5KH3A

Crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl)propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone deacetylase 6
publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 30
structure length 101
sequence length 101
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh3A00
4A4BA 4A0CD 3O34A 1WESA 1Z60A 2KWOA 2XB1A 1JM7A 1XWHA 2KWJA 1VD4A 2LXPC 2FUIA 5D1LB 2K4DA 5H1TA 3T6RA 1E4UA 5DKAA 3U5PA 1N87A 4A4CA 4CCGX 2M6MA 4F52B 3RPGC 2MIQA 2LDRA 4FIPA 2YHNA 2H0DB 2ECTA 1WENA 5B75A 3O7AA 2L0BA 5DINA 1IYMA 1WFKA 1VFYA 4ZUXU 3NG2A 3U5MA 2MA6A 2D8SA 2KR4A 1WEQA 4CA1A 2JRJA 3SOUA 3L1XA 3KNVA 4XI1A 2E6SA 2BAYA 4YBSA 4L58A 5LKZA 3HCUA 1MM2A 2QIZA 2VPGA 3N9PA 1WEOA 2G43A 1FBVA 4PPEA 1HYIA 4GB0A 1WGMA 3GV4A 4FK5A 5TDWA 4O64A 1X4IA 4B86C 2KWNA 2VPDA 2PNXA 2EODA 1WEVA 1WEPA 3HCSA 2M3HA 3MHHA 4I7CA 2KE1A 4LLBA 1LDKC 1WEMA 3O33A 2YQMA 2L75A 3ZYQA 4GNEA 2YW8A 4MVTA 5C11A 5FB1A 4S3OC 2YSJA 4UI9B 2MT5A 4UP0A 2FSAA 3C6WA 4YABA 5LKTA 1DVPA 3EB5A 3U5OA 4I7DA 5TBNA 2M85A 3M99A 2YUCA 3PHDA 2L5UA 5TDRA 5B8DA 5D1KB 4MSXA 1WEWA 3ASLA 2FUUA 4C9ZA 2LXHC 5FEYA 5G05B 3O37A 2ECGA 2KGIA 3PURA 2MNZA 2YURA 2Y43A 3DQVR 1V87A 1WILA 4WZ2A 4V3LC 2RI7A 4Q6FA 3RPGB 2ECIA 3HCTA 1RMDA 2H0DA 2K16A 4YATA 5KH7A 2RSDA 4LK9A 1G25A 3IHPA 4WZ0A 5H9MA 3SHBA 3N9QA 2MD7B 5B78A 2HYED 3U5NA 3GL6A 2KYUA 4AP4A 2VPBA 2VJEB 4BHWA 5I3LA 2ECVA 2G45A 4GNGA 4N4FA 5FERA 3VK6A 3HTKC 3M62A 2YREA 2LRIC 2AN6A 5JG6A 2YU4A 2KU3A 2C2LA 4LKAA 3I2DA 2YT5A 1K2FA 3PUQA 4YBTA 2C2VS 2M1RA 3ZNIA 2UZGA 5B79A 4X3GA 4R7EA 3ZVYA 2I50A 3KV5A 3N9LA 3LRQA 2MD8C 3O36A 5G0FA 5AITA 2KWKA 3V43A 2EA6A 5TABA 1WIMA 1F62A 5D1MB 5B76A 3LQIA 3ZPVE 1MM3A 4S3OB 2F6JA 2F6NA 2LGGA 3L11A 4WA6A 5KH3A 3FL2A 2KREA 2JMDA 4AYCB 4BBQA 1VYXA 4YADA 4YC9A 4IC2A 3ZTGA 3KV6A 3O35A 2ECJA 1LDJB 1CHCA 2JMJA 2YYRA 5AIUA 4ZDTA 2NAAA 1HYJA 2CSYA 4YAXA 3N9NA 2VJFB 5B77A 4IC3A 2LGLA 1U6GB 2CKLB 2K1JA 4NN2A 3C5KA 2DX8A 2ECWA 2JMIA 3SOXA 3ZPV1 4LADB 1WEUA 2OXQC 4N3WA 4GNFA 4GNDA 1JM7B 3RTRB 4B7YC 2LGVA 2IDAA 3N9MA 1WE9A 4ZQLA 4V3KC 4QF2A 5LKXA 3EB6A 3O70A 2Y1NA 4PTBA 5H1VA 3ZVZB 2ZETC 4I7BA 2YHOA 2VJEA 2L80A 4A49A 4R2YA 2KIZA 2KFTA 5G04B 5LCWB 4R8PK 3N9OA 2KGGA 1X4JA 2LV9A 3MHSA 3LQJA 5FB0A 2MA5A 2E6RA 2K17A 2G6QA 2VNFA 1FP0A 2PUYA 4AVXA 2LGKA 1JOCA 4P5OB 4TKPB 2Y1MA 1WEEA 5J3XA 2ECNA 1Z2QA 2VP7A 2VPEA 2CT2A 1T1HA 3DPLR 2EGPA 4FJCA 2L43A 2YQLA 2QJ0A 3T7LA 5C13A 4W4UA 4QF3A 4LJNA 4YBMA 2LQ6A 1X4UA 3QZVA 2CSZA 4AUQB 3M63A 1BORA 2MUMA 4AYCA 5TRBA 5EYAF 2LN0A 5KH9A 2F42A 3LQHA 2HDPA 1Z6UA 5H1UA 2MNYA 3SOWA 2YSMA 4FO9A 4WZ3B 2XEUA 4L7XA 1ZBDB 2VJFA 5LKUA 4UP5A 3L1ZB 2CKLA 3KQIA 2QICA
