA 2YUCA 4R8PK 2ECNA 4C9ZA 2YHOA 2PUYA 2ECWA 3JUEA 1WE9A 3LQIA 4FJCA 3L11A 4GNGA 4WZ3B 2EGPA 1WFKA 5KH9A 2JM3A 2LQ6A 3MHSA 4A4BA 2MT5A 5B77A 4V3LC 2KGIA 3KDEC 3M7KA 3M63A 5G04B 3ZVYA 2PNXA 4QF3A 5H1UA 2G43A 5LKXA 1VYXA 2XP0A 3ZYQA 4GB0A 2LV9A 2FUUA 2UZGA 1RMDA 2RR4A 3N9QA 4YAXA 2C2VS 3LDYA 2RSDA 2D8SA 2I50A 5SVIA 4N3WA 2LXHC 4IC3A 2YQMA 2VPEA 3EB5A 2LXPC 5D1MB 1E4UA 3O35A 5LCWB 3O47A 2MIQA 3RPGC 4QQ4A 2XOZA 2MNZA 5FB1A 3C6WA 1X4UA 2HYED 2DSMA 2CKLA 2E6SA 2CSYA 3IHPA 4AP4A 2YURA 3I2DA 1FP0A 1LDKC 1K2FA 4YBSA 2M3HA 2H0DA 2EGMA 3SUBA 4BBQA 1WEMA 2MKEA 3NG2A 4S3OB 2CSVA 5C13A 2OWAA 4OGEA 2LGKA 3DPLR 3FJUB 3GL6A 4I7BA 4LJNA 4Q6FA 3T9KA 5TRBA 4GNDA 4CCGX 2MNYA 2E6RA 2VPBA 2M6MA 5KH3A 2KGGA 5H1TA 1WEVA 2CRWA 5K3QA 5LKTA 4A4CA 5C11A 2ECJA 3C5KA 2VP7A 1ZBDB 2IDAA 3T6RA 4GNEA 1MM2A 2HDPA 4TKPB 2LRIC 1JOCA 5TDRA 5LKUA 2ECTA 2YHNA 2MA5A 3KV6A 2KU3A 2JRJA 4PTBA 1V87A 3LVRE 2LGVA 3O37A 1DVPA 2P57A 2G6QA 4FK5A 4NN2A 1Z2QA 4B7YC 2CONA 2YVRA 2KWNA 2XOYA 3DQVR 2E61A 4X3GA 1G25A 5B78A 3SOWA 5AITA 2KR4A 4LLBA 5G05B 1CHCA 3T7LA 1VD4A 4P5OB 4LK9A 3FM8C 3H7HA 1N87A 4WA6A 4I7CA 3U5OA 1WESA 2LDRA 4B86C 2MD7B 2YYRA 4Z0RA 2CSZA 3GV4A 3PURA 1XWHA 3O34A 1FBVA 1HYIA 1VFYA 3RPGB 4BHWA 2XEUA 3KQIA 2VJEB 4CA1A 2EA6A 1WILA 2FSAA 2XB1A 3SOUA 2KREA 5B75A 5TDWA 4PPEA 3N9PA 4MVTA 3ZPVE 2CRRA 2NAAA 2KE1A 2F6NA 1DCQA 1U6GB 2ECGA 4WZ2A 2KWJA 2FFWA 4YBMA 3ZTGA 3LVQE 5AIUA 1LDJB 3Q1DA 3N9NA 4A0CD 3FAOA 2FD4A 3PUQA 2F42A 2M85A 4F52B 2MUMA 2K16A 3N9LA 2DX8A 2EXUA 2ZETC 3HCSA 1WEQA 3U5PA 1WEPA 5D1LB 3LQJA 4L7XA 3L1ZB 2FUIA 4R2YA 2ECIA 1WEOA 4I7DA 5SVIB 2EODA 3KNVA 3MHHA 1X4IA 2QIZA 2JMIA 2KWKA 2L80A 2L0BA 3LRQA 3VK6A 4YABA 4YADA 4S3OC 4FO9A 2D8UA 2VJFB 3MDBC 3QZVA 5H1VA 2KKYA 5FERA 3U5MA 1JM7B 3FL2A 5EYAF 4A49A 1X4JA 4WZ0A 2YSJA 4IC2A 4AUQB 2VJEA 3O7AA 5KH7A 1IYMA 3RTRB 2L75A 2LGLA 4UP0A 3FANA 2MA6A 2QJ0A 2K4DA 4ZQLA 2K17A 3ZVZB 2MD8C 3PHDA 2JMJA 5B76A 2Y1MA 3M99A 2M13A 3SHBA 4AYCB 5B8DA 4ZDTA 4UI9B 5I3LA 2KFTA 4LADB 4YBTA 2B0OE 3DDTA 2ECVA 2Y43A 4W4UA 4AVXA 4L58A 