3M7KA

Crystal structure of paci-dna enzyme product complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3m7kA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
2LRIC 2YSMA 2XOYA 2KE1A 5FEYA 1WIMA 3H7HA 4B7YC 2QIZA 4YBTA 1IYMA 2EA6A 4AP4A 2DSMA 2CSYA 3FL2A 2YREA 2P57A 5TRBA 2KU3A 4LLBA 2VP7A 2L5UA 5SVYA 1HYJA 5D1MB 2JMJA 2CSVA 2Y43A 2FD4A 5G04B 3Q1DA 5KH7A 3RTRB 5LCWB 2CRRA 4WA6A 5K3QA 3V43A 2EGPA 5FB0A 2KKXA 2QICA 1WEPA 5SVIB 5I3LA 4A49A 4WZ2A 4FIPA 4S3OC 4YABA 5TABA 2VJFB 1WESA 3KV5A 2LAUA 2K4DA 2MA6A 3HTKC 4I7BA 5C11A 5AITA 4S3OB 2VPGA 4FJCA 3T9KA 4L7XA 2VPEA 3ZVYA 5LKUA 2YHNA 4IC2A 2XEUA 3ZYQA 2ECIA 2LGKA 4BBQA 2KWJA 3ZPV1 2CONA 3GV4A 1WFKA 3PUQA 5B79A 2YSJA 2LXHC 3L11A 3SUBA 3FM8C 3PURA 3U5PA 2ECGA 5FB1A 2FFWA 4V3KC 2FUUA 2E61A 2ECTA 3DDTA 3DWDA 3KQIA 4BHWA 2E6SA 1HYIA 2CSZA 3FJUB 2B0OE 3M7KA 4B86C 2EGMA 3O36A 2MNYA 1K2FA 3ASLA 4CCGX 4AYCA 2ECNA 1LDJB 4W4UA 4QF2A 3IHPA 1X4JA 2JMDA 2XOZA 2VJEB 4X3GA 5J3XA 2MKEA 2YYRA 5TDWA 1F62A 2MUMA 3LJUX 5G05B 5LKTA 4P5OB 5FERA 2LGVA 1LDKC 2FUIA 4N3WA 5SVIA 4GNFA 2IDAA 2K17A 2HYED 2H0DB 4GNEA 3N9LA 2RSDA 1JOCA 4GNGA 1CHCA 4L58A 1Z60A 4LKAA 2NAAA 1DVPA 4WZ0A 2L80A 2Y1NA 4LADB 5D1KB 4R2YA 5H9MA 2ECWA 2XB1A 5DKAA 2VPDA 2EODA 4NN2A 2L7PA 3M62A 1ZBDB 2L0BA 3E2DA 4R7EA 2F42A 2YVRA 2M1RA 2C2LA 3ZTGA 5LKZA 2KFTA 3N9MA 3O47A 5H1UA 3U5OA 4I7CA 1FBVA 2M6MA 2JUNA 2LXPC 2PNXA 4ZDTA 4OGCA 4UP5A 3FAOA 2OWAA 5B8DA 3T7LA 1WEEA 2CT2A 2KKYA 1WEOA 4ZQLA 2VNFA 2HDPA 2KWKA 5B77A 2FSAA 1WILA 3N9NA 1JM7A 4UI9B 3HCTA 2G6QA 2BAYA 2CKLB 3SOUA 2OXQC 5G0FA 4YADA 4WZ3B 2VJEA 4A4BA 5H1VA 1DCQA 2YURA 2LGLA 3EB6A 3N9PA 3LQHA 5LKXA 4O62A 4A0CD 2QJ0A 1RMDA 5DINA 2YUCA 1WEWA 4IC3A 4OGEA 2RI7A 4F52B 2H0DA 3C6WA 3T6RA 2JM3A 2UZGA 1XWHA 2MNZA 2ECJA 3KV6A 3M99A 5TBNA 1WE9A 5B75A 1VFYA 4LK9A 3DPLR 3SOXA 4GNDA 2M3HA 2LQ6A 4UP0A 4Q6FA 3LQIA 5C13A 5D1LB 3FANA 2G43A 3GL6A 5B76A 1U6GB 3O35A 1N87A 3LVQE 2KGIA 2M13A 3M63A 2DX8A 2F6NA 4QF3A 5AIUA 2KWOA 1Z6UA 4A4CA 3HCSA 1WEVA 3NG2A 2K1JA 5H1TA 2VJFA 1V87A 2ZETC 3KNVA 2MT5A 4AVXA 2EXUA 1FP0A 