3M7KA

Crystal structure of paci-dna enzyme product complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
b'MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3m7kA00
3M7KA 3LDYA
chains in the Genus database with same CATH superfamily
2KWKA 2L75A 2YVRA 4Z0RA 2E6SA 2MA5A 2CKLB 2DSMA 3QZVA 4GNDA 2AN6A 2E6RA 3T9KA 5G04B 2ZETC 2LAUA 3PHDA 5TDRA 5SVIA 5B79A 2F42A 4WZ3B 1WIMA 2C2LA 2F6JA 3GV4A 3MDBC 3KNVA 1XWHA 2YYRA 4OGEA 2MNYA 2LXHC 2YSMA 2L43A 2ECTA 3FANA 2IDAA 3IHPA 3E2DA 3LVRE 3V43A 2JRJA 2JMDA 5C11A 5AIUA 5B76A 2QJ0A 4LK9A 2E61A 1X4JA 1LDKC 1LDJB 1WEEA 2EGMA 3C5KA 4S3OB 2QIZA 1X4IA 3L1XA 2RSDA 2Y1NA 4B86C 3ZPV1 1F62A 3U5NA 5I3LA 4AYCA 3FM8C 4ZUXU 1VYXA 1MM2A 1WENA 5AITA 3DPLR 4N3WA 5DKAA 4OGCA 2KE1A 4AP4A 4FJCA 2KIZA 3PURA 4GNGA 1FBVA 4UI9B 2LGLA 2VJFA 2LGVA 3O7AA 4YBTA 5G05B 2QICA 3O33A 3SOWA 3LQHA 2D8UA 4MSXA 2KKXA 2XB1A 3U5OA 5H9MA 4R8PK 2VJEA 2YHNA 3N9MA 2MKEA 3HTKC 1WEWA 3RTRB 2EODA 2C2VS 2HYED 3EB6A 5TDWA 5C13A 2BAYA 2YW8A 1WE9A 2ECGA 4A4CA 3HCUA 2MUMA 4AUQB 3DQVR 1BORA 3Q1DA 3LVQE 2KKYA 1E4UA 2KGIA 3C6WA 3JUEA 4YADA 4I7DA 3N9QA 1DVPA 1WEMA 2OWAA 4LADB 3MHHA 5SVIB 2KGGA 3HCSA 1WEVA 2LGGA 3ZYQA 2XOCA 2ECNA 1WEQA 4MVTA 2H0DA 1WEPA 4W4UA 2B0OE 2MT5A 4R2YA 2CSYA 5B75A 2EXUA 4O62A 5KH7A 4LLBA 3NG2A 3GL6A 3O37A 4PTBA 1U6GB 3N9LA 1JM7A 3RPGB 2L0BA 2KWNA 2Y1MA 4QF2A 2UZGA 2YSJA 2YUCA 3SUBA 5J3XA 4N4FA 5H1VA 1Z2QA 3SOXA 4AVXA 4AYCB 2PNXA 3M62A 2VPDA 3U5PA 3M63A 2CSVA 4YATA 1WILA 4S3OC 5KH9A 3MHSA 5LCWB 5TBNA 5B78A 2VPEA 4PPEA 2CRRA 2JM3A 3H7HA 1Z6UA 4QQ4A 2K16A 4BBQA 2RI7A 2M3HA 4A4BA 3LRQA 4O64A 4R7EA 2FUUA 2K4DA 4YBSA 2CT2A 3M99A 2VJEB 4A0CD 2YURA 1CHCA 2YHOA 5H1UA 3ZVZB 3KV5A 3FAOA 3O34A 2KYUA 4Z0OA 2M13A 5SVYA 4Q6FA 2MD7B 2F6NA 2LV9A 2CRWA 3HCTA 4WA6A 5D1LB 1JOCA 3DDTA 3LQJA 2FSAA 2VPGA 3O70A 2LRIC 2FD4A 1HYIA 3ZNIA 2LDRA 1MBMA 5KH3A 1WFKA 2ECJA 2K17A 2EA6A 5D1KB 4I7CA 2KFTA 1DCQA 3O36A 3EB5A 5DINA 3L1ZB 2VP7A 2MIQA 5JG6A 2H0DB 4H9DA 2G43A 2CSZA 5LKUA 1WEUA 2ECIA 2CONA 2EGPA 4B7YC 2OXQC 2G45A 3LQIA 3SOUA 2L5UA 2L7PA 4GB0A 4P5OB 1IYMA 4NN2A 2LGKA 2LXPC 2I50A 3FL2A 2KWJA 