5KH3A

Crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl)propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Histone deacetylase 6
total genus 30
structure length 101
sequence length 101
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh3A00
2FSAA 4UP5A 3M99A 5J3XA 4AP4A 2ECNA 3LQIA 1WEQA 5B76A 4YBTA 2CKLB 2L43A 5G0FA 4BBQA 4N4FA 1WEVA 1WEMA 4FO9A 2LN0A 4N3WA 2ECVA 4YATA 2YURA 5KH9A 2YU4A 1WEOA 1Z6UA 3T6RA 5AIUA 1FP0A 2ECGA 1IYMA 1XWHA 3HCTA 2ZETC 1VD4A 2KREA 4PTBA 2LXPC 4UI9B 4CCGX 2M1RA 2YREA 2L75A 2H0DB 3N9OA 1G25A 2MUMA 2QIZA 4LADB 2JMJA 2KFTA 2XB1A 5B75A 2UZGA 4O64A 4A49A 1X4IA 1V87A 2I50A 2YHOA 4GNEA 2H0DA 1WE9A 4V3KC 5FB0A 1Z2QA 4GNDA 4UP0A 5FERA 5LCWB 5D1MB 2VPBA 4R8PK 2VPGA 4S3OC 2ECTA 3U5PA 3LQJA 2EODA 1WGMA 3GV4A 2LGVA 2K16A 2NAAA 3N9QA 1X4JA 2QICA 5B8DA 1ZBDB 4YAXA 3ASLA 3EB6A 4R2YA 1F62A 4MVTA 2MD7B 2QJ0A 3RTRB 2F6NA 4FIPA 3L1XA 1JM7A 5AITA 4PPEA 2OXQC 4QF2A 4L58A 1WEWA 5H1VA 1FBVA 4GNGA 5EYAF 2RI7A 2VJEB 3C6WA 4FJCA 2YQMA 2VP7A 5D1KB 3U5NA 2PNXA 2MA5A 5I3LA 2K17A 1WEUA 5B77A 2PUYA 2KGIA 4B7YC 3O34A 1HYIA 2VJEA 1K2FA 4YBSA 3PHDA 1MM3A 2KU3A 5B79A 3RPGC 1DVPA 5G05B 2C2LA 3FL2A 2KWNA 1VFYA 4LKAA 2M85A 4GB0A 3SHBA 2KR4A 5DINA 3M62A 1WESA 1WEPA 3N9PA 5JG6A 3SOWA 3ZTGA 1RMDA 1WILA 3O37A 2D8SA 2LRIC 5LKZA 3SOUA 4X3GA 3L1ZB 4WA6A 4S3OB 1WFKA 4GNFA 2YYRA 3LRQA 4ZQLA 1VYXA 1Z60A 1N87A 3O7AA 5FB1A 5LKTA 4LJNA 3MHHA 5DKAA 4WZ0A 3ZPVE 1CHCA 2HDPA 3KQIA 2VJFA 4W4UA 2KWOA 4WZ2A 2MIQA 2AN6A 1T1HA 3HTKC 3QZVA 2F6JA 5H1UA 1HYJA 2KIZA 1WEEA 1JM7B 1WIMA 4R7EA 3RPGB 2LGGA 2CT2A 4NN2A 3I2DA 4YABA 4WZ3B 4Q6FA 2C2VS 2YUCA 4IC3A 2MT5A 2Y1NA 2L80A 4I7CA 3ZVYA 2BAYA 5LKUA 5C13A 2E6SA 3ZYQA 2FUUA 1X4UA 2YHNA 2YT5A 2YW8A 2VPDA 4CA1A 4ZUXU 4AYCB 4YC9A 3KNVA 4AVXA 3MHSA 5TDWA 5KH3A 2CKLA 5TABA 5KH7A 2M6MA 2HYED 3T7LA 4A4BA 2LQ6A 5FEYA 2VPEA 4AYCA 3IHPA 3O33A 4YADA 3ZVZB 5LKXA 4I7BA 2KWKA 2ECIA 2Y1MA 2MNZA 2KGGA 4I7DA 4BHWA 2XEUA 2KWJA 4A0CD 2IDAA 2JRJA 5TBNA 4FK5A 3O35A 2CSZA 4ZDTA 2RSDA 3DPLR 3KV5A 3VK6A 1LDKC 3N9NA 4MSXA 3KV6A 4XI1A 2JMDA 2Y43A 3DQVR 2YQLA 3L11A 3NG2A 4C9ZA 2LGKA 2LGLA 2VJFB 2G45A 1WENA 2F42A 2K1JA 2EGPA 3GL6A 2FUIA 5G04B 2LXHC 5TDRA 2MA6A 3C5KA 2L0BA 5B78A 3ZPV1 2G43A 3N9LA 5H9MA 3O70A 4IC2A 3EB5A 3HCSA 2MD8C 2M3HA 3PUQA 4YBMA 4LK9A 3U5OA 1JOCA 4F52B 1MM2A 3PURA 4P5OB 5C11A 3ZNIA 1E4UA 4L7XA 3N9MA 3M63A 2ECJA 4AUQB 4A4CA 3LQHA 2YSJA 2KYUA 2LV9A 3SOXA 2KE1A 1LDJB 5TRBA 1U6GB 2LDRA 4LLBA 2ECWA 5D1LB 2DX8A 3O36A 4TKPB 2L5UA 3U5MA 2G6QA 2K4DA 5H1TA 3HCUA 2YSMA 1BORA 2EA6A 2VNFA 3V43A 4QF3A 2E6RA 2JMIA 2MNYA 4B86C 4V3LC 2CSYA