1MM3A 2K16A 1G25A 3RPGC 5TDRA 3O70A 3JUEA 4H9DA 2ECVA 2XOCA 3HCUA 3U5MA 4I7DA 3N9QA 3SHBA 2IQJA 3PLWA 3QZVA 2CKLA 4AUQB 3EB5A 3LQJA 3MHSA 2KYUA 4AYCB 3RPGB 2MIQA 1WENA 1X4UA 3U5NA 3PHDA 2I50A 4YATA 2XP0A 3L1ZB 3MHHA 1WEUA 2YHOA 4MVTA 1X4IA 4FO9A 4YC9A 3ZPVE 5SVXA 3N9OA 2PUYA 2DJAA 3LVRE 2L43A 4O64A 1VD4A 4YBMA 5EYAF 4CA1A 4LJNA 4PTBA 2JMIA 3FEHA 3KDEC 3L1XA 2G45A 2LGGA 4ZUXU 2RR4A 2YU4A 4YBSA 1VYXA 5JG6A 2D8SA 3I2DA 2KR4A 2M85A 2LN0A 3LDYA 4Z0RA 3O7AA 2KWNA 3O34A 4PPEA 1T1HA 4V3LC 4F1PA 1WGMA 2E6RA 5KH9A 4FK5A 5B78A 3LRQA 3ZNIA 2AN6A 2YW8A 4YAXA 4R8PK 2CRWA 2YT5A 4GB0A 2Y1MA 2YQLA 3O33A 4C9ZA 4QQ4A 2L75A 1MBMA 2MD7B 2MD8C 1WEQA 1JM7B 4MSXA 3ZVZB 2D8UA 2JRJA 1WEMA 3VK6A 2MA5A 3DQVR 4XI1A 1BORA 1E4UA 1MM2A 5KH3A 2YQMA 3C5KA 1Z2QA 3MDBC 2F6JA 2KREA 2KIZA 3SOWA 2VPBA 4Z0OA 2LV9A 4N4FA 4TKPB 3O37A 2LDRA 2C2VS 2KGGA
chains in the Genus database with same CATH topology
3FEHA 4F1PA 3KDEC 2JUNA 2EXUA 2XOYA 4OGCA 2D8UA 2CSVA 3LJUX 2OWAA 4OGEA 2XP0A 2RR4A 2FD4A 3FJUB 2CONA 3Q1DA 3JUEA 2KKYA 4H9DA 2B0OE 3H7HA 2JM3A 2CRRA 3LVQE 2XOCA 3SUBA 3M7KA 2M13A 2LAUA 3MDBC 2L7PA 5SVIA 2EGMA 5K3QA 3FM8C 3E2DA 2CRWA 2IQJA 3LDYA 3PLWA 2YREA 4Z0OA 4Z0RA 1DCQA 2P57A 2YVRA 2KKXA 5SVXA 2DJAA 3LVRE 4QQ4A 2FFWA 3T9KA 5SVIB 3O47A 2E61A 3DDTA 2XOZA 3DWDA 4O62A 2MKEA 5SVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 2LRI C;  2YSM A;  2XOY A;  2KE1 A;  5FEY A;  1WIM A;  3H7H A;  4B7Y C;  2QIZ A;  4YBT A;  1IYM A;  2EA6 A;  4AP4 A;  2DSM A;  2CSY A;  3FL2 A;  2YRE A;  2P57 A;  5TRB A;  2KU3 A;  4LLB A;  2VP7 A;  2L5U A;  5SVY A;  1HYJ A;  5D1M B;  2JMJ A;  2CSV A;  2Y43 A;  2FD4 A;  5G04 B;  3Q1D A;  5KH7 A;  3RTR B;  5LCW B;  2CRR A;  4WA6 A;  5K3Q A;  3V43 A;  2EGP A;  5FB0 A;  2KKX A;  2QIC A;  1WEP A;  5SVI B;  5I3L A;  4A49 A;  4WZ2 A;  4FIP A;  4S3O C;  4YAB A;  5TAB A;  2VJF B;  1WES A;  3KV5 A;  2LAU A;  2K4D A;  2MA6 A;  3HTK C;  4I7B A;  5C11 A;  5AIT A;  4S3O B;  2VPG A;  4FJC A;  3T9K A;  4L7X A;  2VPE A;  3ZVY A;  5LKU A;  2YHN A;  4IC2 A;  2XEU A;  3ZYQ A;  2ECI