3T7LA 4YAXA 4GNEA 3L11A 1JM7B 5EYAF 4WZ2A 4F1PA 4ZDTA 4L58A 4LJNA 4I7BA 4YBMA 4WZ0A 2CKLA 3T6RA 3N9PA 5D1MB 4LKAA 2XEUA 2YQMA 4CA1A 1FP0A 1VD4A 2M85A 3RPGC 3N9OA 2MD8C 1RMDA 5FB0A 2Y43A 3SHBA 2DJAA 3LDYA 2K1JA 2XOZA 4F52B 2VPBA 5FB1A 2IQJA 4V3LC 1Z60A 4IC2A 2KU3A 2P57A 2M1RA 2XOYA 5FEYA 4X3GA 2RR4A 2KR4A 3O47A 2G6QA 3M7KA 5TABA 3N9NA 1G25A 2VJFB 4FK5A 5LKTA 2YQLA 2FUIA 1T1HA 3I2DA 5TRBA 3U5MA 2M6MA 4ZQLA 1X4UA 4L7XA 4QF3A 2ECVA 1HYJA 2JUNA 2LN0A 4YABA 2PUYA 2JMJA 2MNZA 4TKPB 1WGMA 5LKXA 2HDPA 5B77A 1N87A 2ECWA 4IC3A 3ZTGA 4CCGX 3ZVYA 4FIPA 2L80A 2YU4A 4YC9A 2VNFA 2YT5A 2XP0A 3KQIA 3PLWA 1WESA 1MM3A 2YREA 3FJUB 5B8DA 1VFYA 3PUQA 4A49A 3FEHA 2D8SA 4BHWA 1K2FA 2MA6A 2DX8A 4GNFA 1V87A 4C9ZA 5FERA 5H1TA 1WEOA 2KREA 3KDEC 3ZPVE 2JMIA 4FO9A 5K3QA 4XI1A 3VK6A 3DWDA 4UP0A 3KV6A 4V3KC 3LJUX 2FFWA 4UP5A 5SVXA 2NAAA 2KWOA 2LQ6A 3O35A 5LKZA 1ZBDB 5G0FA 3ASLA
chains in the Genus database with same CATH topology
2YVRA 4OGEA 2DJAA 3LDYA 2CRWA 2XOZA 4Z0RA 2OWAA 2CSVA 5SVIB 3DDTA 4F1PA 4H9DA 2MKEA 3T9KA 2IQJA 3FM8C 2CONA 2LAUA 3KDEC 2XP0A 2XOCA 3E2DA 3LVRE 5K3QA 2FD4A 3PLWA 2JUNA 3DWDA 2P57A 2XOYA 5SVIA 2D8UA 2KKXA 4OGCA 2RR4A 2YREA 3LJUX 2FFWA 2CRRA 3FJUB 2B0OE 2L7PA 3O47A 5SVXA 3SUBA 2E61A 3M7KA 2JM3A 4Z0OA 3MDBC 3Q1DA 3LVQE 2KKYA 1DCQA 3H7HA 2M13A 5SVYA 3FEHA 2EXUA 4O62A 2EGMA 3JUEA 4QQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7K A;  3LDY A; 
#chains in the Genus database with same CATH topology
 2KWK A;  2L75 A;  2YVR A;  4Z0R A;  2E6S A;  2MA5 A;  2CKL B;  2DSM A;  3QZV A;  4GND A;  2AN6 A;  2E6R A;  3T9K A;  5G04 B;  2ZET C;  2LAU A;  3PHD A;  5TDR A;  5SVI A;  5B79 A;  2F42 A;  4WZ3 B;  1WIM A;  2C2L A;  2F6J A;  3GV4 A;  3MDB C;  3KNV A;  1XWH A;  2YYR A;  4OGE A;  2MNY A;  2LXH C;  2YSM A;  2L43 A;  2ECT A;  3FAN A;  2IDA A;  3IHP A;  3E2D A;  3LVR E;  3V43 A;  2JRJ A;  2JMD A;  5C11 A;  5AIU A;  5B76 A;  2QJ0 A;  4LK9 A;  2E61 A;  1X4J A;  1LDK C;  1LDJ B;  1WEE A;  2EGM A;  3C5K A;  4S3O B;  2QIZ A;  1X4I A;  3L1X A;  2RSD A;  2Y1N A;  4B86 C;  3ZPV 1;  1F62 A;  3U5N A;  5I3L