2VPDA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
VYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpdA00
1X4IA 1WIMA 4B86C 2LN0A 2M85A 1VYXA 3O33A 2M1RA 2F6NA 2MD8C 5EYAF 2YHOA 1FBVA 2KREA 2YSJA 4ZQLA 2EODA 2L75A 3T6RA 1U6GB 4YBSA 2MNZA 3LRQA 1WILA 5G04B 4V3KC 5AITA 2VPEA 5B75A 2KU3A 4R7EA 5H1TA 2YSMA 2H0DA 2QIZA 1WEEA 2BAYA 1WFKA 2VJEA 3HCTA 5B8DA 3O37A 2JMIA 4R2YA 5H1VA 5B77A 2LXHC 2Y1NA 2YUCA 1WEUA 2HYED 4FJCA 2L80A 4V3LC 4I7CA 2FUUA 4ZDTA 1V87A 5LKTA 1FP0A 3M99A 2VPGA 4MVTA 1WEWA 2CSYA 3KNVA 4AP4A 2ECNA 1HYJA 2YURA 1WEPA 4I7BA 2CKLA 1T1HA 4YC9A 3LQHA 4Q6FA 1WGMA 3U5NA 5TABA 3N9QA 2KE1A 2CSZA 1WEQA 1IYMA 3GL6A 1LDJB 4A4BA 2LGVA 2G45A 2YHNA 2H0DB 4WZ2A 2VPBA 5KH9A 2VJEB 4LLBA 3C5KA 3ZNIA 4X3GA 4A4CA 5C11A 4R8PK 2Y43A 4UP0A 3MHSA 1F62A 4A49A 2VP7A 2ZETC 2VPDA 2NAAA 2KFTA 3N9NA 4FK5A 1WEVA 2ECVA 3N9PA 2MNYA 4IC3A 5D1LB 5TBNA 3I2DA 2YT5A 2I50A 1XWHA 3MHHA 2LGGA 4F52B 2ECGA 5G05B 4AYCA 4PTBA 4B7YC 2XEUA 3L1ZB 3C6WA 5J3XA 2M3HA 4WZ0A 2ECJA 3RPGC 4YBTA 2ECIA 2LV9A 2XB1A 4YATA 2Y1MA 4BBQA 2KWJA 2DX8A 2RI7A 2MA6A 4LKAA 5TRBA 3ASLA 1X4UA 3L11A 3ZVYA 1N87A 4S3OC 2C2VS 3RTRB 2E6SA 5DINA 2F6JA 2YQLA 2LDRA 4LADB 4C9ZA 2KYUA 4UP5A 5D1KB 1MM3A 5TDWA 4W4UA 4AYCB 1HYIA 1WEOA 4MSXA 5C13A 2D8SA 5I3LA 3O35A 5FERA 4I7DA 4WA6A 2LXPC 1K2FA 2MUMA 3LQIA 5AIUA 2F42A 3VK6A 4GNEA 2PNXA 2L5UA 2AN6A 4L58A 2KWNA 3SOWA 3SHBA 4BHWA 3HTKC 2JMDA 3U5PA 2LGKA 3M63A 2KWOA 4GNFA 1LDKC 3V43A 2K4DA 1WENA 2JMJA 4GNDA 3N9MA 3RPGB 1BORA 5LKUA 3N9LA 2MD7B 4FIPA 2PUYA 2VJFA 1JM7A 4GB0A 2G43A 1DVPA 3SOUA 5H9MA 2YQMA 1Z6UA 4A0CD 4FO9A 1WE9A 3SOXA 4PPEA 2ECTA 3HCUA 2CT2A 3QZVA 2CKLB 3O36A 2KR4A 3L1XA 3PUQA 3ZVZB 4CA1A 3O7AA 2L0BA 2G6QA 2IDAA 4L7XA 4XI1A 3KV5A 3IHPA 2KGIA 3U5OA 2YYRA 2E6RA 5LCWB 2VJFB 1VD4A 1JM7B 3U5MA 1JOCA 2L43A 4N4FA 1E4UA 2C2LA 2FUIA 2RSDA 1VFYA 2YW8A 3HCSA 3PHDA 1WEMA 3NG2A 2EA6A 2KGGA 3KV6A 3KQIA 3T7LA 1X4JA 3PURA 5FEYA 3O34A 1WESA 