chains in the Genus database with same CATH superfamily
1MBMA 4A4BA 4A0CD 3O34A 1WESA 1Z60A 2KWOA 2XB1A 1JM7A 1XWHA 2KWJA 1VD4A 2EGMA 2LXPC 2FUIA 5D1LB 2K4DA 5H1TA 3T6RA 1E4UA 5DKAA 3U5PA 1N87A 4A4CA 4CCGX 2M6MA 3FANA 4F52B 3RPGC 2MIQA 2LDRA 4FIPA 2YHNA 2H0DB 2ECTA 2CONA 1WENA 5B75A 3O7AA 2L0BA 2KKXA 5DINA 1IYMA 1WFKA 1VFYA 4ZUXU 3NG2A 3U5MA 2MA6A 2D8SA 2KR4A 1WEQA 4CA1A 2JRJA 3SOUA 3L1XA 3KNVA 4XI1A 2KKYA 2E6SA 2BAYA 2FD4A 2IQJA 4YBSA 4L58A 5LKZA 3HCUA 1MM2A 2QIZA 2VPGA 2LAUA 3FAOA 3N9PA 1WEOA 2G43A 3SUBA 1FBVA 4Z0RA 4PPEA 5SVIB 1HYIA 5SVIA 2D8UA 4GB0A 1WGMA 3GV4A 4FK5A 3E2DA 5TDWA 4O64A 1X4IA 4B86C 2YVRA 2KWNA 2VPDA 3H7HA 4F1PA 2PNXA 2EODA 1WEVA 1WEPA 3HCSA 2M3HA 3MHHA 4I7CA 2KE1A 4LLBA 1LDKC 1WEMA 3O33A 5K3QA 2YQMA 2L75A 3ZYQA 4GNEA 2YW8A 4MVTA 5C11A 5FB1A 4S3OC 2YSJA 4UI9B 2MT5A 4UP0A 2FSAA 3C6WA 4YABA 5LKTA 1DVPA 3EB5A 3U5OA 4I7DA 5TBNA 2M85A 3M99A 2YUCA 3PHDA 2L5UA 5TDRA 5B8DA 5D1KB 4MSXA 1WEWA 3ASLA 2FUUA 4C9ZA 2LXHC 5FEYA 2E61A 5G05B 3O37A 2ECGA 2KGIA 3PURA 2MNZA 2YURA 2Y43A 3DQVR 1V87A 1WILA 4WZ2A 4V3LC 2RI7A 4Q6FA 3RPGB 2ECIA 3HCTA 1RMDA 2H0DA 2K16A 4YATA 5KH7A 2RSDA 4LK9A 1G25A 3IHPA 4WZ0A 5H9MA 3SHBA 3N9QA 2MD7B 5B78A 2HYED 3U5NA 3GL6A 2KYUA 4Z0OA 4AP4A 2VPBA 2VJEB 2DJAA 4BHWA 5I3LA 2ECVA 2CRWA 2G45A 2L7PA 4GNGA 4N4FA 5FERA 3VK6A 2JUNA 3HTKC 3M62A 2MKEA 2YREA 2LRIC 2AN6A 5JG6A 2YU4A 2KU3A 2C2LA 4LKAA 3I2DA 2XOCA 2YT5A 2OWAA 1K2FA 3PUQA 4YBTA 2C2VS 2M1RA 3ZNIA 2UZGA 5B79A 3LVRE 3LJUX 4H9DA 4X3GA 4R7EA 3ZVYA 2I50A 3KV5A 3N9LA 3LRQA 2MD8C 2EXUA 3KDEC 3O36A 5G0FA 5AITA 3DWDA 2KWKA 3V43A 2EA6A 2FFWA 2JM3A 5TABA 1WIMA 1F62A 5D1MB 5B76A 3LQIA 3ZPVE 1MM3A 4S3OB 2F6JA 2F6NA 2LGGA 3L11A 4WA6A 5KH3A 3FL2A 2KREA 2JMDA 4AYCB 5SVYA 3Q1DA 4BBQA 3DDTA 1VYXA 3LVQE 4YADA 4YC9A 4IC2A 3ZTGA 3KV6A 3O35A 2ECJA 3M7KA 1LDJB 1CHCA 2JMJA 2YYRA 5AIUA 2RR4A 2NAAA 4ZDTA 2CSYA 1HYJA 4YAXA 3N9NA 2VJFB 5B77A 4IC3A 2LGLA 1U6GB 2CKLB 2K1JA 4NN2A 3C5KA 2DX8A 2ECWA 2JMIA 3O47A 3SOXA 3ZPV1 4LADB 1WEUA 2OXQC 4N3WA 4GNFA 4GNDA 1JM7B 3RTRB 4B7YC 2LGVA 1DCQA 2IDAA 3N9MA 1WE9A 3LDYA 3FM8C 4ZQLA 4V3KC 4QF2A 5LKXA 3EB6A 3O70A 2Y1NA 4PTBA 5H1VA 3ZVZB 