2KYUA 4N4FA 2LN0A 2DJAA 1MM3A 2VNFA 5TABA 2AN6A 2BAYA 2JMDA 2JUNA 2KKXA 2G45A 4QF2A 5SVYA 1Z6UA 3O36A 1F62A 3KV5A 3V43A 5J3XA 3HCUA 4V3KC 5LKZA 2VPDA 2IQJA 4O64A 3E2DA 2YT5A 2C2LA 5B79A 3O33A 1WGMA 4MSXA 3LJUX 2K1JA 2M1RA 2OXQC 1MBMA 4UP5A 1WIMA 1WENA 2F6JA 2YW8A 3O70A 3LQHA 2VJFA 3SOXA 4ZUXU 4F1PA 3ZPV1 2L7PA 1JM7A 1T1HA 2CT2A 3N9MA 3M62A 2YQLA 4O62A 2XOCA 5DINA 4GNFA 3DWDA 4H9DA 5D1KB 5JG6A 2YSMA 1Z60A 5G0FA 4YATA 1WEUA 3U5NA 3L1XA 2KWOA 3ASLA 4LKAA 5DKAA 4Z0OA 1WEEA 4FIPA 4OGCA 3ZNIA 5TBNA 3HTKC 2LGGA 3N9OA 4AYCA 1BORA 3HCTA 2L5UA 1HYJA 4XI1A
chains in the Genus database with same CATH topology
2Y1NA 5H9MA 2CKLB 3EB6A 4YC9A 2RI7A 2VPGA 2QICA 4R7EA 5FEYA 2H0DB 2L43A 2YU4A 5FB0A 2KIZA 2YREA 1WEWA 2YUCA 4R8PK 2ECNA 4C9ZA 2YHOA 2PUYA 2ECWA 1WE9A 3LQIA 4FJCA 3L11A 4GNGA 4WZ3B 2EGPA 1WFKA 5KH9A 2LQ6A 3MHSA 4A4BA 2MT5A 5B77A 4V3LC 2KGIA 3M63A 5G04B 3ZVYA 2PNXA 4QF3A 5H1UA 2G43A 5LKXA 1VYXA 3ZYQA 4GB0A 2LV9A 2FUUA 2UZGA 1RMDA 3N9QA 4YAXA 2C2VS 2RSDA 2D8SA 2I50A 4N3WA 2LXHC 4IC3A 2YQMA 2VPEA 3EB5A 2LXPC 5D1MB 1E4UA 3O35A 5LCWB 2MIQA 3RPGC 2MNZA 5FB1A 3C6WA 1X4UA 2HYED 2CKLA 2E6SA 2CSYA 3IHPA 4AP4A 2YURA 3I2DA 1FP0A 1LDKC 1K2FA 4YBSA 2M3HA 2H0DA 4BBQA 1WEMA 3NG2A 4S3OB 5C13A 2LGKA 3DPLR 3GL6A 4I7BA 4LJNA 4Q6FA 5TRBA 4GNDA 4CCGX 2MNYA 2E6RA 2VPBA 2M6MA 5KH3A 2KGGA 5H1TA 1WEVA 5LKTA 4A4CA 5C11A 2ECJA 3C5KA 2VP7A 1ZBDB 2IDAA 3T6RA 4GNEA 1MM2A 2HDPA 4TKPB 2LRIC 1JOCA 5TDRA 5LKUA 2ECTA 2YHNA 2MA5A 3KV6A 2KU3A 2JRJA 4PTBA 1V87A 2LGVA 3O37A 1DVPA 2G6QA 4FK5A 4NN2A 1Z2QA 4B7YC 2KWNA 3DQVR 4X3GA 1G25A 5B78A 3SOWA 5AITA 2KR4A 4LLBA 5G05B 1CHCA 3T7LA 1VD4A 4P5OB 4LK9A 4WA6A 1N87A 4I7CA 3U5OA 1WESA 2LDRA 4B86C 2MD7B 2YYRA 2CSZA 3GV4A 3PURA 1XWHA 3O34A 1FBVA 1HYIA 1VFYA 3RPGB 4BHWA 2XEUA 3KQIA 2VJEB 4CA1A 2EA6A 1WILA 2FSAA 2XB1A 3SOUA 2KREA 5B75A 5TDWA 4PPEA 3N9PA 4MVTA 3ZPVE 2NAAA 2KE1A 2F6NA 1U6GB 2ECGA 4WZ2A 2KWJA 4YBMA 3ZTGA 5AIUA 1LDJB 3N9NA 4A0CD 3PUQA 2F42A 2M85A 4F52B 2MUMA 2K16A 3N9LA 2DX8A 2ZETC 3HCSA 1WEQA 3U5PA 1WEPA 5D1LB 