3GV4A 3M62A 4ZUXU 5B79A 3O70A 3LQJA 2MT5A 5KH7A 4CCGX 4UI9B 3N9OA 3ZYQA 4LJNA 5LKXA 4LK9A 5KH3A 1MM2A 5H1UA 2OXQC 3DPLR 4N3WA 2M6MA 3EB6A 3ZPV1 4WZ3B 3EB5A 2UZGA 1Z60A 2LGLA 5TDRA 2MIQA 5G0FA 1Z2QA 4TKPB 2MA5A 2JRJA 1RMDA 2QJ0A 2EGPA 4YABA 2YU4A 5D1MB 4YBMA 1ZBDB 3ZTGA 4NN2A 3ZPVE 2QICA 2K16A 2LRIC 3FL2A 4GNGA 2YREA 5FB0A 4QF3A 2KIZA 4YADA 4S3OB 2K1JA 1G25A 5JG6A 5FB1A 4IC2A 2FSAA 2LQ6A 2KWKA 4AVXA 2K17A 5DKAA 5B76A 5LKZA 3DQVR 4QF2A 1CHCA 2VNFA 4O64A 4P5OB 4AUQB 2HDPA 2ECWA 5B78A 4YAXA
chains in the Genus database with same CATH superfamily
1X4IA 2M13A 1WIMA 4B86C 2LN0A 2M85A 1VYXA 3O33A 2M1RA 3M7KA 2F6NA 2MD8C 5EYAF 2YHOA 1FBVA 2KREA 2YSJA 4ZQLA 2EODA 2L75A 3T6RA 1MBMA 1U6GB 4YBSA 2MNZA 5SVXA 3LRQA 1WILA 5G04B 4V3KC 5SVIA 5AITA 4Z0OA 2VPEA 5B75A 2KU3A 4R7EA 5H1TA 2YSMA 2H0DA 2QIZA 2CONA 1WEEA 2BAYA 1WFKA 2VJEA 3HCTA 5B8DA 3O37A 2JMIA 4R2YA 5H1VA 5B77A 2LXHC 2Y1NA 2YUCA 1WEUA 2HYED 3O47A 4FJCA 2L80A 4V3LC 4I7CA 3MDBC 2FUUA 4ZDTA 1V87A 5LKTA 1FP0A 3M99A 2VPGA 4MVTA 1WEWA 2CSYA 3KNVA 4AP4A 2ECNA 1HYJA 2YURA 2YVRA 1WEPA 4I7BA 2DSMA 2CKLA 1T1HA 4YC9A 3LQHA 4Q6FA 1WGMA 5SVIB 3U5NA 5TABA 3N9QA 2KE1A 2CSZA 1WEQA 1IYMA 3GL6A 4H9DA 1LDJB 4A4BA 2LGVA 2G45A 2YHNA 2H0DB 4WZ2A 2VPBA 5KH9A 2VJEB 4LLBA 3C5KA 3ZNIA 4X3GA 4A4CA 5C11A 4R8PK 2Y43A 4UP0A 3MHSA 1F62A 2CRRA 4A49A 2VP7A 3E2DA 2ZETC 2VPDA 2NAAA 2KFTA 3N9NA 4FK5A 1WEVA 2ECVA 2RR4A 2LAUA 3N9PA 2MNYA 2JUNA 3FEHA 4IC3A 3LJUX 5D1LB 5TBNA 2IQJA 3I2DA 2YT5A 2XP0A 2I50A 1XWHA 3MHHA 2LGGA 4F52B 2ECGA 5G05B 4AYCA 2XOCA 4PTBA 4B7YC 2EXUA 2XEUA 3L1ZB 3C6WA 5J3XA 2M3HA 2MKEA 4WZ0A 2ECJA 3DDTA 2P57A 3RPGC 4YBTA 2ECIA 2LV9A 2XB1A 4YATA 2Y1MA 4BBQA 2KWJA 2DX8A 2RI7A 2MA6A 4LKAA 3ASLA 5TRBA 1X4UA 4F1PA 3L11A 3ZVYA 1N87A 4S3OC 4Z0RA 2C2VS 3RTRB 2E6SA 5DINA 2F6JA 2YQLA 2LDRA 4LADB 4C9ZA 2KYUA 4UP5A 5D1KB 1MM3A 5TDWA 4W4UA 4AYCB 1HYIA 1WEOA 4MSXA 5C13A 2D8SA 4OGEA 5I3LA 2JM3A 3O35A 5FERA 4I7DA 4WA6A 2LXPC 