chains in the Genus database with same CATH superfamily
2FSAA 3T9KA 4UP5A 3M99A 5J3XA 2DJAA 4AP4A 2ECNA 3FAOA 3LQIA 1WEQA 5B76A 4YBTA 2XOZA 2CKLB 2L43A 5G0FA 4BBQA 4N4FA 1WEVA 1WEMA 4FO9A 2LN0A 4N3WA 2ECVA 4YATA 2YURA 5KH9A 2YU4A 1WEOA 1Z6UA 3T6RA 5AIUA 1FP0A 2ECGA 1IYMA 2B0OE 1XWHA 3HCTA 2ZETC 1VD4A 2KKYA 3KDEC 2KREA 4PTBA 2MKEA 2LXPC 4UI9B 4CCGX 4F1PA 2M1RA 2YREA 2L75A 2H0DB 3N9OA 1G25A 1MBMA 2MUMA 2QIZA 4LADB 2JMJA 2KFTA 2XB1A 5B75A 2UZGA 4Z0RA 4O64A 4A49A 3LDYA 1X4IA 1V87A 2I50A 2YHOA 4GNEA 2H0DA 1WE9A 4V3KC 5FB0A 1Z2QA 4GNDA 3FANA 4UP0A 5FERA 5LCWB 5D1MB 2VPBA 4R8PK 2VPGA 4S3OC 2CONA 3PLWA 3H7HA 2ECTA 3U5PA 3LQJA 2EODA 1WGMA 2L7PA 3GV4A 2LGVA 4OGCA 2P57A 3LVRE 2K16A 2NAAA 3N9QA 1X4JA 4QQ4A 2QICA 5B8DA 1ZBDB 4YAXA 2DSMA 3ASLA 3EB6A 4R2YA 2OWAA 1F62A 4MVTA 2MD7B 2QJ0A 3RTRB 2F6NA 4FIPA 3L1XA 1JM7A 5AITA 4PPEA 2OXQC 4QF2A 4L58A 1WEWA 5H1VA 1FBVA 4GNGA 5EYAF 2RI7A 2LAUA 2VJEB 3C6WA 4FJCA 2YQMA 3O47A 2VP7A 5D1KB 3U5NA 2PNXA 2MA5A 5I3LA 2K17A 1WEUA 5B77A 3JUEA 2PUYA 2EGMA 4OGEA 2KGIA 4B7YC 3O34A 2XOYA 1HYIA 1DCQA 2VJEA 1K2FA 4YBSA 3PHDA 1MM3A 2KU3A 5B79A 3RPGC 3Q1DA 1DVPA 5G05B 2C2LA 3FL2A 2D8UA 2KWNA 1VFYA 4LKAA 2M85A 4GB0A 3SHBA 2KR4A 5DINA 3M62A 1WESA 1WEPA 3N9PA 5JG6A 3SOWA 3ZTGA 1RMDA 1WILA 3O37A 2RR4A 2D8SA 2LRIC 5LKZA 3SOUA 4X3GA 3L1ZB 4WA6A 4S3OB 1WFKA 4GNFA 2YYRA 3LRQA 4ZQLA 2FFWA 1VYXA 1Z60A 1N87A 3O7AA 5FB1A 5LKTA 3SUBA 4LJNA 3MHHA 5DKAA 2CSVA 4WZ0A 3ZPVE 1CHCA 2HDPA 3KQIA 2VJFA 4W4UA 5SVYA 2KWOA 2M13A 2FD4A 4WZ2A 2MIQA 2AN6A 1T1HA 3HTKC 3QZVA 2F6JA 5H1UA 1HYJA 2KIZA 1WEEA 1JM7B 3LVQE 1WIMA 4R7EA 3RPGB 4O62A 2LGGA 2CT2A 4NN2A 3I2DA 4YABA 4WZ3B 4Q6FA 2C2VS 2YUCA 4IC3A 2MT5A 2Y1NA 2L80A 4I7CA 2YVRA 3ZVYA 2BAYA 3DDTA 5LKUA 5C13A 2E6SA 3ZYQA 2FUUA 1X4UA 2CRRA 2YHNA 2YT5A 2YW8A 2VPDA 4CA1A 4ZUXU 4AYCB 4YC9A 3KNVA 2XOCA 4AVXA 3MHSA 5TDWA 5KH3A 2CKLA 5TABA 5KH7A 2M6MA 2HYED 3T7LA 4A4BA 2LQ6A 5FEYA 2VPEA 4AYCA 3IHPA 3O33A 4YADA 3ZVZB 5LKXA 2EXUA 2KKXA 4I7BA 2KWKA 2ECIA 2Y1MA 2MNZA 2KGGA 4I7DA 4BHWA 2CRWA 2XEUA 2KWJA 4A0CD 2IDAA 2JRJA 5TBNA 4FK5A 3O35A 2CSZA 4ZDTA 2RSDA 2JM3A 3DPLR 3KV5A 3VK6A 1LDKC 3N9NA 4MSXA 5SVXA 3KV6A 4XI1A 2JMDA 2Y43A 3M7KA 