3M7KA

Crystal structure of paci-dna enzyme product complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords restriction endonuclease PacI
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
source organism Pseudomonas alcaligenes
molecule tags Hydrolase/dna
total genus 46
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3m7kA00
3LDYA 3M7KA
chains in the Genus database with same CATH superfamily
2VJEA 3ZPV1 4Q6FA 3SOWA 2XP0A 4I7DA 2M6MA 2JM3A 2YYRA 5H1UA 2LXPC 5FB1A 4AVXA 4P5OB 1WEEA 4NN2A 2K1JA 2QJ0A 3FAOA 2L75A 5D1MB 1VD4A 2K4DA 4V3KC 3ZTGA 2XOCA 5SVIA 4FIPA 3SOUA 3HCSA 5AITA 2MA5A 2YUCA 3N9MA 2VP7A 1WFKA 4BBQA 3GV4A 1FP0A 3FM8C 2KWKA 2L43A 3C6WA 1IYMA 2VPEA 4WZ3B 1WEQA 4R8PK 2CSVA 2CRWA 5TRBA 3ZVYA 5FERA 5TDRA 2VPBA 3LQJA 5AIUA 1E4UA 4X3GA 2PUYA 2K16A 2ECGA 5B76A 5EYAF 3FJUB 2KGIA 2VNFA 2ZETC 4TKPB 4OGCA 1MBMA 3JUEA 4YBTA 5SVYA 2L5UA 4O64A 2YQMA 2PNXA 4GNEA 4LADB 5LKTA 2G6QA 2YURA 4FK5A 2FUIA 4LJNA 5FEYA 3QZVA 2Y1MA 5LKXA 2LGGA 2CT2A 2MIQA 3E2DA 5I3LA 4S3OB 2XOYA 4PPEA 4ZUXU 2F6JA 4GNGA 1WIMA 1G25A 3LVRE 4YATA 2E6SA 5G04B 2RSDA 3FANA 2YQLA 3DQVR 5G05B 2JRJA 2EODA 3DPLR 4AYCB 4N4FA 2KYUA 2JMIA 5LKZA 4CCGX 2QIZA 2EXUA 2HDPA 2YHNA 3FL2A 4GNFA 5LCWB 3MHHA 3LQHA 2KFTA 1HYJA 2BAYA 4B86C 3M7KA 2LV9A 2FFWA 3LDYA 1X4IA 4V3LC 3M63A 3O33A 2YSJA 4I7BA 4QQ4A 3ZNIA 2M3HA 3N9NA 2VPDA 5SVXA 2C2LA 1WEWA 3L1ZB 2CRRA 2ECJA 3LQIA 4Z0RA 2K17A 5H1TA 2M13A 4AP4A 4QF3A 5B8DA 2CSZA 3DWDA 1LDJB 5LKUA 4AYCA 3SOXA 2E61A 1WEVA 4ZQLA 2G43A 5B77A 2KKXA 3VK6A 3U5MA 4MSXA 2ECVA 2MD8C 1WEUA 3N9LA 1JOCA 2FSAA 4LK9A 2B0OE 2P57A 4YC9A 3T9KA 5KH9A 2Y1NA 2KREA 3ASLA 3RTRB 4S3OC 2NAAA 2D8UA 1MM2A 2LDRA 4H9DA 2OXQC 1VFYA 4R2YA 1XWHA 5C13A 2YVRA 1DVPA 5H1VA 5TABA 3PLWA 3HCTA 3PHDA 2AN6A 4IC3A 5JG6A 2F42A 3L1XA 2CSYA 2LN0A 4QF2A 5B75A 2MNYA 4FJCA 4N3WA 4UP0A 1HYIA 1WGMA 4LLBA 1CHCA 5FB0A 4UI9B 3N9QA 4WA6A 3LJUX 1F62A 5TDWA 1ZBDB 2EA6A 2JMDA 2LAUA 2MT5A 2YW8A 1MM3A 1WE9A 4OGEA 2OWAA 1LDKC 5J3XA 2RI7A 3U5OA 3MHSA 2KR4A 3N9OA 3HCUA 5KH3A 2UZGA 2ECNA 5DINA 3SUBA 1WENA 2M85A 3ZPVE 2JUNA 2F6NA 3O36A 2I50A 2LGVA 4A4BA 3M62A 2CKLB 2G45A 2QICA 2IDAA 2DX8A 