1K2FA 1DCQA 2MUMA 3LQIA 5AIUA 3T9KA 2F42A 3VK6A 4GNEA 2PNXA 2L5UA 2AN6A 4L58A 2KWNA 2KKYA 3SOWA 3SHBA 4BHWA 3HTKC 3PLWA 3H7HA 2JMDA 2EGMA 2LGKA 2CSVA 3U5PA 3M63A 2KWOA 4GNFA 1LDKC 3V43A 2K4DA 1WENA 2JMJA 4GNDA 3FAOA 3N9MA 5K3QA 2L7PA 3RPGB 1BORA 5LKUA 3N9LA 2MD7B 4FIPA 2PUYA 2VJFA 1JM7A 4GB0A 2G43A 1DVPA 3SOUA 5H9MA 2YQMA 1Z6UA 4A0CD 3DWDA 4FO9A 1WE9A 2CRWA 3KDEC 3SOXA 4PPEA 2ECTA 2FD4A 3HCUA 2CT2A 3QZVA 3SUBA 2CKLB 3O36A 2KR4A 3L1XA 3PUQA 2KKXA 3ZVZB 4CA1A 3O7AA 2E61A 4O62A 2L0BA 2G6QA 2IDAA 4L7XA 4XI1A 3KV5A 3FANA 3IHPA 2D8UA 2KGIA 3U5OA 2YYRA 3LDYA 2E6RA 5LCWB 2VJFB 1VD4A 1JM7B 3U5MA 1JOCA 2L43A 4N4FA 1E4UA 2C2LA 2FUIA 2RSDA 1VFYA 2YW8A 3HCSA 3PHDA 1WEMA 3NG2A 2EA6A 2OWAA 2KGGA 3KV6A 3KQIA 3T7LA 1X4JA 3PURA 5FEYA 3O34A 1WESA 3GV4A 3M62A 4QQ4A 4ZUXU 5B79A 3O70A 3LQJA 3JUEA 2MT5A 5KH7A 4CCGX 4UI9B 3N9OA 3ZYQA 4LJNA 5LKXA 4LK9A 5KH3A 1MM2A 5H1UA 2OXQC 3DPLR 4N3WA 2M6MA 3EB6A 3LVRE 5SVYA 3ZPV1 4WZ3B 3EB5A 2UZGA 1Z60A 2LGLA 5TDRA 2MIQA 5G0FA 1Z2QA 4TKPB 2MA5A 2JRJA 1RMDA 2QJ0A 2EGPA 4YABA 2YU4A 5D1MB 4YBMA 1ZBDB 3ZTGA 4NN2A 3LVQE 2DJAA 2XOZA 3ZPVE 2QICA 2K16A 2LRIC 3FL2A 4GNGA 2YREA 5FB0A 4QF3A 2KIZA 4YADA 4S3OB 2K1JA 1G25A 2B0OE 5JG6A 5FB1A 4IC2A 2FSAA 2FFWA 2LQ6A 2KWKA 4AVXA 2K17A 5DKAA 5B76A 5LKZA 3DQVR 3FM8C 4QF2A 1CHCA 2VNFA 4O64A 3FJUB 4P5OB 4OGCA 4AUQB 2HDPA 2XOYA 2ECWA 3Q1DA 5B78A 4YAXA
chains in the Genus database with same CATH topology
1X4IA 1WIMA 4B86C 2LN0A 2M85A 1VYXA 3O33A 2M1RA 2F6NA 2MD8C 5EYAF 2YHOA 1FBVA 2KREA 2YSJA 4ZQLA 2EODA 2L75A 3T6RA 1U6GB 4YBSA 2MNZA 3LRQA 1WILA 5G04B 4V3KC 5AITA 2VPEA 5B75A 2KU3A 4R7EA 5H1TA 2YSMA 2H0DA 2QIZA 1WEEA 2BAYA 1WFKA 2VJEA 3HCTA 5B8DA 3O37A 2JMIA 4R2YA 5H1VA 5B77A 2LXHC 2Y1NA 2YUCA 1WEUA 2HYED 4FJCA 2L80A 4V3LC 4I7CA 2FUUA 4ZDTA 1V87A 5LKTA 1FP0A 3M99A 2VPGA 4MVTA 1WEWA 2CSYA 3KNVA 4AP4A 2ECNA 1HYJA 2YURA 1WEPA 4I7BA 2CKLA 1T1HA 4YC9A 3LQHA 4Q6FA 1WGMA 3U5NA 5TABA 3N9QA 