4Z0OA 3DQVR 2YQLA 3L11A 3NG2A 4C9ZA 2LGKA 2LGLA 2VJFB 2G45A 1WENA 2F42A 2XP0A 2K1JA 2EGPA 3GL6A 2FUIA 5G04B 2LXHC 5TDRA 3MDBC 2MA6A 3C5KA 2IQJA 2L0BA 3FJUB 5B78A 3ZPV1 2G43A 3N9LA 5H9MA 3O70A 4IC2A 3EB5A 3HCSA 2MD8C 2M3HA 3PUQA 3LJUX 3FM8C 4YBMA 4LK9A 3U5OA 1JOCA 4F52B 1MM2A 3PURA 4P5OB 2JUNA 5C11A 5SVIB 3ZNIA 1E4UA 3E2DA 4L7XA 3DWDA 3N9MA 3M63A 2ECJA 4AUQB 4A4CA 3LQHA 2YSJA 2KYUA 2LV9A 3SOXA 4H9DA 2KE1A 1LDJB 5K3QA 5TRBA 1U6GB 2LDRA 5SVIA 4LLBA 2ECWA 5D1LB 2DX8A 3O36A 4TKPB 2L5UA 3U5MA 2G6QA 2K4DA 5H1TA 3HCUA 2YSMA 3FEHA 1BORA 2EA6A 2VNFA 3V43A 4QF3A 2E6RA 2JMIA 2MNYA 4B86C 4V3LC 2E61A 2CSYA
chains in the Genus database with same CATH topology
2FSAA 4UP5A 3M99A 5J3XA 4AP4A 2ECNA 3LQIA 1WEQA 5B76A 4YBTA 2CKLB 2L43A 5G0FA 4BBQA 4N4FA 1WEVA 1WEMA 4FO9A 2LN0A 4N3WA 2ECVA 4YATA 2YURA 5KH9A 2YU4A 1WEOA 1Z6UA 3T6RA 5AIUA 1FP0A 2ECGA 1IYMA 1XWHA 3HCTA 2ZETC 1VD4A 2KREA 4PTBA 2LXPC 4UI9B 4CCGX 2M1RA 2YREA 2L75A 2H0DB 3N9OA 1G25A 2MUMA 2QIZA 4LADB 2JMJA 2KFTA 2XB1A 5B75A 2UZGA 4O64A 4A49A 1X4IA 1V87A 2I50A 2YHOA 4GNEA 2H0DA 1WE9A 4V3KC 5FB0A 1Z2QA 4GNDA 4UP0A 5FERA 5LCWB 5D1MB 2VPBA 4R8PK 2VPGA 4S3OC 2ECTA 3U5PA 3LQJA 2EODA 1WGMA 3GV4A 2LGVA 2K16A 2NAAA 3N9QA 1X4JA 2QICA 5B8DA 1ZBDB 4YAXA 3ASLA 3EB6A 4R2YA 1F62A 4MVTA 2MD7B 2QJ0A 3RTRB 2F6NA 4FIPA 3L1XA 1JM7A 5AITA 4PPEA 2OXQC 4QF2A 4L58A 1WEWA 5H1VA 1FBVA 4GNGA 5EYAF 2RI7A 2VJEB 3C6WA 4FJCA 2YQMA 2VP7A 5D1KB 3U5NA 2PNXA 2MA5A 5I3LA 2K17A 1WEUA 5B77A 2PUYA 2KGIA 4B7YC 3O34A 1HYIA 2VJEA 1K2FA 4YBSA 3PHDA 1MM3A 2KU3A 5B79A 3RPGC 1DVPA 5G05B 2C2LA 3FL2A 2KWNA 1VFYA 4LKAA 2M85A 4GB0A 3SHBA 2KR4A 5DINA 3M62A 1WESA 1WEPA 3N9PA 5JG6A 3SOWA 3ZTGA 1RMDA 1WILA 3O37A 2D8SA 2LRIC 5LKZA 3SOUA 4X3GA 3L1ZB 4WA6A 4S3OB 1WFKA 4GNFA 2YYRA 3LRQA 4ZQLA 1VYXA 1Z60A 1N87A 3O7AA 5FB1A 5LKTA 4LJNA 3MHHA 5DKAA 4WZ0A 3ZPVE 1CHCA 2HDPA 3KQIA 2VJFA 4W4UA 2KWOA 4WZ2A 2MIQA 2AN6A 1T1HA 3HTKC 3QZVA 2F6JA 5H1UA 1HYJA 2KIZA 1WEEA 1JM7B 1WIMA 4R7EA 3RPGB 2LGGA 2CT2A 4NN2A 3I2DA 4YABA 4WZ3B 4Q6FA 2C2VS 2YUCA 4IC3A 2MT5A 2Y1NA 2L80A 4I7CA 3ZVYA 2BAYA 5LKUA 5C13A 2E6SA 3ZYQA 2FUUA 1X4UA 2YHNA 2YT5A 2YW8A 2VPDA 4CA1A 4ZUXU 4AYCB 4YC9A 3KNVA 4AVXA 3MHSA 5TDWA 5KH3A 2CKLA 5TABA 5KH7A 2M6MA 2HYED 3T7LA 4A4BA 2LQ6A 5FEYA 2VPEA 4AYCA 3IHPA 3O33A 4YADA 3ZVZB 5LKXA 4I7BA 2KWKA 2ECIA 2Y1MA 2MNZA 2KGGA 4I7DA 4BHWA 2XEUA 2KWJA 4A0CD 2IDAA 2JRJA 5TBNA 