A;  4AYC A;  3FM8 C;  4ZUX U;  1VYX A;  1MM2 A;  1WEN A;  5AIT A;  3DPL R;  4N3W A;  5DKA A;  4OGC A;  2KE1 A;  4AP4 A;  4FJC A;  2KIZ A;  3PUR A;  4GNG A;  1FBV A;  4UI9 B;  2LGL A;  2VJF A;  2LGV A;  3O7A A;  4YBT A;  5G05 B;  2QIC A;  3O33 A;  3SOW A;  3LQH A;  2D8U A;  4MSX A;  2KKX A;  2XB1 A;  3U5O A;  5H9M A;  4R8P K;  2VJE A;  2YHN A;  3N9M A;  2MKE A;  3HTK C;  1WEW A;  3RTR B;  2EOD A;  2C2V S;  2HYE D;  3EB6 A;  5TDW A;  5C13 A;  2BAY A;  2YW8 A;  1WE9 A;  2ECG A;  4A4C A;  3HCU A;  2MUM A;  4AUQ B;  3DQV R;  1BOR A;  3Q1D A;  3LVQ E;  2KKY A;  1E4U A;  2KGI A;  3C6W A;  3JUE A;  4YAD A;  4I7D A;  3N9Q A;  1DVP A;  1WEM A;  2OWA A;  4LAD B;  3MHH A;  5SVI B;  2KGG A;  3HCS A;  1WEV A;  2LGG A;  3ZYQ A;  2XOC A;  2ECN A;  1WEQ A;  4MVT A;  2H0D A;  1WEP A;  4W4U A;  2B0O E;  2MT5 A;  4R2Y A;  2CSY A;  5B75 A;  2EXU A;  4O62 A;  5KH7 A;  4LLB A;  3NG2 A;  3GL6 A;  3O37 A;  4PTB A;  1U6G B;  3N9L A;  1JM7 A;  3RPG B;  2L0B A;  2KWN A;  2Y1M A;  4QF2 A;  2UZG A;  2YSJ A;  2YUC A;  3SUB A;  5J3X A;  4N4F A;  5H1V A;  1Z2Q A;  3SOX A;  4AVX A;  4AYC B;  2PNX A;  3M62 A;  2VPD A;  3U5P A;  3M63 A;  2CSV A;  4YAT A;  1WIL A;  4S3O C;  5KH9 A;  3MHS A;  5LCW B;  5TBN A;  5B78 A;  2VPE A;  4PPE A;  2CRR A;  2JM3 A;  3H7H A;  1Z6U A;  4QQ4 A;  2K16 A;  4BBQ A;  2RI7 A;  2M3H A;  4A4B A;  3LRQ A;  4O64 A;  4R7E A;  2FUU A;  2K4D A;  4YBS A;  2CT2 A;  3M99 A;  2VJE B;  4A0C D;  2YUR A;  1CHC A;  2YHO A;  5H1U A;  3ZVZ B;  3KV5 A;  3FAO A;  3O34 A;  2KYU A;  4Z0O A;  2M13 A;  5SVY A;  4Q6F A;  2MD7 B;  2F6N A;  2LV9 A;  2CRW A;  3HCT A;  4WA6 A;  5D1L B;  1JOC A;  3DDT A;  3LQJ A;  2FSA A;  2VPG A;  3O70 A;  2LRI C;  2FD4 A;  1HYI A;  3ZNI A;  2LDR A;  1MBM A;  5KH3 A;  1WFK A;  2ECJ A;  2K17 A;  2EA6 A;  5D1K B;  4I7C A;  2KFT A;  1DCQ A;  3O36 A;  3EB5 A;  5DIN A;  3L1Z B;  2VP7 A;  2MIQ A;  5JG6 A;  2H0D B;  4H9D A;  2G43 A;  2CSZ A;  5LKU A;  1WEU A;  2ECI A;  2CON A;  2EGP A;  4B7Y C;  2OXQ C;  2G45 A;  3LQI A;  3SOU A;  2L5U A;  2L7P A;  4GB0 A;  4P5O B;  1IYM A;  4NN2 A;  