1DCQA 2L7PA 3FEHA 3MDBC 2KGGA 5K3QA 4YBMA 2DSMA 3ZYQA 3SHBA 3KV5A 2HYED 3Q1DA 2LRIC 2LGKA 3O37A 1U6GB 3L11A 4UP5A 3M99A 5DKAA 4I7CA 1RMDA 2MA6A 2VJFA 2L80A 3T6RA 2FD4A 3KV6A 2MD7B 3V43A 2RR4A 1WEMA 3O35A 1X4JA 3RPGB 4FO9A 4WZ0A 2ECTA 4GB0A 1V87A 4R7EA 2DJAA 2D8SA 4L58A 1WILA 3EB5A 2CKLA 2Y43A 2XB1A 2VPGA 4A49A 3NG2A 3N9PA 4WZ2A 3LVQE 2YHOA 3T7LA 1Z2QA 4LKAA 4MVTA 2H0DA 2KKYA 2MNZA 3ZVZB 3O70A 4PTBA 4F1PA 3EB6A 4A0CD 4YABA 1FBVA 2CONA 3IHPA 1N87A 2LQ6A 1JM7B 1BORA 2JMJA 3HTKC 1WEOA 4XI1A 4IC2A 2YT5A 4A4CA 3GL6A 5C11A 1WEPA 3I2DA 5D1KB 5TBNA 4O62A 2VJFB 2VJEB 3LRQA 3H7HA 3DDTA 2LGLA 3PUQA 2KWOA 3KQIA 4CA1A 2KIZA 1K2FA 2XEUA 3KNVA 3C5KA 3U5NA 3O47A 4B7YC 1X4UA 2MKEA 4ZDTA 2YREA 3U5PA 4L7XA 4GNDA 4C9ZA 2IQJA 5G0FA 2KU3A 5B79A 1Z60A 3KDEC 2XOZA 2M1RA 2MUMA 3PURA 4YAXA 5KH7A 4BHWA 2E6RA 5SVIB 1WESA 3RPGC 1JM7A 3O7AA 1Z6UA 2LXHC 4YADA 2H0DB 2KWNA 5H9MA 2ECIA 2FUUA 4F52B 5D1LB 5B78A 2YU4A 4Z0OA 2KWJA 2KE1A 2C2VS 2L0BA 2EGMA 4W4UA 4AUQB 2EGPA 1T1HA 3O34A 2YSMA 2ECWA 1VYXA 4YBSA
chains in the Genus database with same CATH topology
4OGEA 2OWAA 2CRWA 2P57A 3H7HA 2CRRA 2FD4A 2XOCA 1DCQA 2L7PA 4Z0RA 3T9KA 3DDTA 5SVIA 3FEHA 3MDBC 2M13A 2XP0A 2D8UA 2JM3A 3LVQE 5K3QA 3DWDA 2RR4A 3M7KA 2FFWA 4H9DA 3LDYA 3O47A 3SUBA 2E61A 2KKYA 3Q1DA 3E2DA 4Z0OA 2MKEA 3FM8C 2YREA 2JUNA 3LJUX 3FJUB 4O62A 2EGMA 2EXUA 2KKXA 4F1PA 2XOYA 2YVRA 4QQ4A 2IQJA 2DJAA 2LAUA 4OGCA 3JUEA 3KDEC 3PLWA 5SVYA 2XOZA 2CONA 5SVXA 2CSVA 3LVRE 2B0OE 5SVIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDY A;  3M7K A; 
#chains in the Genus database with same CATH topology
 2VJE A;  3ZPV 1;  4Q6F A;  3SOW A;  2XP0 A;  4I7D A;  2M6M A;  2JM3 A;  2YYR A;  5H1U A;  2LXP C;  5FB1 A;  4AVX A;  4P5O B;  1WEE A;  4NN2 A;  2K1J A;  2QJ0 A;  3FAO A;  2L75 A;  5D1M B;  1VD4 A;  2K4D A;  4V3K C;  3ZTG A;  2XOC A;  5SVI A;  4FIP A;  3SOU A;  3HCS A;  5AIT A;  2MA5 A;  2YUC A;  3N9M A;  2VP7 A;  1WFK A;  4BBQ A;  3GV4 A;  1FP0 A;  3FM8 C;  2KWK A;  2L43 A;  3C6W A;  1IYM A;  2VPE A;  4WZ3 B;  1WEQ A;  4R8P K;  2CSV A;  2CRW A;  5TRB A;  3ZVY A;  5FER A;  5TDR A;  2VPB A;  3LQJ A;  5AIU A;  