4FK5A 3O35A 2CSZA 4ZDTA 2RSDA 3DPLR 3KV5A 3VK6A 1LDKC 3N9NA 4MSXA 3KV6A 4XI1A 2JMDA 2Y43A 3DQVR 2YQLA 3L11A 3NG2A 4C9ZA 2LGKA 2LGLA 2VJFB 2G45A 1WENA 2F42A 2K1JA 2EGPA 3GL6A 2FUIA 5G04B 2LXHC 5TDRA 2MA6A 3C5KA 2L0BA 5B78A 3ZPV1 2G43A 3N9LA 5H9MA 3O70A 4IC2A 3EB5A 3HCSA 2MD8C 2M3HA 3PUQA 4YBMA 4LK9A 3U5OA 1JOCA 4F52B 1MM2A 3PURA 4P5OB 5C11A 3ZNIA 1E4UA 4L7XA 3N9MA 3M63A 2ECJA 4AUQB 4A4CA 3LQHA 2YSJA 2KYUA 2LV9A 3SOXA 2KE1A 1LDJB 5TRBA 1U6GB 2LDRA 4LLBA 2ECWA 5D1LB 2DX8A 3O36A 4TKPB 2L5UA 3U5MA 2G6QA 2K4DA 5H1TA 3HCUA 2YSMA 1BORA 2EA6A 2VNFA 3V43A 4QF3A 2E6RA 2JMIA 2MNYA 4B86C 4V3LC 2CSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FSA A;  4UP5 A;  3M99 A;  5J3X A;  4AP4 A;  2ECN A;  3LQI A;  1WEQ A;  5B76 A;  4YBT A;  2CKL B;  2L43 A;  5G0F A;  4BBQ A;  4N4F A;  1WEV A;  1WEM A;  4FO9 A;  2LN0 A;  4N3W A;  2ECV A;  4YAT A;  2YUR A;  5KH9 A;  2YU4 A;  1WEO A;  1Z6U A;  3T6R A;  5AIU A;  1FP0 A;  2ECG A;  1IYM A;  1XWH A;  3HCT A;  2ZET C;  1VD4 A;  2KRE A;  4PTB A;  2LXP C;  4UI9 B;  4CCG X;  2M1R A;  2YRE A;  2L75 A;  2H0D B;  3N9O A;  1G25 A;  2MUM A;  2QIZ A;  4LAD B;  2JMJ A;  2KFT A;  2XB1 A;  5B75 A;  2UZG A;  4O64 A;  4A49 A;  1X4I A;  1V87 A;  2I50 A;  2YHO A;  4GNE A;  2H0D A;  1WE9 A;  4V3K C;  5FB0 A;  1Z2Q A;  4GND A;  4UP0 A;  5FER A;  5LCW B;  5D1M B;  2VPB A;  4R8P K;  2VPG A;  4S3O C;  2ECT A;  3U5P A;  3LQJ A;  2EOD A;  1WGM A;  3GV4 A;  2LGV A;  2K16 A;  2NAA A;  3N9Q A;  1X4J A;  2QIC A;  5B8D A;  1ZBD B;  4YAX A;  3ASL A;  3EB6 A;  4R2Y A;  1F62 A;  4MVT A;  2MD7 B;  2QJ0 A;  3RTR B;  2F6N A;  4FIP A;  3L1X A;  1JM7 A;  5AIT A;  4PPE A;  2OXQ C;  4QF2 A;  4L58 A;  1WEW A;  5H1V A;  1FBV A;  4GNG A;  5EYA F;  2RI7 A;  2VJE B;  3C6W A;  4FJC A;  2YQM A;  2VP7 A;  5D1K B;  3U5N A;  2PNX A;  2MA5 A;  5I3L A;  2K17 A;  1WEU A;  5B77 A;  2PUY A;  2KGI A;  4B7Y C;  3O34 A;  1HYI A;  2VJE A;  1K2F A;  4YBS A;  3PHD A;  1MM3 A;  2KU3 A;  5B79 A;  3RPG C;  1DVP A;  5G05 B;  2C2L A;  3FL2 A;  2KWN A;  1VFY A;  4LKA A;  2M85 A;  4GB0 A;  3SHB A;  2KR4 A;  5DIN A;  3M62 A;  1WES A;  1WEP A;  3N9P A;  5JG6 A;  3SOW A;  3ZTG A;  1RMD A;  1WIL A;  3O37 A;  2D8S A;  2LRI C;  5LKZ A;  3SOU A;  4X3G A;  3L1Z B;  4WA6 A;  4S3O B;  1WFK A;  4GNF A;  2YYR A;  3LRQ A;  4ZQL A;  1VYX A;  1Z60 A;  1N87 A;  3O7A A;  5FB1 A;  5LKT A;  4LJN A;  3MHH