2KE1A 2CSZA 1WEQA 1IYMA 3GL6A 1LDJB 4A4BA 2LGVA 2G45A 2YHNA 2H0DB 4WZ2A 2VPBA 5KH9A 2VJEB 4LLBA 3C5KA 3ZNIA 4X3GA 4A4CA 5C11A 4R8PK 2Y43A 4UP0A 3MHSA 1F62A 4A49A 2VP7A 2ZETC 2VPDA 2NAAA 2KFTA 3N9NA 4FK5A 1WEVA 2ECVA 3N9PA 2MNYA 4IC3A 5D1LB 5TBNA 3I2DA 2YT5A 2I50A 1XWHA 3MHHA 2LGGA 4F52B 2ECGA 5G05B 4AYCA 4PTBA 4B7YC 2XEUA 3L1ZB 3C6WA 5J3XA 2M3HA 4WZ0A 2ECJA 3RPGC 4YBTA 2ECIA 2LV9A 2XB1A 4YATA 2Y1MA 4BBQA 2KWJA 2DX8A 2RI7A 2MA6A 4LKAA 5TRBA 3ASLA 1X4UA 3L11A 3ZVYA 1N87A 4S3OC 2C2VS 3RTRB 2E6SA 5DINA 2F6JA 2YQLA 2LDRA 4LADB 4C9ZA 2KYUA 4UP5A 5D1KB 1MM3A 5TDWA 4W4UA 4AYCB 1HYIA 1WEOA 4MSXA 5C13A 2D8SA 5I3LA 3O35A 5FERA 4I7DA 4WA6A 2LXPC 1K2FA 2MUMA 3LQIA 5AIUA 2F42A 3VK6A 4GNEA 2PNXA 2L5UA 2AN6A 4L58A 2KWNA 3SOWA 3SHBA 4BHWA 3HTKC 2JMDA 3U5PA 2LGKA 3M63A 2KWOA 4GNFA 1LDKC 3V43A 2K4DA 1WENA 2JMJA 4GNDA 3N9MA 3RPGB 1BORA 5LKUA 3N9LA 2MD7B 4FIPA 2PUYA 2VJFA 1JM7A 4GB0A 2G43A 1DVPA 3SOUA 5H9MA 2YQMA 1Z6UA 4A0CD 4FO9A 1WE9A 3SOXA 4PPEA 2ECTA 3HCUA 2CT2A 3QZVA 2CKLB 3O36A 2KR4A 3L1XA 3PUQA 3ZVZB 4CA1A 3O7AA 2L0BA 2G6QA 2IDAA 4L7XA 4XI1A 3KV5A 3IHPA 2KGIA 3U5OA 2YYRA 2E6RA 5LCWB 2VJFB 1VD4A 1JM7B 3U5MA 1JOCA 2L43A 4N4FA 1E4UA 2C2LA 2FUIA 2RSDA 1VFYA 2YW8A 3HCSA 3PHDA 1WEMA 3NG2A 2EA6A 2KGGA 3KV6A 3KQIA 3T7LA 1X4JA 3PURA 5FEYA 3O34A 1WESA 3GV4A 3M62A 4ZUXU 5B79A 3O70A 3LQJA 2MT5A 5KH7A 4CCGX 4UI9B 3N9OA 3ZYQA 4LJNA 5LKXA 4LK9A 5KH3A 1MM2A 5H1UA 2OXQC 3DPLR 4N3WA 2M6MA 3EB6A 3ZPV1 4WZ3B 3EB5A 2UZGA 1Z60A 2LGLA 5TDRA 2MIQA 5G0FA 1Z2QA 4TKPB 2MA5A 2JRJA 1RMDA 2QJ0A 2EGPA 4YABA 2YU4A 5D1MB 4YBMA 1ZBDB 3ZTGA 4NN2A 3ZPVE 2QICA 2K16A 2LRIC 3FL2A 4GNGA 2YREA 5FB0A 4QF3A 2KIZA 4YADA 4S3OB 2K1JA 1G25A 5JG6A 5FB1A 4IC2A 2FSAA 2LQ6A 2KWKA 4AVXA 2K17A 5DKAA 5B76A 5LKZA 3DQVR 4QF2A 1CHCA 2VNFA 4O64A 4P5OB 4AUQB 2HDPA 2ECWA 5B78A 4YAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4I A;  1WIM A;  4B86 C;  2LN0 A;  2M85 A;  1VYX A;  3O33 A;  2M1R A;  