A;  2LGK A;  4BBQ A;  2KWJ A;  3ZPV 1;  2CON A;  3GV4 A;  1WFK A;  3PUQ A;  5B79 A;  2YSJ A;  2LXH C;  3L11 A;  3SUB A;  3FM8 C;  3PUR A;  3U5P A;  2ECG A;  5FB1 A;  2FFW A;  4V3K C;  2FUU A;  2E61 A;  2ECT A;  3DDT A;  3DWD A;  3KQI A;  4BHW A;  2E6S A;  1HYI A;  2CSZ A;  3FJU B;  2B0O E;  3M7K A;  4B86 C;  2EGM A;  3O36 A;  2MNY A;  1K2F A;  3ASL A;  4CCG X;  4AYC A;  2ECN A;  1LDJ B;  4W4U A;  4QF2 A;  3IHP A;  1X4J A;  2JMD A;  2XOZ A;  2VJE B;  4X3G A;  5J3X A;  2MKE A;  2YYR A;  5TDW A;  1F62 A;  2MUM A;  3LJU X;  5G05 B;  5LKT A;  4P5O B;  5FER A;  2LGV A;  1LDK C;  2FUI A;  4N3W A;  5SVI A;  4GNF A;  2IDA A;  2K17 A;  2HYE D;  2H0D B;  4GNE A;  3N9L A;  2RSD A;  1JOC A;  4GNG A;  1CHC A;  4L58 A;  1Z60 A;  4LKA A;  2NAA A;  1DVP A;  4WZ0 A;  2L80 A;  2Y1N A;  4LAD B;  5D1K B;  4R2Y A;  5H9M A;  2ECW A;  2XB1 A;  5DKA A;  2VPD A;  2EOD A;  4NN2 A;  2L7P A;  3M62 A;  1ZBD B;  2L0B A;  3E2D A;  4R7E A;  2F42 A;  2YVR A;  2M1R A;  2C2L A;  3ZTG A;  5LKZ A;  2KFT A;  3N9M A;  3O47 A;  5H1U A;  3U5O A;  4I7C A;  1FBV A;  2M6M A;  2JUN A;  2LXP C;  2PNX A;  4ZDT A;  4OGC A;  4UP5 A;  3FAO A;  2OWA A;  5B8D A;  3T7L A;  1WEE A;  2CT2 A;  2KKY A;  1WEO A;  4ZQL A;  2VNF A;  2HDP A;  2KWK A;  5B77 A;  2FSA A;  1WIL A;  3N9N A;  1JM7 A;  4UI9 B;  3HCT A;  2G6Q A;  2BAY A;  2CKL B;  3SOU A;  2OXQ C;  5G0F A;  4YAD A;  4WZ3 B;  2VJE A;  4A4B A;  5H1V A;  1DCQ A;  2YUR A;  2LGL A;  3EB6 A;  3N9P A;  3LQH A;  5LKX A;  4O62 A;  4A0C D;  2QJ0 A;  1RMD A;  5DIN A;  2YUC A;  1WEW A;  4IC3 A;  4OGE A;  2RI7 A;  4F52 B;  2H0D A;  3C6W A;  3T6R A;  2JM3 A;  2UZG A;  1XWH A;  2MNZ A;  2ECJ A;  3KV6 A;  3M99 A;  5TBN A;  1WE9 A;  5B75 A;  1VFY A;  4LK9 A;  3DPL R;  3SOX A;  4GND A;  2M3H A;  2LQ6 A;  4UP0 A;  4Q6F A;  3LQI A;  5C13 A;  5D1L B;  3FAN A;  2G43 A;  3GL6 A;  5B76 A;  1U6G B;  3O35 A;  1N87 A;  3LVQ E;  2KGI A;  2M13 A;  3M63 A;  2DX8 A;  2F6N A;  4QF3 A;  5AIU A;  2KWO A;  1Z6U A;  4A4C A;  3HCS A;  1WEV A;  3NG2 A;  2K1J A;  5H1T A;  2VJF A;  