A;  5DKA A;  4WZ0 A;  3ZPV E;  1CHC A;  2HDP A;  3KQI A;  2VJF A;  4W4U A;  2KWO A;  4WZ2 A;  2MIQ A;  2AN6 A;  1T1H A;  3HTK C;  3QZV A;  2F6J A;  5H1U A;  1HYJ A;  2KIZ A;  1WEE A;  1JM7 B;  1WIM A;  4R7E A;  3RPG B;  2LGG A;  2CT2 A;  4NN2 A;  3I2D A;  4YAB A;  4WZ3 B;  4Q6F A;  2C2V S;  2YUC A;  4IC3 A;  2MT5 A;  2Y1N A;  2L80 A;  4I7C A;  3ZVY A;  2BAY A;  5LKU A;  5C13 A;  2E6S A;  3ZYQ A;  2FUU A;  1X4U A;  2YHN A;  2YT5 A;  2YW8 A;  2VPD A;  4CA1 A;  4ZUX U;  4AYC B;  4YC9 A;  3KNV A;  4AVX A;  3MHS A;  5TDW A;  5KH3 A;  2CKL A;  5TAB A;  5KH7 A;  2M6M A;  2HYE D;  3T7L A;  4A4B A;  2LQ6 A;  5FEY A;  2VPE A;  4AYC A;  3IHP A;  3O33 A;  4YAD A;  3ZVZ B;  5LKX A;  4I7B A;  2KWK A;  2ECI A;  2Y1M A;  2MNZ A;  2KGG A;  4I7D A;  4BHW A;  2XEU A;  2KWJ A;  4A0C D;  2IDA A;  2JRJ A;  5TBN A;  4FK5 A;  3O35 A;  2CSZ A;  4ZDT A;  2RSD A;  3DPL R;  3KV5 A;  3VK6 A;  1LDK C;  3N9N A;  4MSX A;  3KV6 A;  4XI1 A;  2JMD A;  2Y43 A;  3DQV R;  2YQL A;  3L11 A;  3NG2 A;  4C9Z A;  2LGK A;  2LGL A;  2VJF B;  2G45 A;  1WEN A;  2F42 A;  2K1J A;  2EGP A;  3GL6 A;  2FUI A;  5G04 B;  2LXH C;  5TDR A;  2MA6 A;  3C5K A;  2L0B A;  5B78 A;  3ZPV 1;  2G43 A;  3N9L A;  5H9M A;  3O70 A;  4IC2 A;  3EB5 A;  3HCS A;  2MD8 C;  2M3H A;  3PUQ A;  4YBM A;  4LK9 A;  3U5O A;  1JOC A;  4F52 B;  1MM2 A;  3PUR A;  4P5O B;  5C11 A;  3ZNI A;  1E4U A;  4L7X A;  3N9M A;  3M63 A;  2ECJ A;  4AUQ B;  4A4C A;  3LQH A;  2YSJ A;  2KYU A;  2LV9 A;  3SOX A;  2KE1 A;  1LDJ B;  5TRB A;  1U6G B;  2LDR A;  4LLB A;  2ECW A;  5D1L B;  2DX8 A;  3O36 A;  4TKP B;  2L5U A;  3U5M A;  2G6Q A;  2K4D A;  5H1T A;  3HCU A;  2YSM A;  1BOR A;  2EA6 A;  2VNF A;  3V43 A;  4QF3 A;  2E6R A;  2JMI A;  2MNY A;  4B86 C;  4V3L C;  2CSY A; 
#chains in the Genus database with same CATH topology
 2FSA A;  3T9K A;  4UP5 A;  3M99 A;  5J3X A;  2DJA A;  4AP4 A;  2ECN A;  3FAO A;  3LQI A;  1WEQ A;  5B76 A;  4YBT A;  2XOZ A;  2CKL B;  2L43 A;  5G0F A;  4BBQ A;  4N4F A;  1WEV A;  1WEM A;  4FO9 A;  2LN0 A;  4N3W A;  2ECV A;  4YAT A;  2YUR A;  5KH9 A;  2YU4 A;  1WEO A;  1Z6U A;  3T6R A;  5AIU A;  1FP0 A;  2ECG A;  1IYM A;  2B0O E;  1XWH A;  3HCT A;  2ZET C;  1VD4 A;  2KKY A;  3KDE C;  2KRE A;  4PTB A;  2MKE A;  2LXP C;  4UI9 B;  4CCG X;  4F1P A;  2M1R A;  2YRE A;  2L75 A;  2H0D B;  3N9O A;  1G25 A;  1MBM A;  2MUM A;  2QIZ A;  