3LQJA 4L7XA 3L1ZB 2FUIA 4R2YA 2ECIA 1WEOA 4I7DA 2EODA 3KNVA 3MHHA 1X4IA 2QIZA 2JMIA 2KWKA 2L80A 2L0BA 3LRQA 3VK6A 4YABA 4YADA 4S3OC 4FO9A 3QZVA 2VJFB 5H1VA 5FERA 3U5MA 1JM7B 3FL2A 5EYAF 4A49A 1X4JA 4WZ0A 2YSJA 4IC2A 4AUQB 2VJEA 3O7AA 5KH7A 1IYMA 3RTRB 2L75A 2LGLA 4UP0A 2MA6A 2QJ0A 2K4DA 4ZQLA 2K17A 3ZVZB 2MD8C 3PHDA 2JMJA 5B76A 2Y1MA 3M99A 3SHBA 4AYCB 5B8DA 4ZDTA 4UI9B 5I3LA 2KFTA 4LADB 4YBTA 2ECVA 2Y43A 4W4UA 4AVXA 4L58A 2KYUA 4N4FA 2LN0A 2VNFA 1MM3A 5TABA 2AN6A 2BAYA 2JMDA 2G45A 4QF2A 1Z6UA 3O36A 1F62A 3KV5A 3V43A 5J3XA 3HCUA 4V3KC 5LKZA 2VPDA 4O64A 2YT5A 2C2LA 5B79A 3O33A 1WGMA 4MSXA 2K1JA 2M1RA 2OXQC 4UP5A 1WIMA 1WENA 2F6JA 2YW8A 3O70A 3LQHA 2VJFA 3SOXA 4ZUXU 3ZPV1 1JM7A 1T1HA 2CT2A 3N9MA 3M62A 2YQLA 5DINA 4GNFA 5D1KB 5JG6A 2YSMA 1Z60A 5G0FA 4YATA 1WEUA 3U5NA 3L1XA 2KWOA 3ASLA 4LKAA 5DKAA 1WEEA 4FIPA 3ZNIA 5TBNA 3HTKC 2LGGA 3N9OA 4AYCA 1BORA 3HCTA 2L5UA 1HYJA 4XI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1N A;  5H9M A;  2CKL B;  3EB6 A;  4YC9 A;  2RI7 A;  2VPG A;  2QIC A;  4R7E A;  5FEY A;  2H0D B;  2L43 A;  2YU4 A;  5FB0 A;  2KIZ A;  2YRE A;  1WEW A;  2YUC A;  4R8P K;  2ECN A;  4C9Z A;  2YHO A;  2PUY A;  2ECW A;  1WE9 A;  3LQI A;  4FJC A;  3L11 A;  4GNG A;  4WZ3 B;  2EGP A;  1WFK A;  5KH9 A;  2LQ6 A;  3MHS A;  4A4B A;  2MT5 A;  5B77 A;  4V3L C;  2KGI A;  3M63 A;  5G04 B;  3ZVY A;  2PNX A;  4QF3 A;  5H1U A;  2G43 A;  5LKX A;  1VYX A;  3ZYQ A;  4GB0 A;  2LV9 A;  2FUU A;  2UZG A;  1RMD A;  3N9Q A;  4YAX A;  2C2V S;  2RSD A;  2D8S A;  2I50 A;  4N3W A;  2LXH C;  4IC3 A;  2YQM A;  2VPE A;  3EB5 A;  2LXP C;  5D1M B;  1E4U A;  3O35 A;  5LCW B;  2MIQ A;  3RPG C;  2MNZ A;  5FB1 A;  3C6W A;  1X4U A;  2HYE D;  2CKL A;  2E6S A;  2CSY A;  3IHP A;  4AP4 A;  2YUR A;  3I2D A;  1FP0 A;  1LDK C;  1K2F A;  4YBS A;  2M3H A;  2H0D A;  4BBQ A;  1WEM A;  3NG2 A;  4S3O B;  5C13 A;  2LGK A;  3DPL R;  3GL6 A;  4I7B A;  4LJN A;  4Q6F A;  5TRB A;  4GND A;  4CCG X;  2MNY A;  2E6R A;  2VPB A;  2M6M A;  5KH3 A;  2KGG A;  5H1T A;  1WEV