2ZETC 4I7BA 2YHOA 2VJEA 2L80A 4A49A 2M13A 4R2YA 2KIZA 2KFTA 5G04B 5LCWB 4R8PK 3N9OA 2KGGA 1X4JA 2LV9A 3MHSA 3LQJA 5FB0A 2MA5A 2E6RA 2K17A 2G6QA 3FJUB 2CRRA 2VNFA 4O62A 4OGEA 2XOZA 4OGCA 1FP0A 2PUYA 2DSMA 4AVXA 2LGKA 1JOCA 2XOYA 4P5OB 4TKPB 2Y1MA 1WEEA 5J3XA 2ECNA 1Z2QA 2VP7A 2VPEA 2CT2A 3JUEA 3MDBC 1T1HA 3DPLR 2EGPA 4FJCA 2L43A 2YQLA 2QJ0A 3T7LA 5C13A 4W4UA 4QF3A 4LJNA 4YBMA 2LQ6A 1X4UA 3QZVA 2CSZA 5SVXA 4AUQB 3M63A 1BORA 2MUMA 4AYCA 5TRBA 5EYAF 2LN0A 5KH9A 2F42A 2CSVA 3LQHA 2HDPA 1Z6UA 5H1UA 2MNYA 3SOWA 2YSMA 4FO9A 4WZ3B 2B0OE 2XEUA 4L7XA 2P57A 1ZBDB 2VJFA 3PLWA 5LKUA 2XP0A 4UP5A 3L1ZB 2CKLA 3FEHA 3KQIA 4QQ4A 2QICA 3T9KA
chains in the Genus database with same CATH topology
4A4BA 4A0CD 3O34A 1WESA 1Z60A 2KWOA 2XB1A 1JM7A 1XWHA 2KWJA 1VD4A 2LXPC 2FUIA 5D1LB 2K4DA 5H1TA 3T6RA 1E4UA 5DKAA 3U5PA 1N87A 4A4CA 4CCGX 2M6MA 4F52B 3RPGC 2MIQA 2LDRA 4FIPA 2YHNA 2H0DB 2ECTA 1WENA 5B75A 3O7AA 2L0BA 5DINA 1IYMA 1WFKA 1VFYA 4ZUXU 3NG2A 3U5MA 2MA6A 2D8SA 2KR4A 1WEQA 4CA1A 2JRJA 3SOUA 3L1XA 3KNVA 4XI1A 2E6SA 2BAYA 4YBSA 4L58A 5LKZA 3HCUA 1MM2A 2QIZA 2VPGA 3N9PA 1WEOA 2G43A 1FBVA 4PPEA 1HYIA 4GB0A 1WGMA 3GV4A 4FK5A 5TDWA 4O64A 1X4IA 4B86C 2KWNA 2VPDA 2PNXA 2EODA 1WEVA 1WEPA 3HCSA 2M3HA 3MHHA 4I7CA 2KE1A 4LLBA 1LDKC 1WEMA 3O33A 2YQMA 2L75A 3ZYQA 4GNEA 2YW8A 4MVTA 5C11A 5FB1A 4S3OC 2YSJA 4UI9B 2MT5A 4UP0A 2FSAA 3C6WA 4YABA 5LKTA 1DVPA 3EB5A 3U5OA 4I7DA 5TBNA 2M85A 3M99A 2YUCA 3PHDA 2L5UA 5TDRA 5B8DA 5D1KB 4MSXA 1WEWA 3ASLA 2FUUA 4C9ZA 2LXHC 5FEYA 5G05B 3O37A 2ECGA 2KGIA 3PURA 2MNZA 2YURA 2Y43A 3DQVR 1V87A 1WILA 4WZ2A 4V3LC 2RI7A 4Q6FA 3RPGB 2ECIA 3HCTA 1RMDA 2H0DA 2K16A 4YATA 5KH7A 2RSDA 4LK9A 1G25A 3IHPA 4WZ0A 5H9MA 3SHBA 3N9QA 2MD7B 5B78A 2HYED 3U5NA 3GL6A 2KYUA 4AP4A 2VPBA 2VJEB 4BHWA 5I3LA 2ECVA 2G45A 4GNGA 4N4FA 5FERA 3VK6A 3HTKC 3M62A 2YREA 2LRIC 2AN6A 5JG6A 2YU4A 2KU3A 2C2LA 4LKAA 3I2DA 2YT5A 1K2FA 3PUQA 4YBTA 2C2VS 2M1RA 3ZNIA 2UZGA 5B79A 4X3GA 4R7EA 3ZVYA 2I50A 3KV5A 3N9LA 3LRQA 2MD8C 3O36A 5G0FA 5AITA 2KWKA 3V43A 2EA6A 5TABA 1WIMA 1F62A 5D1MB 5B76A 3LQIA 3ZPVE 1MM3A 4S3OB 2F6JA 2F6NA 2LGGA 3L11A 4WA6A 5KH3A 3FL2A 2KREA 2JMDA 4AYCB 4BBQA 1VYXA 4YADA 4YC9A 4IC2A 3ZTGA 3KV6A 3O35A 2ECJA 1LDJB 1CHCA 2JMJA 2YYRA 5AIUA 4ZDTA 2NAAA 1HYJA 2CSYA 4YAXA 3N9NA 2VJFB 5B77A 4IC3A 2LGLA 1U6GB 2CKLB 2K1JA 4NN2A 3C5KA 2DX8A 2ECWA 2JMIA 3SOXA 3ZPV1 4LADB 1WEUA 2OXQC 4N3WA 4GNFA 