3M7KA

Crystal structure of paci-dna enzyme product complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3m7kA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
2HYED 1FP0A 2K17A 2L0BA 3M7KA 2HDPA 2YQLA 3O70A 2JMIA 1VYXA 3LJUX 5K3QA 1WENA 2LQ6A 1E4UA 3ZYQA 2BAYA 2ECVA 5LKZA 2L7PA 3KQIA 2Y1NA 3O37A 2PNXA 2DX8A 4B86C 2JUNA 1WFKA 2H0DB 3T9KA 5C13A 2CKLB 5KH7A 3ZTGA 3IHPA 2RR4A 3N9OA 2VJEB 4AVXA 4GNEA 4OGEA 3MHSA 3EB6A 2JMJA 2YT5A 5FB0A 4A0CD 5B77A 2C2VS 1X4IA 3Q1DA 2ECGA 5LKTA 2RSDA 1LDKC 5I3LA 2ECIA 4GNDA 3RTRB 2VPDA 5DINA 3O47A 2ECJA 3RPGC 4L7XA 2KGGA 2LAUA 3VK6A 4ZDTA 2F6NA 5H1UA 4B7YC 2KGIA 2E61A 1BORA 1WEEA 2ECTA 5TABA 3M62A 4PTBA 2IQJA 3KDEC 3L1XA 3O35A 2G43A 1WEWA 2OXQC 5FB1A 4FJCA 4FIPA 4ZUXU 2E6RA 3SOWA 5TDRA 1WEQA 2XOCA 1X4UA 2K1JA 4YBSA 4YABA 3LRQA 5TBNA 3FAOA 3HCSA 5SVIA 3PLWA 1Z6UA 5EYAF 2KWOA 2EGPA 3GV4A 3L11A 2XEUA 2KFTA 3LQHA 5LKXA 2JM3A 2MNZA 1N87A 2YURA 1WGMA 5DKAA 2LDRA 2LN0A 4GNFA 2D8SA 2XOYA 3HCUA 1WEMA 2KU3A 3ASLA 4I7DA 4F1PA 2MD7B 5H1VA 2YW8A 4YATA 4WZ3B 5B8DA 1F62A 2KYUA 4S3OC 3FM8C 3KNVA 2CRWA 2YUCA 3PURA 3PHDA 4OGCA 3U5MA 3MDBC 2YSMA 2ZETC 2VPEA 3O36A 5B76A 2CONA 1Z60A 2P57A 5D1KB 2QJ0A 3E2DA 2ECWA 1G25A 4Z0OA 2MKEA 5KH9A 2MT5A 2VPGA 1FBVA 2MA5A 2KWKA 3SOXA 2L43A 5TRBA 1WESA 1Z2QA 2XOZA 5H9MA 3ZNIA 2VP7A 2OWAA 3FANA 4R7EA 3LQJA 4LLBA 5AIUA 3T7LA 3FJUB 3LVRE 2G6QA 3O7AA 5TDWA 4BBQA 3U5PA 5H1TA 2M1RA 2VPBA 3L1ZB 5SVIB 3N9QA 1VD4A 4UI9B 1JM7B 2EXUA 4LJNA 2YYRA 4AUQB 3O33A 4LKAA 2YU4A 4AYCA 4LADB 1V87A 1DCQA 4AP4A 5B75A 4I7BA 1MBMA 5LKUA 4X3GA 2CSVA 3O34A 4QQ4A 1WEOA 3JUEA 4V3LC 2AN6A 2LRIC 2Y43A 2G45A 5JG6A 4N3WA 3M63A 4O64A 2DJAA 5C11A 3LQIA 2MNYA 4UP5A 2B0OE 4MSXA 4GB0A 2LGGA 3FL2A 2MIQA 5J3XA 2LXHC 3KV6A 3HCTA 3ZVYA 4CCGX 2CSZA 4A49A 4P5OB 2H0DA 2CKLA 5B79A 4YBTA 2DSMA 4WZ2A 4BHWA 1WEPA 2E6SA 2VJFA 3DDTA 2YHNA 3C5KA 2LGVA 4FO9A 5FEYA 2F42A 1WE9A 2CSYA 4O62A 2FFWA 4Q6FA 4YAXA 3DPLR 4F52B 3HTKC 4C9ZA 3V43A 3H7HA 1JOCA 3SOUA 4UP0A 2FD4A 3SHBA 1RMDA 4PPEA 3RPGB 1HYJA 5SVXA 1MM3A 2PUYA 2F6JA 4XI1A 1WEVA 3N9LA 2FSAA 