A;  5LKT A;  4A4C A;  5C11 A;  2ECJ A;  3C5K A;  2VP7 A;  1ZBD B;  2IDA A;  3T6R A;  4GNE A;  1MM2 A;  2HDP A;  4TKP B;  2LRI C;  1JOC A;  5TDR A;  5LKU A;  2ECT A;  2YHN A;  2MA5 A;  3KV6 A;  2KU3 A;  2JRJ A;  4PTB A;  1V87 A;  2LGV A;  3O37 A;  1DVP A;  2G6Q A;  4FK5 A;  4NN2 A;  1Z2Q A;  4B7Y C;  2KWN A;  3DQV R;  4X3G A;  1G25 A;  5B78 A;  3SOW A;  5AIT A;  2KR4 A;  4LLB A;  5G05 B;  1CHC A;  3T7L A;  1VD4 A;  4P5O B;  4LK9 A;  4WA6 A;  1N87 A;  4I7C A;  3U5O A;  1WES A;  2LDR A;  4B86 C;  2MD7 B;  2YYR A;  2CSZ A;  3GV4 A;  3PUR A;  1XWH A;  3O34 A;  1FBV A;  1HYI A;  1VFY A;  3RPG B;  4BHW A;  2XEU A;  3KQI A;  2VJE B;  4CA1 A;  2EA6 A;  1WIL A;  2FSA A;  2XB1 A;  3SOU A;  2KRE A;  5B75 A;  5TDW A;  4PPE A;  3N9P A;  4MVT A;  3ZPV E;  2NAA A;  2KE1 A;  2F6N A;  1U6G B;  2ECG A;  4WZ2 A;  2KWJ A;  4YBM A;  3ZTG A;  5AIU A;  1LDJ B;  3N9N A;  4A0C D;  3PUQ A;  2F42 A;  2M85 A;  4F52 B;  2MUM A;  2K16 A;  3N9L A;  2DX8 A;  2ZET C;  3HCS A;  1WEQ A;  3U5P A;  1WEP A;  5D1L B;  3LQJ A;  4L7X A;  3L1Z B;  2FUI A;  4R2Y A;  2ECI A;  1WEO A;  4I7D A;  2EOD A;  3KNV A;  3MHH A;  1X4I A;  2QIZ A;  2JMI A;  2KWK A;  2L80 A;  2L0B A;  3LRQ A;  3VK6 A;  4YAB A;  4YAD A;  4S3O C;  4FO9 A;  3QZV A;  2VJF B;  5H1V A;  5FER A;  3U5M A;  1JM7 B;  3FL2 A;  5EYA F;  4A49 A;  1X4J A;  4WZ0 A;  2YSJ A;  4IC2 A;  4AUQ B;  2VJE A;  3O7A A;  5KH7 A;  1IYM A;  3RTR B;  2L75 A;  2LGL A;  4UP0 A;  2MA6 A;  2QJ0 A;  2K4D A;  4ZQL A;  2K17 A;  3ZVZ B;  2MD8 C;  3PHD A;  2JMJ A;  5B76 A;  2Y1M A;  3M99 A;  3SHB A;  4AYC B;  5B8D A;  4ZDT A;  4UI9 B;  5I3L A;  2KFT A;  4LAD B;  4YBT A;  2ECV A;  2Y43 A;  4W4U A;  4AVX A;  4L58 A;  2KYU A;  4N4F A;  2LN0 A;  2VNF A;  1MM3 A;  5TAB A;  2AN6 A;  2BAY A;  2JMD A;  2G45 A;  4QF2 A;  1Z6U A;  3O36 A;  1F62 A;  3KV5 A;  3V43 A;  5J3X A;  3HCU A;  4V3K C;  5LKZ A;  2VPD A;  4O64 A;  2YT5 A;  2C2L A;  5B79 A;  3O33 A;  1WGM A;  4MSX A;  2K1J A;  2M1R A;  2OXQ C;  4UP5 A;  1WIM A;  1WEN A;  2F6J A;  2YW8 