4GNDA 1JM7B 3RTRB 4B7YC 2LGVA 2IDAA 3N9MA 1WE9A 4ZQLA 4V3KC 4QF2A 5LKXA 3EB6A 3O70A 2Y1NA 4PTBA 5H1VA 3ZVZB 2ZETC 4I7BA 2YHOA 2VJEA 2L80A 4A49A 4R2YA 2KIZA 2KFTA 5G04B 5LCWB 4R8PK 3N9OA 2KGGA 1X4JA 2LV9A 3MHSA 3LQJA 5FB0A 2MA5A 2E6RA 2K17A 2G6QA 2VNFA 1FP0A 2PUYA 4AVXA 2LGKA 1JOCA 4P5OB 4TKPB 2Y1MA 1WEEA 5J3XA 2ECNA 1Z2QA 2VP7A 2VPEA 2CT2A 1T1HA 3DPLR 2EGPA 4FJCA 2L43A 2YQLA 2QJ0A 3T7LA 5C13A 4W4UA 4QF3A 4LJNA 4YBMA 2LQ6A 1X4UA 3QZVA 2CSZA 4AUQB 3M63A 1BORA 2MUMA 4AYCA 5TRBA 5EYAF 2LN0A 5KH9A 2F42A 3LQHA 2HDPA 1Z6UA 5H1UA 2MNYA 3SOWA 2YSMA 4FO9A 4WZ3B 2XEUA 4L7XA 1ZBDB 2VJFA 5LKUA 4UP5A 3L1ZB 2CKLA 3KQIA 2QICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4B A;  4A0C D;  3O34 A;  1WES A;  1Z60 A;  2KWO A;  2XB1 A;  1JM7 A;  1XWH A;  2KWJ A;  1VD4 A;  2LXP C;  2FUI A;  5D1L B;  2K4D A;  5H1T A;  3T6R A;  1E4U A;  5DKA A;  3U5P A;  1N87 A;  4A4C A;  4CCG X;  2M6M A;  4F52 B;  3RPG C;  2MIQ A;  2LDR A;  4FIP A;  2YHN A;  2H0D B;  2ECT A;  1WEN A;  5B75 A;  3O7A A;  2L0B A;  5DIN A;  1IYM A;  1WFK A;  1VFY A;  4ZUX U;  3NG2 A;  3U5M A;  2MA6 A;  2D8S A;  2KR4 A;  1WEQ A;  4CA1 A;  2JRJ A;  3SOU A;  3L1X A;  3KNV A;  4XI1 A;  2E6S A;  2BAY A;  4YBS A;  4L58 A;  5LKZ A;  3HCU A;  1MM2 A;  2QIZ A;  2VPG A;  3N9P A;  1WEO A;  2G43 A;  1FBV A;  4PPE A;  1HYI A;  4GB0 A;  1WGM A;  3GV4 A;  4FK5 A;  5TDW A;  4O64 A;  1X4I A;  4B86 C;  2KWN A;  2VPD A;  2PNX A;  2EOD A;  1WEV A;  1WEP A;  3HCS A;  2M3H A;  3MHH A;  4I7C A;  2KE1 A;  4LLB A;  1LDK C;  1WEM A;  3O33 A;  2YQM A;  2L75 A;  3ZYQ A;  4GNE A;  2YW8 A;  4MVT A;  5C11 A;  5FB1 A;  4S3O C;  2YSJ A;  4UI9 B;  2MT5 A;  4UP0 A;  2FSA A;  3C6W A;  4YAB A;  5LKT A;  1DVP A;  3EB5 A;  3U5O A;  4I7D A;  5TBN A;  2M85 A;  3M99 A;  2YUC A;  3PHD A;  2L5U A;  5TDR A;  5B8D A;  5D1K B;  4MSX A;  1WEW A;  3ASL A;  2FUU A;  4C9Z A;  2LXH C;  5FEY A;  5G05 B;  3O37 A;  2ECG A;  2KGI A;  3PUR A;  2MNZ A;  2YUR A;  2Y43 A;  3DQV R;  1V87 A;  1WIL A;  4WZ2 A;  4V3L C;  2RI7 A;  4Q6F A;  3RPG B;  2ECI A;  3HCT A;  1RMD A;  2H0D A;  2K16 A;  4YAT A;  5KH7 A;  2RSD A;  4LK9 A;  1G25 A;  3IHP A;  4WZ0 A;  5H9M A;  3SHB A;  3N9Q A;  2MD7 B;  5B78 A;  2HYE D;  3U5N A;  3GL6 A;  2KYU A;  4AP4 A;  2VPB A;  2VJE B;  4BHW A;  5I3L A;  2ECV A;  2G45 A;  4GNG A;  4N4F A;  5FER A;  3VK6 A;  3HTK C;  3M62 A;  2YRE A;  2LRI C;  