2L80A 2IDAA 2XB1A 2LXPC 1WEUA 1X4JA 2YREA 4MVTA 2EODA 4Z0RA 2M13A 5G04B 1HYIA 2MA6A 4H9DA 3FEHA 2YQMA 2M85A 4A4CA 3U5NA 2M3HA 4I7CA 3SUBA 5B78A 1LDJB 3U5OA 4N4FA 2YHOA 5G0FA 2EGMA 4W4UA 4CA1A 4YC9A 1T1HA 2D8UA 5FERA 2VJFB 2NAAA 1VFYA 3EB5A 2KWNA 4ZQLA 2MD8C 2FUUA 1K2FA 4LK9A 5AITA 2QIZA 1WIMA 3N9PA 2L5UA 4FK5A 4S3OB 4A4BA 1XWHA 2KE1A 3N9NA 2KKXA 4IC3A 1ZBDB 3LVQE 3T6RA 5D1MB 4WA6A 2YSJA 4L58A 5G05B 2EA6A 1U6GB 2JRJA 5LCWB 4NN2A 3ZVZB 5SVYA 5KH3A 3ZPV1 2ECNA 1DVPA 2LGLA 2RI7A 2FUIA 4QF3A 2YVRA 2KREA 2LV9A 2K16A 4R8PK 3ZPVE 1MM2A 2MUMA 3MHHA 2VJEA 2XP0A 2M6MA 4V3KC 2CRRA 5D1LB 3LDYA 4QF2A 2QICA 2KIZA 2KKYA 4WZ0A 1JM7A 3I2DA 2K4DA 2L75A 3DQVR 4TKPB 3N9MA 3C6WA 4YBMA 3QZVA 3KV5A 4YADA 3M99A 3GL6A 2LGKA 2KR4A 4GNGA 2Y1MA 2VNFA 2CT2A 1IYMA 1CHCA 2I50A 2JMDA 4IC2A 3DWDA 3NG2A 1WILA 4AYCB 4R2YA 3PUQA 2C2LA 2UZGA 2KWJA
chains in the Genus database with same CATH topology
5SVIB 2JM3A 3T9KA 3M7KA 2YREA 3H7HA 2EXUA 2DJAA 3O47A 2CRWA 2KKXA 2XOCA 2XP0A 2FD4A 3LJUX 3LVQE 2XOZA 4OGCA 3DDTA 2EGMA 3MDBC 2RR4A 2B0OE 5K3QA 2D8UA 2LAUA 4Z0RA 2OWAA 2CRRA 4OGEA 2M13A 3LDYA 2XOYA 5SVXA 2CONA 1DCQA 2E61A 3FJUB 2P57A 2L7PA 3LVRE 4O62A 2KKYA 4F1PA 3E2DA 4H9DA 2IQJA 3DWDA 3KDEC 5SVYA 4Z0OA 3PLWA 3FEHA 5SVIA 2FFWA 2CSVA 2MKEA 4QQ4A 3SUBA 3JUEA 3Q1DA 2YVRA 2JUNA 3FM8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 2HYE D;  1FP0 A;  2K17 A;  2L0B A;  3M7K A;  2HDP A;  2YQL A;  3O70 A;  2JMI A;  1VYX A;  3LJU X;  5K3Q A;  1WEN A;  2LQ6 A;  1E4U A;  3ZYQ A;  2BAY A;  2ECV A;  5LKZ A;  2L7P A;  3KQI A;  2Y1N A;  3O37 A;  2PNX A;  2DX8 A;  4B86 C;  2JUN A;  1WFK A;  2H0D B;  3T9K A;  5C13 A;  2CKL B;  5KH7 A;  3ZTG A;  3IHP A;  2RR4 A;  3N9O A;  2VJE B;  4AVX A;  4GNE A;  4OGE A;  3MHS A;  3EB6 A;  2JMJ A;  2YT5 A;  5FB0 A;  4A0C D;  5B77 A;  2C2V S;  1X4I A;  3Q1D A;  2ECG A;  5LKT A;  2RSD A;  1LDK C;  5I3L A;  2ECI A;  4GND A;  3RTR B;  2VPD A;  5DIN A;  3O47 A;  2ECJ A;  3RPG C;  4L7X A;  2KGG A;  2LAU A;  3VK6 A;  4ZDT A;  2F6N A;  5H1U A;  4B7Y C;  2KGI A;  2E61 A;  1BOR