2F6N A;  2MD8 C;  5EYA F;  2YHO A;  1FBV A;  2KRE A;  2YSJ A;  4ZQL A;  2EOD A;  2L75 A;  3T6R A;  1U6G B;  4YBS A;  2MNZ A;  3LRQ A;  1WIL A;  5G04 B;  4V3K C;  5AIT A;  2VPE A;  5B75 A;  2KU3 A;  4R7E A;  5H1T A;  2YSM A;  2H0D A;  2QIZ A;  1WEE A;  2BAY A;  1WFK A;  2VJE A;  3HCT A;  5B8D A;  3O37 A;  2JMI A;  4R2Y A;  5H1V A;  5B77 A;  2LXH C;  2Y1N A;  2YUC A;  1WEU A;  2HYE D;  4FJC A;  2L80 A;  4V3L C;  4I7C A;  2FUU A;  4ZDT A;  1V87 A;  5LKT A;  1FP0 A;  3M99 A;  2VPG A;  4MVT A;  1WEW A;  2CSY A;  3KNV A;  4AP4 A;  2ECN A;  1HYJ A;  2YUR A;  1WEP A;  4I7B A;  2CKL A;  1T1H A;  4YC9 A;  3LQH A;  4Q6F A;  1WGM A;  3U5N A;  5TAB A;  3N9Q A;  2KE1 A;  2CSZ A;  1WEQ A;  1IYM A;  3GL6 A;  1LDJ B;  4A4B A;  2LGV A;  2G45 A;  2YHN A;  2H0D B;  4WZ2 A;  2VPB A;  5KH9 A;  2VJE B;  4LLB A;  3C5K A;  3ZNI A;  4X3G A;  4A4C A;  5C11 A;  4R8P K;  2Y43 A;  4UP0 A;  3MHS A;  1F62 A;  4A49 A;  2VP7 A;  2ZET C;  2VPD A;  2NAA A;  2KFT A;  3N9N A;  4FK5 A;  1WEV A;  2ECV A;  3N9P A;  2MNY A;  4IC3 A;  5D1L B;  5TBN A;  3I2D A;  2YT5 A;  2I50 A;  1XWH A;  3MHH A;  2LGG A;  4F52 B;  2ECG A;  5G05 B;  4AYC A;  4PTB A;  4B7Y C;  2XEU A;  3L1Z B;  3C6W A;  5J3X A;  2M3H A;  4WZ0 A;  2ECJ A;  3RPG C;  4YBT A;  2ECI A;  2LV9 A;  2XB1 A;  4YAT A;  2Y1M A;  4BBQ A;  2KWJ A;  2DX8 A;  2RI7 A;  2MA6 A;  4LKA A;  5TRB A;  3ASL A;  1X4U A;  3L11 A;  3ZVY A;  1N87 A;  4S3O C;  2C2V S;  3RTR B;  2E6S A;  5DIN A;  2F6J A;  2YQL A;  2LDR A;  4LAD B;  4C9Z A;  2KYU A;  4UP5 A;  5D1K B;  1MM3 A;  5TDW A;  4W4U A;  4AYC B;  1HYI A;  1WEO A;  4MSX A;  5C13 A;  2D8S A;  5I3L A;  3O35 A;  5FER A;  4I7D A;  4WA6 A;  2LXP C;  1K2F A;  2MUM A;  3LQI A;  5AIU A;  2F42 A;  3VK6 A;  4GNE A;  2PNX A;  2L5U A;  2AN6 A;  4L58 A;  2KWN A;  3SOW A;  3SHB A;  4BHW A;  3HTK C;  2JMD A;  3U5P A;  2LGK A;  3M63 A;  2KWO A;  4GNF A;  1LDK C;  3V43 A;  2K4D A;  1WEN A;  