2LGK A;  2LXP C;  2I50 A;  3FL2 A;  2KWJ A;  3T7L A;  4YAX A;  4GNE A;  3L11 A;  1JM7 B;  5EYA F;  4WZ2 A;  4F1P A;  4ZDT A;  4L58 A;  4LJN A;  4I7B A;  4YBM A;  4WZ0 A;  2CKL A;  3T6R A;  3N9P A;  5D1M B;  4LKA A;  2XEU A;  2YQM A;  4CA1 A;  1FP0 A;  1VD4 A;  2M85 A;  3RPG C;  3N9O A;  2MD8 C;  1RMD A;  5FB0 A;  2Y43 A;  3SHB A;  2DJA A;  3LDY A;  2K1J A;  2XOZ A;  4F52 B;  2VPB A;  5FB1 A;  2IQJ A;  4V3L C;  1Z60 A;  4IC2 A;  2KU3 A;  2P57 A;  2M1R A;  2XOY A;  5FEY A;  4X3G A;  2RR4 A;  2KR4 A;  3O47 A;  2G6Q A;  3M7K A;  5TAB A;  3N9N A;  1G25 A;  2VJF B;  4FK5 A;  5LKT A;  2YQL A;  2FUI A;  1T1H A;  3I2D A;  5TRB A;  3U5M A;  2M6M A;  4ZQL A;  1X4U A;  4L7X A;  4QF3 A;  2ECV A;  1HYJ A;  2JUN A;  2LN0 A;  4YAB A;  2PUY A;  2JMJ A;  2MNZ A;  4TKP B;  1WGM A;  5LKX A;  2HDP A;  5B77 A;  1N87 A;  2ECW A;  4IC3 A;  3ZTG A;  4CCG X;  3ZVY A;  4FIP A;  2L80 A;  2YU4 A;  4YC9 A;  2VNF A;  2YT5 A;  2XP0 A;  3KQI A;  3PLW A;  1WES A;  1MM3 A;  2YRE A;  3FJU B;  5B8D A;  1VFY A;  3PUQ A;  4A49 A;  3FEH A;  2D8S A;  4BHW A;  1K2F A;  2MA6 A;  2DX8 A;  4GNF A;  1V87 A;  4C9Z A;  5FER A;  5H1T A;  1WEO A;  2KRE A;  3KDE C;  3ZPV E;  2JMI A;  4FO9 A;  5K3Q A;  4XI1 A;  3VK6 A;  3DWD A;  4UP0 A;  3KV6 A;  4V3K C;  3LJU X;  2FFW A;  4UP5 A;  5SVX A;  2NAA A;  2KWO A;  2LQ6 A;  3O35 A;  5LKZ A;  1ZBD B;  5G0F A;  3ASL A; 
#chains in the Genus database with same CATH homology
 2YVR A;  4OGE A;  2DJA A;  3LDY A;  2CRW A;  2XOZ A;  4Z0R A;  2OWA A;  2CSV A;  5SVI B;  3DDT A;  4F1P A;  4H9D A;  2MKE A;  3T9K A;  2IQJ A;  3FM8 C;  2CON A;  2LAU A;  3KDE C;  2XP0 A;  2XOC A;  3E2D A;  3LVR E;  5K3Q A;  2FD4 A;  3PLW A;  2JUN A;  3DWD A;  2P57 A;  2XOY A;  5SVI A;  2D8U A;  2KKX A;  4OGC A;  2RR4 A;  2YRE A;  3LJU X;  2FFW A;  2CRR A;  3FJU B;  2B0O E;  2L7P A;  3O47 A;  5SVX A;  3SUB A;  2E61 A;  3M7K A;  2JM3 A;  4Z0O A;  3MDB C;  3Q1D A;  3LVQ E;  2KKY A;  1DCQ A;  3H7H A;  2M13 A;  5SVY A;  3FEH A;  2EXU A;  4O62 A;  2EGM A;  3JUE A;  4QQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...