2AN6 A;  5JG6 A;  2YU4 A;  2KU3 A;  2C2L A;  4LKA A;  3I2D A;  2YT5 A;  1K2F A;  3PUQ A;  4YBT A;  2C2V S;  2M1R A;  3ZNI A;  2UZG A;  5B79 A;  4X3G A;  4R7E A;  3ZVY A;  2I50 A;  3KV5 A;  3N9L A;  3LRQ A;  2MD8 C;  3O36 A;  5G0F A;  5AIT A;  2KWK A;  3V43 A;  2EA6 A;  5TAB A;  1WIM A;  1F62 A;  5D1M B;  5B76 A;  3LQI A;  3ZPV E;  1MM3 A;  4S3O B;  2F6J A;  2F6N A;  2LGG A;  3L11 A;  4WA6 A;  5KH3 A;  3FL2 A;  2KRE A;  2JMD A;  4AYC B;  4BBQ A;  1VYX A;  4YAD A;  4YC9 A;  4IC2 A;  3ZTG A;  3KV6 A;  3O35 A;  2ECJ A;  1LDJ B;  1CHC A;  2JMJ A;  2YYR A;  5AIU A;  4ZDT A;  2NAA A;  1HYJ A;  2CSY A;  4YAX A;  3N9N A;  2VJF B;  5B77 A;  4IC3 A;  2LGL A;  1U6G B;  2CKL B;  2K1J A;  4NN2 A;  3C5K A;  2DX8 A;  2ECW A;  2JMI A;  3SOX A;  3ZPV 1;  4LAD B;  1WEU A;  2OXQ C;  4N3W A;  4GNF A;  4GND A;  1JM7 B;  3RTR B;  4B7Y C;  2LGV A;  2IDA A;  3N9M A;  1WE9 A;  4ZQL A;  4V3K C;  4QF2 A;  5LKX A;  3EB6 A;  3O70 A;  2Y1N A;  4PTB A;  5H1V A;  3ZVZ B;  2ZET C;  4I7B A;  2YHO A;  2VJE A;  2L80 A;  4A49 A;  4R2Y A;  2KIZ A;  2KFT A;  5G04 B;  5LCW B;  4R8P K;  3N9O A;  2KGG A;  1X4J A;  2LV9 A;  3MHS A;  3LQJ A;  5FB0 A;  2MA5 A;  2E6R A;  2K17 A;  2G6Q A;  2VNF A;  1FP0 A;  2PUY A;  4AVX A;  2LGK A;  1JOC A;  4P5O B;  4TKP B;  2Y1M A;  1WEE A;  5J3X A;  2ECN A;  1Z2Q A;  2VP7 A;  2VPE A;  2CT2 A;  1T1H A;  3DPL R;  2EGP A;  4FJC A;  2L43 A;  2YQL A;  2QJ0 A;  3T7L A;  5C13 A;  4W4U A;  4QF3 A;  4LJN A;  4YBM A;  2LQ6 A;  1X4U A;  3QZV A;  2CSZ A;  4AUQ B;  3M63 A;  1BOR A;  2MUM A;  4AYC A;  5TRB A;  5EYA F;  2LN0 A;  5KH9 A;  2F42 A;  3LQH A;  2HDP A;  1Z6U A;  5H1U A;  2MNY A;  3SOW A;  2YSM A;  4FO9 A;  4WZ3 B;  2XEU A;  4L7X A;  1ZBD B;  2VJF A;  5LKU A;  4UP5 A;  3L1Z B;  2CKL A;  3KQI A;  2QIC A; 
#chains in the Genus database with same CATH topology
 1MBM A;  4A4B A;  4A0C D;  3O34 A;  1WES A;  1Z60 A;  2KWO A;  2XB1 A;  1JM7 A;  1XWH A;  2KWJ A;  1VD4 A;  2EGM A;  2LXP C;  2FUI A;  5D1L B;  2K4D A;  5H1T A;  3T6R A;  1E4U A;  5DKA A;  3U5P A;  1N87 A;  4A4C A;  4CCG X;  2M6M A;  3FAN A;  4F52 B;  3RPG C;  2MIQ A;  2LDR A;  4FIP A;  2YHN A;  2H0D B;  2ECT A;  2CON A;  1WEN A;  5B75 A;  3O7A A;  2L0B A;  2KKX A;  5DIN A;  1IYM A;  1WFK A;  1VFY A;  4ZUX U;  3NG2 A;  3U5M A;  2MA6 A;  2D8S A;  2KR4 A;  1WEQ A;  4CA1 A;  2JRJ A;  3SOU A;  3L1X A;  3KNV A;  4XI1 