A;  3O70 A;  3LQH A;  2VJF A;  3SOX A;  4ZUX U;  3ZPV 1;  1JM7 A;  1T1H A;  2CT2 A;  3N9M A;  3M62 A;  2YQL A;  5DIN A;  4GNF A;  5D1K B;  5JG6 A;  2YSM A;  1Z60 A;  5G0F A;  4YAT A;  1WEU A;  3U5N A;  3L1X A;  2KWO A;  3ASL A;  4LKA A;  5DKA A;  1WEE A;  4FIP A;  3ZNI A;  5TBN A;  3HTK C;  2LGG A;  3N9O A;  4AYC A;  1BOR A;  3HCT A;  2L5U A;  1HYJ A;  4XI1 A; 
#chains in the Genus database with same CATH topology
 2Y1N A;  5H9M A;  2CKL B;  3EB6 A;  5SVX A;  3FEH A;  4YC9 A;  2RI7 A;  3PLW A;  2VPG A;  2QIC A;  4R7E A;  2LAU A;  5FEY A;  2H0D B;  2L43 A;  2YU4 A;  5FB0 A;  2KIZ A;  2YRE A;  1WEW A;  2YUC A;  4R8P K;  2ECN A;  4C9Z A;  2YHO A;  2PUY A;  2ECW A;  3JUE A;  1WE9 A;  3LQI A;  4FJC A;  3L11 A;  4GNG A;  4WZ3 B;  2EGP A;  1WFK A;  5KH9 A;  2JM3 A;  2LQ6 A;  3MHS A;  4A4B A;  2MT5 A;  5B77 A;  4V3L C;  2KGI A;  3KDE C;  3M7K A;  3M63 A;  5G04 B;  3ZVY A;  2PNX A;  4QF3 A;  5H1U A;  2G43 A;  5LKX A;  1VYX A;  2XP0 A;  3ZYQ A;  4GB0 A;  2LV9 A;  2FUU A;  2UZG A;  1RMD A;  2RR4 A;  3N9Q A;  4YAX A;  2C2V S;  3LDY A;  2RSD A;  2D8S A;  2I50 A;  5SVI A;  4N3W A;  2LXH C;  4IC3 A;  2YQM A;  2VPE A;  3EB5 A;  2LXP C;  5D1M B;  1E4U A;  3O35 A;  5LCW B;  3O47 A;  2MIQ A;  3RPG C;  4QQ4 A;  2XOZ A;  2MNZ A;  5FB1 A;  3C6W A;  1X4U A;  2HYE D;  2DSM A;  2CKL A;  2E6S A;  2CSY A;  3IHP A;  4AP4 A;  2YUR A;  3I2D A;  1FP0 A;  1LDK C;  1K2F A;  4YBS A;  2M3H A;  2H0D A;  2EGM A;  3SUB A;  4BBQ A;  1WEM A;  2MKE A;  3NG2 A;  4S3O B;  2CSV A;  5C13 A;  2OWA A;  4OGE A;  2LGK A;  3DPL R;  3FJU B;  3GL6 A;  4I7B A;  4LJN A;  4Q6F A;  3T9K A;  5TRB A;  4GND A;  4CCG X;  2MNY A;  2E6R A;  2VPB A;  2M6M A;  5KH3 A;  2KGG A;  5H1T A;  1WEV A;  2CRW A;  5K3Q A;  5LKT A;  4A4C A;  5C11 A;  2ECJ A;  3C5K A;  2VP7 A;  1ZBD B;  2IDA A;  3T6R A;  4GNE A;  1MM2 A;  2HDP A;  4TKP B;  2LRI C;  1JOC A;  5TDR A;  5LKU A;  2ECT A;  2YHN A;  2MA5 A;  3KV6 A;  2KU3 A;  2JRJ A;  4PTB A;  1V87 A;  3LVR E;  2LGV A;  3O37 A;  1DVP A;  2P57 A;  