1V87 A;  2ZET C;  3KNV A;  2MT5 A;  4AVX A;  2EXU A;  1FP0 A;  1MM3 A;  2K16 A;  1G25 A;  3RPG C;  5TDR A;  3O70 A;  3JUE A;  4H9D A;  2ECV A;  2XOC A;  3HCU A;  3U5M A;  4I7D A;  3N9Q A;  3SHB A;  2IQJ A;  3PLW A;  3QZV A;  2CKL A;  4AUQ B;  3EB5 A;  3LQJ A;  3MHS A;  2KYU A;  4AYC B;  3RPG B;  2MIQ A;  1WEN A;  1X4U A;  3U5N A;  3PHD A;  2I50 A;  4YAT A;  2XP0 A;  3L1Z B;  3MHH A;  1WEU A;  2YHO A;  4MVT A;  1X4I A;  4FO9 A;  4YC9 A;  3ZPV E;  5SVX A;  3N9O A;  2PUY A;  2DJA A;  3LVR E;  2L43 A;  4O64 A;  1VD4 A;  4YBM A;  5EYA F;  4CA1 A;  4LJN A;  4PTB A;  2JMI A;  3FEH A;  3KDE C;  3L1X A;  2G45 A;  2LGG A;  4ZUX U;  2RR4 A;  2YU4 A;  4YBS A;  1VYX A;  5JG6 A;  2D8S A;  3I2D A;  2KR4 A;  2M85 A;  2LN0 A;  3LDY A;  4Z0R A;  3O7A A;  2KWN A;  3O34 A;  4PPE A;  1T1H A;  4V3L C;  4F1P A;  1WGM A;  2E6R A;  5KH9 A;  4FK5 A;  5B78 A;  3LRQ A;  3ZNI A;  2AN6 A;  2YW8 A;  4YAX A;  4R8P K;  2CRW A;  2YT5 A;  4GB0 A;  2Y1M A;  2YQL A;  3O33 A;  4C9Z A;  4QQ4 A;  2L75 A;  1MBM A;  2MD7 B;  2MD8 C;  1WEQ A;  1JM7 B;  4MSX A;  3ZVZ B;  2D8U A;  2JRJ A;  1WEM A;  3VK6 A;  2MA5 A;  3DQV R;  4XI1 A;  1BOR A;  1E4U A;  1MM2 A;  5KH3 A;  2YQM A;  3C5K A;  1Z2Q A;  3MDB C;  2F6J A;  2KRE A;  2KIZ A;  3SOW A;  2VPB A;  4Z0O A;  2LV9 A;  4N4F A;  4TKP B;  3O37 A;  2LDR A;  2C2V S;  2KGG A; 
#chains in the Genus database with same CATH homology
 3FEH A;  4F1P A;  3KDE C;  2JUN A;  2EXU A;  2XOY A;  4OGC A;  2D8U A;  2CSV A;  3LJU X;  2OWA A;  4OGE A;  2XP0 A;  2RR4 A;  2FD4 A;  3FJU B;  2CON A;  3Q1D A;  3JUE A;  2KKY A;  4H9D A;  2B0O E;  3H7H A;  2JM3 A;  2CRR A;  3LVQ E;  2XOC A;  3SUB A;  3M7K A;  2M13 A;  2LAU A;  3MDB C;  2L7P A;  5SVI A;  2EGM A;  5K3Q A;  3FM8 C;  3E2D A;  2CRW A;  2IQJ A;  3LDY A;  3PLW A;  2YRE A;  4Z0O A;  4Z0R A;  1DCQ A;  2P57 A;  2YVR A;  2KKX A;  5SVX A;  2DJA A;  3LVR E;  4QQ4 A;  2FFW A;  3T9K A;  5SVI B;  3O47 A;  2E61 A;  3DDT A;  2XOZ A;  3DWD A;  4O62 A;  2MKE A;  5SVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...