4LAD B;  2JMJ A;  2KFT A;  2XB1 A;  5B75 A;  2UZG A;  4Z0R A;  4O64 A;  4A49 A;  3LDY A;  1X4I A;  1V87 A;  2I50 A;  2YHO A;  4GNE A;  2H0D A;  1WE9 A;  4V3K C;  5FB0 A;  1Z2Q A;  4GND A;  3FAN A;  4UP0 A;  5FER A;  5LCW B;  5D1M B;  2VPB A;  4R8P K;  2VPG A;  4S3O C;  2CON A;  3PLW A;  3H7H A;  2ECT A;  3U5P A;  3LQJ A;  2EOD A;  1WGM A;  2L7P A;  3GV4 A;  2LGV A;  4OGC A;  2P57 A;  3LVR E;  2K16 A;  2NAA A;  3N9Q A;  1X4J A;  4QQ4 A;  2QIC A;  5B8D A;  1ZBD B;  4YAX A;  2DSM A;  3ASL A;  3EB6 A;  4R2Y A;  2OWA A;  1F62 A;  4MVT A;  2MD7 B;  2QJ0 A;  3RTR B;  2F6N A;  4FIP A;  3L1X A;  1JM7 A;  5AIT A;  4PPE A;  2OXQ C;  4QF2 A;  4L58 A;  1WEW A;  5H1V A;  1FBV A;  4GNG A;  5EYA F;  2RI7 A;  2LAU A;  2VJE B;  3C6W A;  4FJC A;  2YQM A;  3O47 A;  2VP7 A;  5D1K B;  3U5N A;  2PNX A;  2MA5 A;  5I3L A;  2K17 A;  1WEU A;  5B77 A;  3JUE A;  2PUY A;  2EGM A;  4OGE A;  2KGI A;  4B7Y C;  3O34 A;  2XOY A;  1HYI A;  1DCQ A;  2VJE A;  1K2F A;  4YBS A;  3PHD A;  1MM3 A;  2KU3 A;  5B79 A;  3RPG C;  3Q1D A;  1DVP A;  5G05 B;  2C2L A;  3FL2 A;  2D8U A;  2KWN A;  1VFY A;  4LKA A;  2M85 A;  4GB0 A;  3SHB A;  2KR4 A;  5DIN A;  3M62 A;  1WES A;  1WEP A;  3N9P A;  5JG6 A;  3SOW A;  3ZTG A;  1RMD A;  1WIL A;  3O37 A;  2RR4 A;  2D8S A;  2LRI C;  5LKZ A;  3SOU A;  4X3G A;  3L1Z B;  4WA6 A;  4S3O B;  1WFK A;  4GNF A;  2YYR A;  3LRQ A;  4ZQL A;  2FFW A;  1VYX A;  1Z60 A;  1N87 A;  3O7A A;  5FB1 A;  5LKT A;  3SUB A;  4LJN A;  3MHH A;  5DKA A;  2CSV A;  4WZ0 A;  3ZPV E;  1CHC A;  2HDP A;  3KQI A;  2VJF A;  4W4U A;  5SVY A;  2KWO A;  2M13 A;  2FD4 A;  4WZ2 A;  2MIQ A;  2AN6 A;  1T1H A;  3HTK C;  3QZV A;  2F6J A;  5H1U A;  1HYJ A;  2KIZ A;  1WEE A;  1JM7 B;  3LVQ E;  1WIM A;  4R7E A;  3RPG B;  4O62 A;  2LGG A;  2CT2 A;  4NN2 A;  3I2D A;  4YAB A;  4WZ3 B;  4Q6F A;  2C2V S;  2YUC A;  4IC3 A;  2MT5 A;  2Y1N A;  2L80 A;  4I7C A;  2YVR A;  3ZVY A;  2BAY A;  3DDT A;  5LKU A;  5C13 A;  2E6S A;  3ZYQ A;  2FUU A;  1X4U A;  2CRR A;  2YHN A;  2YT5 A;  2YW8 A;  2VPD A;  4CA1 A;  4ZUX U;  4AYC B;  4YC9 A;  3KNV A;  2XOC A;  4AVX A;  3MHS A;  5TDW A;  5KH3 A;  2CKL A;  5TAB A;  5KH7 A;  2M6M A;  2HYE D;  3T7L A;  4A4B A;  2LQ6 A;  5FEY A;  2VPE A;  4AYC A;  3IHP A;  3O33 A;  4YAD A;  3ZVZ B;  5LKX A;  2EXU A;  2KKX A;  4I7B A;  2KWK A;  2ECI A;  2Y1M A;  2MNZ A;  2KGG A;  4I7D A;  4BHW A;  