2JMJ A;  4GND A;  3N9M A;  3RPG B;  1BOR A;  5LKU A;  3N9L A;  2MD7 B;  4FIP A;  2PUY A;  2VJF A;  1JM7 A;  4GB0 A;  2G43 A;  1DVP A;  3SOU A;  5H9M A;  2YQM A;  1Z6U A;  4A0C D;  4FO9 A;  1WE9 A;  3SOX A;  4PPE A;  2ECT A;  3HCU A;  2CT2 A;  3QZV A;  2CKL B;  3O36 A;  2KR4 A;  3L1X A;  3PUQ A;  3ZVZ B;  4CA1 A;  3O7A A;  2L0B A;  2G6Q A;  2IDA A;  4L7X A;  4XI1 A;  3KV5 A;  3IHP A;  2KGI A;  3U5O A;  2YYR A;  2E6R A;  5LCW B;  2VJF B;  1VD4 A;  1JM7 B;  3U5M A;  1JOC A;  2L43 A;  4N4F A;  1E4U A;  2C2L A;  2FUI A;  2RSD A;  1VFY A;  2YW8 A;  3HCS A;  3PHD A;  1WEM A;  3NG2 A;  2EA6 A;  2KGG A;  3KV6 A;  3KQI A;  3T7L A;  1X4J A;  3PUR A;  5FEY A;  3O34 A;  1WES A;  3GV4 A;  3M62 A;  4ZUX U;  5B79 A;  3O70 A;  3LQJ A;  2MT5 A;  5KH7 A;  4CCG X;  4UI9 B;  3N9O A;  3ZYQ A;  4LJN A;  5LKX A;  4LK9 A;  5KH3 A;  1MM2 A;  5H1U A;  2OXQ C;  3DPL R;  4N3W A;  2M6M A;  3EB6 A;  3ZPV 1;  4WZ3 B;  3EB5 A;  2UZG A;  1Z60 A;  2LGL A;  5TDR A;  2MIQ A;  5G0F A;  1Z2Q A;  4TKP B;  2MA5 A;  2JRJ A;  1RMD A;  2QJ0 A;  2EGP A;  4YAB A;  2YU4 A;  5D1M B;  4YBM A;  1ZBD B;  3ZTG A;  4NN2 A;  3ZPV E;  2QIC A;  2K16 A;  2LRI C;  3FL2 A;  4GNG A;  2YRE A;  5FB0 A;  4QF3 A;  2KIZ A;  4YAD A;  4S3O B;  2K1J A;  1G25 A;  5JG6 A;  5FB1 A;  4IC2 A;  2FSA A;  2LQ6 A;  2KWK A;  4AVX A;  2K17 A;  5DKA A;  5B76 A;  5LKZ A;  3DQV R;  4QF2 A;  1CHC A;  2VNF A;  4O64 A;  4P5O B;  4AUQ B;  2HDP A;  2ECW A;  5B78 A;  4YAX A; 
#chains in the Genus database with same CATH topology
 1X4I A;  2M13 A;  1WIM A;  4B86 C;  2LN0 A;  2M85 A;  1VYX A;  3O33 A;  2M1R A;  3M7K A;  2F6N A;  2MD8 C;  5EYA F;  2YHO A;  1FBV A;  2KRE A;  2YSJ A;  4ZQL A;  2EOD A;  2L75 A;  3T6R A;  1MBM A;  1U6G B;  4YBS A;  2MNZ A;  5SVX A;  3LRQ A;  1WIL A;  5G04 B;  4V3K C;  5SVI A;  5AIT A;  4Z0O A;  2VPE A;  5B75 A;  2KU3 A;  4R7E A;  5H1T A;  2YSM A;  2H0D A;  2QIZ A;  2CON A;  1WEE A;  2BAY