A;  2KKY A;  2E6S A;  2BAY A;  2FD4 A;  2IQJ A;  4YBS A;  4L58 A;  5LKZ A;  3HCU A;  1MM2 A;  2QIZ A;  2VPG A;  2LAU A;  3FAO A;  3N9P A;  1WEO A;  2G43 A;  3SUB A;  1FBV A;  4Z0R A;  4PPE A;  5SVI B;  1HYI A;  5SVI A;  2D8U A;  4GB0 A;  1WGM A;  3GV4 A;  4FK5 A;  3E2D A;  5TDW A;  4O64 A;  1X4I A;  4B86 C;  2YVR A;  2KWN A;  2VPD A;  3H7H A;  4F1P A;  2PNX A;  2EOD A;  1WEV A;  1WEP A;  3HCS A;  2M3H A;  3MHH A;  4I7C A;  2KE1 A;  4LLB A;  1LDK C;  1WEM A;  3O33 A;  5K3Q A;  2YQM A;  2L75 A;  3ZYQ A;  4GNE A;  2YW8 A;  4MVT A;  5C11 A;  5FB1 A;  4S3O C;  2YSJ A;  4UI9 B;  2MT5 A;  4UP0 A;  2FSA A;  3C6W A;  4YAB A;  5LKT A;  1DVP A;  3EB5 A;  3U5O A;  4I7D A;  5TBN A;  2M85 A;  3M99 A;  2YUC A;  3PHD A;  2L5U A;  5TDR A;  5B8D A;  5D1K B;  4MSX A;  1WEW A;  3ASL A;  2FUU A;  4C9Z A;  2LXH C;  5FEY A;  2E61 A;  5G05 B;  3O37 A;  2ECG A;  2KGI A;  3PUR A;  2MNZ A;  2YUR A;  2Y43 A;  3DQV R;  1V87 A;  1WIL A;  4WZ2 A;  4V3L C;  2RI7 A;  4Q6F A;  3RPG B;  2ECI A;  3HCT A;  1RMD A;  2H0D A;  2K16 A;  4YAT A;  5KH7 A;  2RSD A;  4LK9 A;  1G25 A;  3IHP A;  4WZ0 A;  5H9M A;  3SHB A;  3N9Q A;  2MD7 B;  5B78 A;  2HYE D;  3U5N A;  3GL6 A;  2KYU A;  4Z0O A;  4AP4 A;  2VPB A;  2VJE B;  2DJA A;  4BHW A;  5I3L A;  2ECV A;  2CRW A;  2G45 A;  2L7P A;  4GNG A;  4N4F A;  5FER A;  3VK6 A;  2JUN A;  3HTK C;  3M62 A;  2MKE A;  2YRE A;  2LRI C;  2AN6 A;  5JG6 A;  2YU4 A;  2KU3 A;  2C2L A;  4LKA A;  3I2D A;  2XOC A;  2YT5 A;  2OWA A;  1K2F A;  3PUQ A;  4YBT A;  2C2V S;  2M1R A;  3ZNI A;  2UZG A;  5B79 A;  3LVR E;  3LJU X;  4H9D A;  4X3G A;  4R7E A;  3ZVY A;  2I50 A;  3KV5 A;  3N9L A;  3LRQ A;  2MD8 C;  2EXU A;  3KDE C;  3O36 A;  5G0F A;  5AIT A;  3DWD A;  2KWK A;  3V43 A;  2EA6 A;  2FFW A;  2JM3 A;  5TAB A;  1WIM A;  1F62 A;  5D1M B;  5B76 A;  3LQI A;  3ZPV E;  1MM3 A;  4S3O B;  2F6J A;  2F6N A;  2LGG A;  3L11 A;  4WA6 A;  5KH3 A;  3FL2 A;  2KRE A;  2JMD A;  4AYC B;  5SVY A;  3Q1D A;  4BBQ A;  3DDT A;  1VYX A;  3LVQ E;  4YAD A;  4YC9 A;  4IC2 A;  3ZTG A;  3KV6 A;  3O35 A;  2ECJ A;  3M7K A;  1LDJ B;  1CHC A;  2JMJ A;  2YYR A;  5AIU A;  2RR4 A;  2NAA A;  4ZDT A;  2CSY A;  1HYJ A;  4YAX A;  3N9N A;  2VJF B;  5B77 A;  4IC3 A;  2LGL A;  1U6G B;  2CKL B;  2K1J A;  4NN2 A;  3C5K A;  2DX8 A;  2ECW A;  2JMI A;  3O47 A;  3SOX A;  3ZPV 1;  4LAD B;  1WEU A;  2OXQ C;  4N3W A;  4GNF A;  