2CRW A;  2XEU A;  2KWJ A;  4A0C D;  2IDA A;  2JRJ A;  5TBN A;  4FK5 A;  3O35 A;  2CSZ A;  4ZDT A;  2RSD A;  2JM3 A;  3DPL R;  3KV5 A;  3VK6 A;  1LDK C;  3N9N A;  4MSX A;  5SVX A;  3KV6 A;  4XI1 A;  2JMD A;  2Y43 A;  3M7K A;  4Z0O A;  3DQV R;  2YQL A;  3L11 A;  3NG2 A;  4C9Z A;  2LGK A;  2LGL A;  2VJF B;  2G45 A;  1WEN A;  2F42 A;  2XP0 A;  2K1J A;  2EGP A;  3GL6 A;  2FUI A;  5G04 B;  2LXH C;  5TDR A;  3MDB C;  2MA6 A;  3C5K A;  2IQJ A;  2L0B A;  3FJU B;  5B78 A;  3ZPV 1;  2G43 A;  3N9L A;  5H9M A;  3O70 A;  4IC2 A;  3EB5 A;  3HCS A;  2MD8 C;  2M3H A;  3PUQ A;  3LJU X;  3FM8 C;  4YBM A;  4LK9 A;  3U5O A;  1JOC A;  4F52 B;  1MM2 A;  3PUR A;  4P5O B;  2JUN A;  5C11 A;  5SVI B;  3ZNI A;  1E4U A;  3E2D A;  4L7X A;  3DWD A;  3N9M A;  3M63 A;  2ECJ A;  4AUQ B;  4A4C A;  3LQH A;  2YSJ A;  2KYU A;  2LV9 A;  3SOX A;  4H9D A;  2KE1 A;  1LDJ B;  5K3Q A;  5TRB A;  1U6G B;  2LDR A;  5SVI A;  4LLB A;  2ECW A;  5D1L B;  2DX8 A;  3O36 A;  4TKP B;  2L5U A;  3U5M A;  2G6Q A;  2K4D A;  5H1T A;  3HCU A;  2YSM A;  3FEH A;  1BOR A;  2EA6 A;  2VNF A;  3V43 A;  4QF3 A;  2E6R A;  2JMI A;  2MNY A;  4B86 C;  4V3L C;  2E61 A;  2CSY A; 
#chains in the Genus database with same CATH homology
 2FSA A;  4UP5 A;  3M99 A;  5J3X A;  4AP4 A;  2ECN A;  3LQI A;  1WEQ A;  5B76 A;  4YBT A;  2CKL B;  2L43 A;  5G0F A;  4BBQ A;  4N4F A;  1WEV A;  1WEM A;  4FO9 A;  2LN0 A;  4N3W A;  2ECV A;  4YAT A;  2YUR A;  5KH9 A;  2YU4 A;  1WEO A;  1Z6U A;  3T6R A;  5AIU A;  1FP0 A;  2ECG A;  1IYM A;  1XWH A;  3HCT A;  2ZET C;  1VD4 A;  2KRE A;  4PTB A;  2LXP C;  4UI9 B;  4CCG X;  2M1R A;  2YRE A;  2L75 A;  2H0D B;  3N9O A;  1G25 A;  2MUM A;  2QIZ A;  4LAD B;  2JMJ A;  2KFT A;  2XB1 A;  5B75 A;  2UZG A;  4O64 A;  4A49 A;  1X4I A;  1V87 A;  2I50 A;  2YHO A;  4GNE A;  2H0D A;  1WE9 A;  4V3K C;  5FB0 A;  1Z2Q A;  4GND A;  4UP0 A;  5FER A;  5LCW B;  5D1M B;  2VPB A;  4R8P K;  2VPG A;  4S3O C;  2ECT A;  3U5P A;  3LQJ A;  2EOD A;  1WGM A;  3GV4 A;  2LGV A;  2K16 A;  2NAA A;  3N9Q A;  1X4J A;  2QIC A;  5B8D A;  1ZBD B;  4YAX A;  3ASL A;  3EB6 A;  4R2Y A;  1F62 A;  4MVT A;  2MD7 B;  2QJ0 A;  3RTR B;  2F6N A;  4FIP A;  3L1X A;  1JM7 A;  5AIT A;  4PPE A;  2OXQ C;  4QF2 A;  4L58 A;  1WEW A;  5H1V A;  1FBV A;  4GNG A;  5EYA F;  2RI7 A;  2VJE B;  3C6W A;  4FJC A;  2YQM A;  2VP7 A;  5D1K B;  3U5N A;  2PNX A;  2MA5 