A;  1WFK A;  2VJE A;  3HCT A;  5B8D A;  3O37 A;  2JMI A;  4R2Y A;  5H1V A;  5B77 A;  2LXH C;  2Y1N A;  2YUC A;  1WEU A;  2HYE D;  3O47 A;  4FJC A;  2L80 A;  4V3L C;  4I7C A;  3MDB C;  2FUU A;  4ZDT A;  1V87 A;  5LKT A;  1FP0 A;  3M99 A;  2VPG A;  4MVT A;  1WEW A;  2CSY A;  3KNV A;  4AP4 A;  2ECN A;  1HYJ A;  2YUR A;  2YVR A;  1WEP A;  4I7B A;  2DSM A;  2CKL A;  1T1H A;  4YC9 A;  3LQH A;  4Q6F A;  1WGM A;  5SVI B;  3U5N A;  5TAB A;  3N9Q A;  2KE1 A;  2CSZ A;  1WEQ A;  1IYM A;  3GL6 A;  4H9D A;  1LDJ B;  4A4B A;  2LGV A;  2G45 A;  2YHN A;  2H0D B;  4WZ2 A;  2VPB A;  5KH9 A;  2VJE B;  4LLB A;  3C5K A;  3ZNI A;  4X3G A;  4A4C A;  5C11 A;  4R8P K;  2Y43 A;  4UP0 A;  3MHS A;  1F62 A;  2CRR A;  4A49 A;  2VP7 A;  3E2D A;  2ZET C;  2VPD A;  2NAA A;  2KFT A;  3N9N A;  4FK5 A;  1WEV A;  2ECV A;  2RR4 A;  2LAU A;  3N9P A;  2MNY A;  2JUN A;  3FEH A;  4IC3 A;  3LJU X;  5D1L B;  5TBN A;  2IQJ A;  3I2D A;  2YT5 A;  2XP0 A;  2I50 A;  1XWH A;  3MHH A;  2LGG A;  4F52 B;  2ECG A;  5G05 B;  4AYC A;  2XOC A;  4PTB A;  4B7Y C;  2EXU A;  2XEU A;  3L1Z B;  3C6W A;  5J3X A;  2M3H A;  2MKE A;  4WZ0 A;  2ECJ A;  3DDT A;  2P57 A;  3RPG C;  4YBT A;  2ECI A;  2LV9 A;  2XB1 A;  4YAT A;  2Y1M A;  4BBQ A;  2KWJ A;  2DX8 A;  2RI7 A;  2MA6 A;  4LKA A;  3ASL A;  5TRB A;  1X4U A;  4F1P A;  3L11 A;  3ZVY A;  1N87 A;  4S3O C;  4Z0R A;  2C2V S;  3RTR B;  2E6S A;  5DIN A;  2F6J A;  2YQL A;  2LDR A;  4LAD B;  4C9Z A;  2KYU A;  4UP5 A;  5D1K B;  1MM3 A;  5TDW A;  4W4U A;  4AYC B;  1HYI A;  1WEO A;  4MSX A;  5C13 A;  2D8S A;  4OGE A;  5I3L A;  2JM3 A;  3O35 A;  5FER A;  4I7D A;  4WA6 A;  2LXP C;  1K2F A;  1DCQ A;  2MUM A;  3LQI A;  5AIU A;  3T9K A;  2F42 A;  3VK6 A;  4GNE A;  2PNX A;  2L5U A;  2AN6 A;  4L58 A;  2KWN A;  2KKY A;  3SOW A;  3SHB A;  4BHW A;  3HTK C;  3PLW A;  3H7H A;  2JMD A;  2EGM A;  2LGK A;  2CSV A;  3U5P A;  3M63 A;  2KWO A;  4GNF A;  1LDK C;  3V43 