4GND A;  1JM7 B;  3RTR B;  4B7Y C;  2LGV A;  1DCQ A;  2IDA A;  3N9M A;  1WE9 A;  3LDY A;  3FM8 C;  4ZQL A;  4V3K C;  4QF2 A;  5LKX A;  3EB6 A;  3O70 A;  2Y1N A;  4PTB A;  5H1V A;  3ZVZ B;  2ZET C;  4I7B A;  2YHO A;  2VJE A;  2L80 A;  4A49 A;  2M13 A;  4R2Y A;  2KIZ A;  2KFT A;  5G04 B;  5LCW B;  4R8P K;  3N9O A;  2KGG A;  1X4J A;  2LV9 A;  3MHS A;  3LQJ A;  5FB0 A;  2MA5 A;  2E6R A;  2K17 A;  2G6Q A;  3FJU B;  2CRR A;  2VNF A;  4O62 A;  4OGE A;  2XOZ A;  4OGC A;  1FP0 A;  2PUY A;  2DSM A;  4AVX A;  2LGK A;  1JOC A;  2XOY A;  4P5O B;  4TKP B;  2Y1M A;  1WEE A;  5J3X A;  2ECN A;  1Z2Q A;  2VP7 A;  2VPE A;  2CT2 A;  3JUE A;  3MDB C;  1T1H A;  3DPL R;  2EGP A;  4FJC A;  2L43 A;  2YQL A;  2QJ0 A;  3T7L A;  5C13 A;  4W4U A;  4QF3 A;  4LJN A;  4YBM A;  2LQ6 A;  1X4U A;  3QZV A;  2CSZ A;  5SVX A;  4AUQ B;  3M63 A;  1BOR A;  2MUM A;  4AYC A;  5TRB A;  5EYA F;  2LN0 A;  5KH9 A;  2F42 A;  2CSV A;  3LQH A;  2HDP A;  1Z6U A;  5H1U A;  2MNY A;  3SOW A;  2YSM A;  4FO9 A;  4WZ3 B;  2B0O E;  2XEU A;  4L7X A;  2P57 A;  1ZBD B;  2VJF A;  3PLW A;  5LKU A;  2XP0 A;  4UP5 A;  3L1Z B;  2CKL A;  3FEH A;  3KQI A;  4QQ4 A;  2QIC A;  3T9K A; 
#chains in the Genus database with same CATH homology
 4A4B A;  4A0C D;  3O34 A;  1WES A;  1Z60 A;  2KWO A;  2XB1 A;  1JM7 A;  1XWH A;  2KWJ A;  1VD4 A;  2LXP C;  2FUI A;  5D1L B;  2K4D A;  5H1T A;  3T6R A;  1E4U A;  5DKA A;  3U5P A;  1N87 A;  4A4C A;  4CCG X;  2M6M A;  4F52 B;  3RPG C;  2MIQ A;  2LDR A;  4FIP A;  2YHN A;  2H0D B;  2ECT A;  1WEN A;  5B75 A;  3O7A A;  2L0B A;  5DIN A;  1IYM A;  1WFK A;  1VFY A;  4ZUX U;  3NG2 A;  3U5M A;  2MA6 A;  2D8S A;  2KR4 A;  1WEQ A;  4CA1 A;  2JRJ A;  3SOU A;  3L1X A;  3KNV A;  4XI1 A;  2E6S A;  2BAY A;  4YBS A;  4L58 A;  5LKZ A;  3HCU A;  1MM2 A;  2QIZ A;  2VPG A;  3N9P A;  1WEO A;  2G43 A;  1FBV A;  4PPE A;  1HYI A;  4GB0 A;  1WGM A;  3GV4 A;  4FK5 A;  5TDW A;  4O64 A;  1X4I A;  4B86 C;  2KWN A;  2VPD A;  2PNX A;  2EOD A;  1WEV A;  1WEP A;  3HCS A;  2M3H A;  3MHH A;  4I7C A;  2KE1 A;  4LLB A;  1LDK C;  1WEM A;  3O33 A;  2YQM A;  2L75 A;  3ZYQ A;  4GNE A;  2YW8 A;  4MVT A;  5C11 A;  5FB1 A;  4S3O C;  2YSJ A;  4UI9 B;  2MT5 A;  4UP0 A;  2FSA A;  3C6W A;  4YAB A;  5LKT A;  1DVP A;  3EB5 A;  3U5O A;  4I7D A;  5TBN A;  2M85 A;  3M99 A;  2YUC A;  3PHD A;  2L5U A;  5TDR A;  5B8D A;  5D1K B;  4MSX A;  