1E4U A;  4X3G A;  2PUY A;  2K16 A;  2ECG A;  5B76 A;  5EYA F;  3FJU B;  2KGI A;  2VNF A;  2ZET C;  4TKP B;  4OGC A;  1MBM A;  3JUE A;  4YBT A;  5SVY A;  2L5U A;  4O64 A;  2YQM A;  2PNX A;  4GNE A;  4LAD B;  5LKT A;  2G6Q A;  2YUR A;  4FK5 A;  2FUI A;  4LJN A;  5FEY A;  3QZV A;  2Y1M A;  5LKX A;  2LGG A;  2CT2 A;  2MIQ A;  3E2D A;  5I3L A;  4S3O B;  2XOY A;  4PPE A;  4ZUX U;  2F6J A;  4GNG A;  1WIM A;  1G25 A;  3LVR E;  4YAT A;  2E6S A;  5G04 B;  2RSD A;  3FAN A;  2YQL A;  3DQV R;  5G05 B;  2JRJ A;  2EOD A;  3DPL R;  4AYC B;  4N4F A;  2KYU A;  2JMI A;  5LKZ A;  4CCG X;  2QIZ A;  2EXU A;  2HDP A;  2YHN A;  3FL2 A;  4GNF A;  5LCW B;  3MHH A;  3LQH A;  2KFT A;  1HYJ A;  2BAY A;  4B86 C;  3M7K A;  2LV9 A;  2FFW A;  3LDY A;  1X4I A;  4V3L C;  3M63 A;  3O33 A;  2YSJ A;  4I7B A;  4QQ4 A;  3ZNI A;  2M3H A;  3N9N A;  2VPD A;  5SVX A;  2C2L A;  1WEW A;  3L1Z B;  2CRR A;  2ECJ A;  3LQI A;  4Z0R A;  2K17 A;  5H1T A;  2M13 A;  4AP4 A;  4QF3 A;  5B8D A;  2CSZ A;  3DWD A;  1LDJ B;  5LKU A;  4AYC A;  3SOX A;  2E61 A;  1WEV A;  4ZQL A;  2G43 A;  5B77 A;  2KKX A;  3VK6 A;  3U5M A;  4MSX A;  2ECV A;  2MD8 C;  1WEU A;  3N9L A;  1JOC A;  2FSA A;  4LK9 A;  2B0O E;  2P57 A;  4YC9 A;  3T9K A;  5KH9 A;  2Y1N A;  2KRE A;  3ASL A;  3RTR B;  4S3O C;  2NAA A;  2D8U A;  1MM2 A;  2LDR A;  4H9D A;  2OXQ C;  1VFY A;  4R2Y A;  1XWH A;  5C13 A;  2YVR A;  1DVP A;  5H1V A;  5TAB A;  3PLW A;  3HCT A;  3PHD A;  2AN6 A;  4IC3 A;  5JG6 A;  2F42 A;  3L1X A;  2CSY A;  2LN0 A;  4QF2 A;  5B75 A;  2MNY A;  4FJC A;  4N3W A;  4UP0 A;  1HYI A;  1WGM A;  4LLB A;  1CHC A;  5FB0 A;  4UI9 B;  3N9Q A;  4WA6 A;  3LJU X;  1F62 A;  5TDW A;  1ZBD B;  2EA6 A;  2JMD A;  2LAU A;  2MT5 A;  2YW8 A;  1MM3 A;  1WE9 A;  4OGE A;  2OWA A;  1LDK C;  5J3X A;  2RI7 A;  3U5O A;  3MHS A;  2KR4 A;  3N9O A;  3HCU A;  5KH3 A;  2UZG A;  2ECN A;  5DIN A;  3SUB A;  1WEN A;  2M85 A;  3ZPV E;  2JUN A;  2F6N A;  3O36 A;  2I50 A;  2LGV A;  4A4B A;  3M62 A;  2CKL B;  2G45 A;  2QIC A;  2IDA A;  2DX8 A;  1DCQ A;  2L7P A;  3FEH A;  3MDB C;  2KGG A;  5K3Q A;  4YBM A;  2DSM A;  3ZYQ A;  3SHB A;  3KV5 A;  2HYE