2G6Q A;  4FK5 A;  4NN2 A;  1Z2Q A;  4B7Y C;  2CON A;  2YVR A;  2KWN A;  2XOY A;  3DQV R;  2E61 A;  4X3G A;  1G25 A;  5B78 A;  3SOW A;  5AIT A;  2KR4 A;  4LLB A;  5G05 B;  1CHC A;  3T7L A;  1VD4 A;  4P5O B;  4LK9 A;  3FM8 C;  3H7H A;  1N87 A;  4WA6 A;  4I7C A;  3U5O A;  1WES A;  2LDR A;  4B86 C;  2MD7 B;  2YYR A;  4Z0R A;  2CSZ A;  3GV4 A;  3PUR A;  1XWH A;  3O34 A;  1FBV A;  1HYI A;  1VFY A;  3RPG B;  4BHW A;  2XEU A;  3KQI A;  2VJE B;  4CA1 A;  2EA6 A;  1WIL A;  2FSA A;  2XB1 A;  3SOU A;  2KRE A;  5B75 A;  5TDW A;  4PPE A;  3N9P A;  4MVT A;  3ZPV E;  2CRR A;  2NAA A;  2KE1 A;  2F6N A;  1DCQ A;  1U6G B;  2ECG A;  4WZ2 A;  2KWJ A;  2FFW A;  4YBM A;  3ZTG A;  3LVQ E;  5AIU A;  1LDJ B;  3Q1D A;  3N9N A;  4A0C D;  3FAO A;  2FD4 A;  3PUQ A;  2F42 A;  2M85 A;  4F52 B;  2MUM A;  2K16 A;  3N9L A;  2DX8 A;  2EXU A;  2ZET C;  3HCS A;  1WEQ A;  3U5P A;  1WEP A;  5D1L B;  3LQJ A;  4L7X A;  3L1Z B;  2FUI A;  4R2Y A;  2ECI A;  1WEO A;  4I7D A;  5SVI B;  2EOD A;  3KNV A;  3MHH A;  1X4I A;  2QIZ A;  2JMI A;  2KWK A;  2L80 A;  2L0B A;  3LRQ A;  3VK6 A;  4YAB A;  4YAD A;  4S3O C;  4FO9 A;  2D8U A;  2VJF B;  3MDB C;  3QZV A;  5H1V A;  2KKY A;  5FER A;  3U5M A;  1JM7 B;  3FL2 A;  5EYA F;  4A49 A;  1X4J A;  4WZ0 A;  2YSJ A;  4IC2 A;  4AUQ B;  2VJE A;  3O7A A;  5KH7 A;  1IYM A;  3RTR B;  2L75 A;  2LGL A;  4UP0 A;  3FAN A;  2MA6 A;  2QJ0 A;  2K4D A;  4ZQL A;  2K17 A;  3ZVZ B;  2MD8 C;  3PHD A;  2JMJ A;  5B76 A;  2Y1M A;  3M99 A;  2M13 A;  3SHB A;  4AYC B;  5B8D A;  4ZDT A;  4UI9 B;  5I3L A;  2KFT A;  4LAD B;  4YBT A;  2B0O E;  3DDT A;  2ECV A;  2Y43 A;  4W4U A;  4AVX A;  4L58 A;  2KYU A;  4N4F A;  2LN0 A;  2DJA A;  1MM3 A;  2VNF A;  5TAB A;  2AN6 A;  2BAY A;  2JMD A;  2JUN A;  2KKX A;  2G45 A;  4QF2 A;  5SVY A;  1Z6U A;  3O36 A;  1F62 A;  3KV5 A;  3V43 A;  5J3X A;  3HCU A;  4V3K C;  5LKZ A;  2VPD A;  2IQJ A;  4O64 A;  3E2D A;  2YT5 A;  2C2L A;  5B79 A;  3O33 A;  1WGM A;  4MSX A;  3LJU X;  2K1J A;  2M1R A;  2OXQ C;  1MBM A;  4UP5 A;  1WIM A;  