A;  1WEE A;  2ECT A;  5TAB A;  3M62 A;  4PTB A;  2IQJ A;  3KDE C;  3L1X A;  3O35 A;  2G43 A;  1WEW A;  2OXQ C;  5FB1 A;  4FJC A;  4FIP A;  4ZUX U;  2E6R A;  3SOW A;  5TDR A;  1WEQ A;  2XOC A;  1X4U A;  2K1J A;  4YBS A;  4YAB A;  3LRQ A;  5TBN A;  3FAO A;  3HCS A;  5SVI A;  3PLW A;  1Z6U A;  5EYA F;  2KWO A;  2EGP A;  3GV4 A;  3L11 A;  2XEU A;  2KFT A;  3LQH A;  5LKX A;  2JM3 A;  2MNZ A;  1N87 A;  2YUR A;  1WGM A;  5DKA A;  2LDR A;  2LN0 A;  4GNF A;  2D8S A;  2XOY A;  3HCU A;  1WEM A;  2KU3 A;  3ASL A;  4I7D A;  4F1P A;  2MD7 B;  5H1V A;  2YW8 A;  4YAT A;  4WZ3 B;  5B8D A;  1F62 A;  2KYU A;  4S3O C;  3FM8 C;  3KNV A;  2CRW A;  2YUC A;  3PUR A;  3PHD A;  4OGC A;  3U5M A;  3MDB C;  2YSM A;  2ZET C;  2VPE A;  3O36 A;  5B76 A;  2CON A;  1Z60 A;  2P57 A;  5D1K B;  2QJ0 A;  3E2D A;  2ECW A;  1G25 A;  4Z0O A;  2MKE A;  5KH9 A;  2MT5 A;  2VPG A;  1FBV A;  2MA5 A;  2KWK A;  3SOX A;  2L43 A;  5TRB A;  1WES A;  1Z2Q A;  2XOZ A;  5H9M A;  3ZNI A;  2VP7 A;  2OWA A;  3FAN A;  4R7E A;  3LQJ A;  4LLB A;  5AIU A;  3T7L A;  3FJU B;  3LVR E;  2G6Q A;  3O7A A;  5TDW A;  4BBQ A;  3U5P A;  5H1T A;  2M1R A;  2VPB A;  3L1Z B;  5SVI B;  3N9Q A;  1VD4 A;  4UI9 B;  1JM7 B;  2EXU A;  4LJN A;  2YYR A;  4AUQ B;  3O33 A;  4LKA A;  2YU4 A;  4AYC A;  4LAD B;  1V87 A;  1DCQ A;  4AP4 A;  5B75 A;  4I7B A;  1MBM A;  5LKU A;  4X3G A;  2CSV A;  3O34 A;  4QQ4 A;  1WEO A;  3JUE A;  4V3L C;  2AN6 A;  2LRI C;  2Y43 A;  2G45 A;  5JG6 A;  4N3W A;  3M63 A;  4O64 A;  2DJA A;  5C11 A;  3LQI A;  2MNY A;  4UP5 A;  2B0O E;  4MSX A;  4GB0 A;  2LGG A;  3FL2 A;  2MIQ A;  5J3X A;  2LXH C;  3KV6 A;  3HCT A;  3ZVY A;  4CCG X;  2CSZ A;  4A49 A;  4P5O B;  2H0D A;  2CKL A;  5B79 A;  4YBT A;  2DSM A;  4WZ2 A;  4BHW A;  1WEP A;  2E6S A;  2VJF A;  3DDT A;  2YHN A;  3C5K A;  2LGV A;  4FO9 A;  5FEY A;  2F42 A;  1WE9 A;  2CSY A;  4O62 A;  2FFW A;  4Q6F A;  4YAX A;  3DPL R;  4F52 B;  3HTK C;  4C9Z A;  3V43 A;  3H7H A;  1JOC A;  3SOU A;  4UP0 A;  2FD4 A;  3SHB A;  1RMD A;  4PPE A;  3RPG B;  1HYJ A;  5SVX A;  