A;  5I3L A;  2K17 A;  1WEU A;  5B77 A;  2PUY A;  2KGI A;  4B7Y C;  3O34 A;  1HYI A;  2VJE A;  1K2F A;  4YBS A;  3PHD A;  1MM3 A;  2KU3 A;  5B79 A;  3RPG C;  1DVP A;  5G05 B;  2C2L A;  3FL2 A;  2KWN A;  1VFY A;  4LKA A;  2M85 A;  4GB0 A;  3SHB A;  2KR4 A;  5DIN A;  3M62 A;  1WES A;  1WEP A;  3N9P A;  5JG6 A;  3SOW A;  3ZTG A;  1RMD A;  1WIL A;  3O37 A;  2D8S A;  2LRI C;  5LKZ A;  3SOU A;  4X3G A;  3L1Z B;  4WA6 A;  4S3O B;  1WFK A;  4GNF A;  2YYR A;  3LRQ A;  4ZQL A;  1VYX A;  1Z60 A;  1N87 A;  3O7A A;  5FB1 A;  5LKT A;  4LJN A;  3MHH A;  5DKA A;  4WZ0 A;  3ZPV E;  1CHC A;  2HDP A;  3KQI A;  2VJF A;  4W4U A;  2KWO A;  4WZ2 A;  2MIQ A;  2AN6 A;  1T1H A;  3HTK C;  3QZV A;  2F6J A;  5H1U A;  1HYJ A;  2KIZ A;  1WEE A;  1JM7 B;  1WIM A;  4R7E A;  3RPG B;  2LGG A;  2CT2 A;  4NN2 A;  3I2D A;  4YAB A;  4WZ3 B;  4Q6F A;  2C2V S;  2YUC A;  4IC3 A;  2MT5 A;  2Y1N A;  2L80 A;  4I7C A;  3ZVY A;  2BAY A;  5LKU A;  5C13 A;  2E6S A;  3ZYQ A;  2FUU A;  1X4U A;  2YHN A;  2YT5 A;  2YW8 A;  2VPD A;  4CA1 A;  4ZUX U;  4AYC B;  4YC9 A;  3KNV A;  4AVX A;  3MHS A;  5TDW A;  5KH3 A;  2CKL A;  5TAB A;  5KH7 A;  2M6M A;  2HYE D;  3T7L A;  4A4B A;  2LQ6 A;  5FEY A;  2VPE A;  4AYC A;  3IHP A;  3O33 A;  4YAD A;  3ZVZ B;  5LKX A;  4I7B A;  2KWK A;  2ECI A;  2Y1M A;  2MNZ A;  2KGG A;  4I7D A;  4BHW A;  2XEU A;  2KWJ A;  4A0C D;  2IDA A;  2JRJ A;  5TBN A;  4FK5 A;  3O35 A;  2CSZ A;  4ZDT A;  2RSD A;  3DPL R;  3KV5 A;  3VK6 A;  1LDK C;  3N9N A;  4MSX A;  3KV6 A;  4XI1 A;  2JMD A;  2Y43 A;  3DQV R;  2YQL A;  3L11 A;  3NG2 A;  4C9Z A;  2LGK A;  2LGL A;  2VJF B;  2G45 A;  1WEN A;  2F42 A;  2K1J A;  2EGP A;  3GL6 A;  2FUI A;  5G04 B;  2LXH C;  5TDR A;  2MA6 A;  3C5K A;  2L0B A;  5B78 A;  3ZPV 1;  2G43 A;  3N9L A;  5H9M A;  3O70 A;  4IC2 A;  3EB5 A;  3HCS A;  2MD8 C;  2M3H A;  3PUQ A;  4YBM A;  4LK9 A;  3U5O A;  1JOC A;  4F52 B;  1MM2 A;  3PUR A;  4P5O B;  5C11 A;  3ZNI A;  1E4U A;  4L7X A;  3N9M A;  3M63 A;  2ECJ A;  4AUQ B;  4A4C A;  3LQH A;  2YSJ A;  2KYU A;  2LV9 A;  3SOX A;  2KE1 A;  1LDJ B;  5TRB A;  1U6G B;  2LDR A;  4LLB A;  2ECW A;  5D1L B;  2DX8 A;  3O36 A;  4TKP B;  2L5U A;  3U5M A;  2G6Q A;  2K4D A;  5H1T A;  3HCU A;  2YSM A;  1BOR A;  2EA6 A;  2VNF A;  3V43 A;  4QF3 A;  2E6R A;  2JMI A;  2MNY A;  4B86 C;  4V3L C;  2CSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...