D;  3Q1D A;  2LRI C;  2LGK A;  3O37 A;  1U6G B;  3L11 A;  4UP5 A;  3M99 A;  5DKA A;  4I7C A;  1RMD A;  2MA6 A;  2VJF A;  2L80 A;  3T6R A;  2FD4 A;  3KV6 A;  2MD7 B;  3V43 A;  2RR4 A;  1WEM A;  3O35 A;  1X4J A;  3RPG B;  4FO9 A;  4WZ0 A;  2ECT A;  4GB0 A;  1V87 A;  4R7E A;  2DJA A;  2D8S A;  4L58 A;  1WIL A;  3EB5 A;  2CKL A;  2Y43 A;  2XB1 A;  2VPG A;  4A49 A;  3NG2 A;  3N9P A;  4WZ2 A;  3LVQ E;  2YHO A;  3T7L A;  1Z2Q A;  4LKA A;  4MVT A;  2H0D A;  2KKY A;  2MNZ A;  3ZVZ B;  3O70 A;  4PTB A;  4F1P A;  3EB6 A;  4A0C D;  4YAB A;  1FBV A;  2CON A;  3IHP A;  1N87 A;  2LQ6 A;  1JM7 B;  1BOR A;  2JMJ A;  3HTK C;  1WEO A;  4XI1 A;  4IC2 A;  2YT5 A;  4A4C A;  3GL6 A;  5C11 A;  1WEP A;  3I2D A;  5D1K B;  5TBN A;  4O62 A;  2VJF B;  2VJE B;  3LRQ A;  3H7H A;  3DDT A;  2LGL A;  3PUQ A;  2KWO A;  3KQI A;  4CA1 A;  2KIZ A;  1K2F A;  2XEU A;  3KNV A;  3C5K A;  3U5N A;  3O47 A;  4B7Y C;  1X4U A;  2MKE A;  4ZDT A;  2YRE A;  3U5P A;  4L7X A;  4GND A;  4C9Z A;  2IQJ A;  5G0F A;  2KU3 A;  5B79 A;  1Z60 A;  3KDE C;  2XOZ A;  2M1R A;  2MUM A;  3PUR A;  4YAX A;  5KH7 A;  4BHW A;  2E6R A;  5SVI B;  1WES A;  3RPG C;  1JM7 A;  3O7A A;  1Z6U A;  2LXH C;  4YAD A;  2H0D B;  2KWN A;  5H9M A;  2ECI A;  2FUU A;  4F52 B;  5D1L B;  5B78 A;  2YU4 A;  4Z0O A;  2KWJ A;  2KE1 A;  2C2V S;  2L0B A;  2EGM A;  4W4U A;  4AUQ B;  2EGP A;  1T1H A;  3O34 A;  2YSM A;  2ECW A;  1VYX A;  4YBS A; 
#chains in the Genus database with same CATH homology
 4OGE A;  2OWA A;  2CRW A;  2P57 A;  3H7H A;  2CRR A;  2FD4 A;  2XOC A;  1DCQ A;  2L7P A;  4Z0R A;  3T9K A;  3DDT A;  5SVI A;  3FEH A;  3MDB C;  2M13 A;  2XP0 A;  2D8U A;  2JM3 A;  3LVQ E;  5K3Q A;  3DWD A;  2RR4 A;  3M7K A;  2FFW A;  4H9D A;  3LDY A;  3O47 A;  3SUB A;  2E61 A;  2KKY A;  3Q1D A;  3E2D A;  4Z0O A;  2MKE A;  3FM8 C;  2YRE A;  2JUN A;  3LJU X;  3FJU B;  4O62 A;  2EGM A;  2EXU A;  2KKX A;  4F1P A;  2XOY A;  2YVR A;  4QQ4 A;  2IQJ A;  2DJA A;  2LAU A;  4OGC A;  3JUE A;  3KDE C;  3PLW A;  5SVY A;  2XOZ A;  2CON A;  5SVX A;  2CSV A;  3LVR E;  2B0O E;  5SVI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...