1WEN A;  2F6J A;  2YW8 A;  3O70 A;  3LQH A;  2VJF A;  3SOX A;  4ZUX U;  4F1P A;  3ZPV 1;  2L7P A;  1JM7 A;  1T1H A;  2CT2 A;  3N9M A;  3M62 A;  2YQL A;  4O62 A;  2XOC A;  5DIN A;  4GNF A;  3DWD A;  4H9D A;  5D1K B;  5JG6 A;  2YSM A;  1Z60 A;  5G0F A;  4YAT A;  1WEU A;  3U5N A;  3L1X A;  2KWO A;  3ASL A;  4LKA A;  5DKA A;  4Z0O A;  1WEE A;  4FIP A;  4OGC A;  3ZNI A;  5TBN A;  3HTK C;  2LGG A;  3N9O A;  4AYC A;  1BOR A;  3HCT A;  2L5U A;  1HYJ A;  4XI1 A; 
#chains in the Genus database with same CATH homology
 2Y1N A;  5H9M A;  2CKL B;  3EB6 A;  4YC9 A;  2RI7 A;  2VPG A;  2QIC A;  4R7E A;  5FEY A;  2H0D B;  2L43 A;  2YU4 A;  5FB0 A;  2KIZ A;  2YRE A;  1WEW A;  2YUC A;  4R8P K;  2ECN A;  4C9Z A;  2YHO A;  2PUY A;  2ECW A;  1WE9 A;  3LQI A;  4FJC A;  3L11 A;  4GNG A;  4WZ3 B;  2EGP A;  1WFK A;  5KH9 A;  2LQ6 A;  3MHS A;  4A4B A;  2MT5 A;  5B77 A;  4V3L C;  2KGI A;  3M63 A;  5G04 B;  3ZVY A;  2PNX A;  4QF3 A;  5H1U A;  2G43 A;  5LKX A;  1VYX A;  3ZYQ A;  4GB0 A;  2LV9 A;  2FUU A;  2UZG A;  1RMD A;  3N9Q A;  4YAX A;  2C2V S;  2RSD A;  2D8S A;  2I50 A;  4N3W A;  2LXH C;  4IC3 A;  2YQM A;  2VPE A;  3EB5 A;  2LXP C;  5D1M B;  1E4U A;  3O35 A;  5LCW B;  2MIQ A;  3RPG C;  2MNZ A;  5FB1 A;  3C6W A;  1X4U A;  2HYE D;  2CKL A;  2E6S A;  2CSY A;  3IHP A;  4AP4 A;  2YUR A;  3I2D A;  1FP0 A;  1LDK C;  1K2F A;  4YBS A;  2M3H A;  2H0D A;  4BBQ A;  1WEM A;  3NG2 A;  4S3O B;  5C13 A;  2LGK A;  3DPL R;  3GL6 A;  4I7B A;  4LJN A;  4Q6F A;  5TRB A;  4GND A;  4CCG X;  2MNY A;  2E6R A;  2VPB A;  2M6M A;  5KH3 A;  2KGG A;  5H1T A;  1WEV A;  5LKT A;  4A4C A;  5C11 A;  2ECJ A;  3C5K A;  2VP7 A;  1ZBD B;  2IDA A;  3T6R A;  4GNE A;  1MM2 A;  2HDP A;  4TKP B;  2LRI C;  1JOC A;  5TDR A;  5LKU A;  2ECT A;  2YHN A;  2MA5 A;  3KV6 A;  2KU3 A;  2JRJ A;  4PTB A;  1V87 A;  2LGV A;  3O37 A;  1DVP A;  2G6Q A;  4FK5 A;  4NN2 A;  1Z2Q A;  4B7Y C;  2KWN A;  3DQV R;  4X3G A;  1G25 A;  5B78 A;  3SOW A;  5AIT A;  2KR4 A;  4LLB A;  5G05 B;  1CHC A;  3T7L A;  1VD4 