1MM3 A;  2PUY A;  2F6J A;  4XI1 A;  1WEV A;  3N9L A;  2FSA A;  2L80 A;  2IDA A;  2XB1 A;  2LXP C;  1WEU A;  1X4J A;  2YRE A;  4MVT A;  2EOD A;  4Z0R A;  2M13 A;  5G04 B;  1HYI A;  2MA6 A;  4H9D A;  3FEH A;  2YQM A;  2M85 A;  4A4C A;  3U5N A;  2M3H A;  4I7C A;  3SUB A;  5B78 A;  1LDJ B;  3U5O A;  4N4F A;  2YHO A;  5G0F A;  2EGM A;  4W4U A;  4CA1 A;  4YC9 A;  1T1H A;  2D8U A;  5FER A;  2VJF B;  2NAA A;  1VFY A;  3EB5 A;  2KWN A;  4ZQL A;  2MD8 C;  2FUU A;  1K2F A;  4LK9 A;  5AIT A;  2QIZ A;  1WIM A;  3N9P A;  2L5U A;  4FK5 A;  4S3O B;  4A4B A;  1XWH A;  2KE1 A;  3N9N A;  2KKX A;  4IC3 A;  1ZBD B;  3LVQ E;  3T6R A;  5D1M B;  4WA6 A;  2YSJ A;  4L58 A;  5G05 B;  2EA6 A;  1U6G B;  2JRJ A;  5LCW B;  4NN2 A;  3ZVZ B;  5SVY A;  5KH3 A;  3ZPV 1;  2ECN A;  1DVP A;  2LGL A;  2RI7 A;  2FUI A;  4QF3 A;  2YVR A;  2KRE A;  2LV9 A;  2K16 A;  4R8P K;  3ZPV E;  1MM2 A;  2MUM A;  3MHH A;  2VJE A;  2XP0 A;  2M6M A;  4V3K C;  2CRR A;  5D1L B;  3LDY A;  4QF2 A;  2QIC A;  2KIZ A;  2KKY A;  4WZ0 A;  1JM7 A;  3I2D A;  2K4D A;  2L75 A;  3DQV R;  4TKP B;  3N9M A;  3C6W A;  4YBM A;  3QZV A;  3KV5 A;  4YAD A;  3M99 A;  3GL6 A;  2LGK A;  2KR4 A;  4GNG A;  2Y1M A;  2VNF A;  2CT2 A;  1IYM A;  1CHC A;  2I50 A;  2JMD A;  4IC2 A;  3DWD A;  3NG2 A;  1WIL A;  4AYC B;  4R2Y A;  3PUQ A;  2C2L A;  2UZG A;  2KWJ A; 
#chains in the Genus database with same CATH homology
 5SVI B;  2JM3 A;  3T9K A;  3M7K A;  2YRE A;  3H7H A;  2EXU A;  2DJA A;  3O47 A;  2CRW A;  2KKX A;  2XOC A;  2XP0 A;  2FD4 A;  3LJU X;  3LVQ E;  2XOZ A;  4OGC A;  3DDT A;  2EGM A;  3MDB C;  2RR4 A;  2B0O E;  5K3Q A;  2D8U A;  2LAU A;  4Z0R A;  2OWA A;  2CRR A;  4OGE A;  2M13 A;  3LDY A;  2XOY A;  5SVX A;  2CON A;  1DCQ A;  2E61 A;  3FJU B;  2P57 A;  2L7P A;  3LVR E;  4O62 A;  2KKY A;  4F1P A;  3E2D A;  4H9D A;  2IQJ A;  3DWD A;  3KDE C;  5SVY A;  4Z0O A;  3PLW A;  3FEH A;  5SVI A;  2FFW A;  2CSV A;  2MKE A;  4QQ4 A;  3SUB A;  3JUE A;  3Q1D A;  2YVR A;  2JUN A;  3FM8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...