1WEW A;  3ASL A;  2FUU A;  4C9Z A;  2LXH C;  5FEY A;  5G05 B;  3O37 A;  2ECG A;  2KGI A;  3PUR A;  2MNZ A;  2YUR A;  2Y43 A;  3DQV R;  1V87 A;  1WIL A;  4WZ2 A;  4V3L C;  2RI7 A;  4Q6F A;  3RPG B;  2ECI A;  3HCT A;  1RMD A;  2H0D A;  2K16 A;  4YAT A;  5KH7 A;  2RSD A;  4LK9 A;  1G25 A;  3IHP A;  4WZ0 A;  5H9M A;  3SHB A;  3N9Q A;  2MD7 B;  5B78 A;  2HYE D;  3U5N A;  3GL6 A;  2KYU A;  4AP4 A;  2VPB A;  2VJE B;  4BHW A;  5I3L A;  2ECV A;  2G45 A;  4GNG A;  4N4F A;  5FER A;  3VK6 A;  3HTK C;  3M62 A;  2YRE A;  2LRI C;  2AN6 A;  5JG6 A;  2YU4 A;  2KU3 A;  2C2L A;  4LKA A;  3I2D A;  2YT5 A;  1K2F A;  3PUQ A;  4YBT A;  2C2V S;  2M1R A;  3ZNI A;  2UZG A;  5B79 A;  4X3G A;  4R7E A;  3ZVY A;  2I50 A;  3KV5 A;  3N9L A;  3LRQ A;  2MD8 C;  3O36 A;  5G0F A;  5AIT A;  2KWK A;  3V43 A;  2EA6 A;  5TAB A;  1WIM A;  1F62 A;  5D1M B;  5B76 A;  3LQI A;  3ZPV E;  1MM3 A;  4S3O B;  2F6J A;  2F6N A;  2LGG A;  3L11 A;  4WA6 A;  5KH3 A;  3FL2 A;  2KRE A;  2JMD A;  4AYC B;  4BBQ A;  1VYX A;  4YAD A;  4YC9 A;  4IC2 A;  3ZTG A;  3KV6 A;  3O35 A;  2ECJ A;  1LDJ B;  1CHC A;  2JMJ A;  2YYR A;  5AIU A;  4ZDT A;  2NAA A;  1HYJ A;  2CSY A;  4YAX A;  3N9N A;  2VJF B;  5B77 A;  4IC3 A;  2LGL A;  1U6G B;  2CKL B;  2K1J A;  4NN2 A;  3C5K A;  2DX8 A;  2ECW A;  2JMI A;  3SOX A;  3ZPV 1;  4LAD B;  1WEU A;  2OXQ C;  4N3W A;  4GNF A;  4GND A;  1JM7 B;  3RTR B;  4B7Y C;  2LGV A;  2IDA A;  3N9M A;  1WE9 A;  4ZQL A;  4V3K C;  4QF2 A;  5LKX A;  3EB6 A;  3O70 A;  2Y1N A;  4PTB A;  5H1V A;  3ZVZ B;  2ZET C;  4I7B A;  2YHO A;  2VJE A;  2L80 A;  4A49 A;  4R2Y A;  2KIZ A;  2KFT A;  5G04 B;  5LCW B;  4R8P K;  3N9O A;  2KGG A;  1X4J A;  2LV9 A;  3MHS A;  3LQJ A;  5FB0 A;  2MA5 A;  2E6R A;  2K17 A;  2G6Q A;  2VNF A;  1FP0 A;  2PUY A;  4AVX A;  2LGK A;  1JOC A;  4P5O B;  4TKP B;  2Y1M A;  1WEE A;  5J3X A;  2ECN A;  1Z2Q A;  2VP7 A;  2VPE A;  2CT2 A;  1T1H A;  3DPL R;  2EGP A;  4FJC A;  2L43 A;  2YQL A;  2QJ0 A;  3T7L A;  5C13 A;  4W4U A;  4QF3 A;  4LJN A;  4YBM A;  2LQ6 A;  1X4U A;  3QZV A;  2CSZ A;  4AUQ B;  3M63 A;  1BOR A;  2MUM A;  4AYC A;  5TRB A;  5EYA F;  2LN0 A;  5KH9 A;  2F42 A;  3LQH A;  2HDP A;  1Z6U A;  5H1U A;  2MNY A;  3SOW A;  2YSM A;  4FO9 A;  4WZ3 B;  2XEU A;  4L7X A;  1ZBD B;  2VJF A;  5LKU A;  4UP5 A;  3L1Z B;  2CKL A;  3KQI A;  2QIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...