A;  4P5O B;  4LK9 A;  4WA6 A;  1N87 A;  4I7C A;  3U5O A;  1WES A;  2LDR A;  4B86 C;  2MD7 B;  2YYR A;  2CSZ A;  3GV4 A;  3PUR A;  1XWH A;  3O34 A;  1FBV A;  1HYI A;  1VFY A;  3RPG B;  4BHW A;  2XEU A;  3KQI A;  2VJE B;  4CA1 A;  2EA6 A;  1WIL A;  2FSA A;  2XB1 A;  3SOU A;  2KRE A;  5B75 A;  5TDW A;  4PPE A;  3N9P A;  4MVT A;  3ZPV E;  2NAA A;  2KE1 A;  2F6N A;  1U6G B;  2ECG A;  4WZ2 A;  2KWJ A;  4YBM A;  3ZTG A;  5AIU A;  1LDJ B;  3N9N A;  4A0C D;  3PUQ A;  2F42 A;  2M85 A;  4F52 B;  2MUM A;  2K16 A;  3N9L A;  2DX8 A;  2ZET C;  3HCS A;  1WEQ A;  3U5P A;  1WEP A;  5D1L B;  3LQJ A;  4L7X A;  3L1Z B;  2FUI A;  4R2Y A;  2ECI A;  1WEO A;  4I7D A;  2EOD A;  3KNV A;  3MHH A;  1X4I A;  2QIZ A;  2JMI A;  2KWK A;  2L80 A;  2L0B A;  3LRQ A;  3VK6 A;  4YAB A;  4YAD A;  4S3O C;  4FO9 A;  3QZV A;  2VJF B;  5H1V A;  5FER A;  3U5M A;  1JM7 B;  3FL2 A;  5EYA F;  4A49 A;  1X4J A;  4WZ0 A;  2YSJ A;  4IC2 A;  4AUQ B;  2VJE A;  3O7A A;  5KH7 A;  1IYM A;  3RTR B;  2L75 A;  2LGL A;  4UP0 A;  2MA6 A;  2QJ0 A;  2K4D A;  4ZQL A;  2K17 A;  3ZVZ B;  2MD8 C;  3PHD A;  2JMJ A;  5B76 A;  2Y1M A;  3M99 A;  3SHB A;  4AYC B;  5B8D A;  4ZDT A;  4UI9 B;  5I3L A;  2KFT A;  4LAD B;  4YBT A;  2ECV A;  2Y43 A;  4W4U A;  4AVX A;  4L58 A;  2KYU A;  4N4F A;  2LN0 A;  2VNF A;  1MM3 A;  5TAB A;  2AN6 A;  2BAY A;  2JMD A;  2G45 A;  4QF2 A;  1Z6U A;  3O36 A;  1F62 A;  3KV5 A;  3V43 A;  5J3X A;  3HCU A;  4V3K C;  5LKZ A;  2VPD A;  4O64 A;  2YT5 A;  2C2L A;  5B79 A;  3O33 A;  1WGM A;  4MSX A;  2K1J A;  2M1R A;  2OXQ C;  4UP5 A;  1WIM A;  1WEN A;  2F6J A;  2YW8 A;  3O70 A;  3LQH A;  2VJF A;  3SOX A;  4ZUX U;  3ZPV 1;  1JM7 A;  1T1H A;  2CT2 A;  3N9M A;  3M62 A;  2YQL A;  5DIN A;  4GNF A;  5D1K B;  5JG6 A;  2YSM A;  1Z60 A;  5G0F A;  4YAT A;  1WEU A;  3U5N A;  3L1X A;  2KWO A;  3ASL A;  4LKA A;  5DKA A;  1WEE A;  4FIP A;  3ZNI A;  5TBN A;  3HTK C;  2LGG A;  3N9O A;  4AYC A;  1BOR A;  3HCT A;  2L5U A;  1HYJ A;  4XI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...