A;  2K4D A;  1WEN A;  2JMJ A;  4GND A;  3FAO A;  3N9M A;  5K3Q A;  2L7P A;  3RPG B;  1BOR A;  5LKU A;  3N9L A;  2MD7 B;  4FIP A;  2PUY A;  2VJF A;  1JM7 A;  4GB0 A;  2G43 A;  1DVP A;  3SOU A;  5H9M A;  2YQM A;  1Z6U A;  4A0C D;  3DWD A;  4FO9 A;  1WE9 A;  2CRW A;  3KDE C;  3SOX A;  4PPE A;  2ECT A;  2FD4 A;  3HCU A;  2CT2 A;  3QZV A;  3SUB A;  2CKL B;  3O36 A;  2KR4 A;  3L1X A;  3PUQ A;  2KKX A;  3ZVZ B;  4CA1 A;  3O7A A;  2E61 A;  4O62 A;  2L0B A;  2G6Q A;  2IDA A;  4L7X A;  4XI1 A;  3KV5 A;  3FAN A;  3IHP A;  2D8U A;  2KGI A;  3U5O A;  2YYR A;  3LDY A;  2E6R A;  5LCW B;  2VJF B;  1VD4 A;  1JM7 B;  3U5M A;  1JOC A;  2L43 A;  4N4F A;  1E4U A;  2C2L A;  2FUI A;  2RSD A;  1VFY A;  2YW8 A;  3HCS A;  3PHD A;  1WEM A;  3NG2 A;  2EA6 A;  2OWA A;  2KGG A;  3KV6 A;  3KQI A;  3T7L A;  1X4J A;  3PUR A;  5FEY A;  3O34 A;  1WES A;  3GV4 A;  3M62 A;  4QQ4 A;  4ZUX U;  5B79 A;  3O70 A;  3LQJ A;  3JUE A;  2MT5 A;  5KH7 A;  4CCG X;  4UI9 B;  3N9O A;  3ZYQ A;  4LJN A;  5LKX A;  4LK9 A;  5KH3 A;  1MM2 A;  5H1U A;  2OXQ C;  3DPL R;  4N3W A;  2M6M A;  3EB6 A;  3LVR E;  5SVY A;  3ZPV 1;  4WZ3 B;  3EB5 A;  2UZG A;  1Z60 A;  2LGL A;  5TDR A;  2MIQ A;  5G0F A;  1Z2Q A;  4TKP B;  2MA5 A;  2JRJ A;  1RMD A;  2QJ0 A;  2EGP A;  4YAB A;  2YU4 A;  5D1M B;  4YBM A;  1ZBD B;  3ZTG A;  4NN2 A;  3LVQ E;  2DJA A;  2XOZ A;  3ZPV E;  2QIC A;  2K16 A;  2LRI C;  3FL2 A;  4GNG A;  2YRE A;  5FB0 A;  4QF3 A;  2KIZ A;  4YAD A;  4S3O B;  2K1J A;  1G25 A;  2B0O E;  5JG6 A;  5FB1 A;  4IC2 A;  2FSA A;  2FFW A;  2LQ6 A;  2KWK A;  4AVX A;  2K17 A;  5DKA A;  5B76 A;  5LKZ A;  3DQV R;  3FM8 C;  4QF2 A;  1CHC A;  2VNF A;  4O64 A;  3FJU B;  4P5O B;  4OGC A;  4AUQ B;  2HDP A;  2XOY A;  2ECW A;  3Q1D A;  5B78 A;  4YAX A; 
#chains in the Genus database with same CATH homology
 1X4I A;  1WIM A;  4B86 C;  2LN0 A;  2M85 A;  1VYX A;  3O33 A;  2M1R A;  2F6N A;  2MD8 C;  5EYA F;  2YHO A;  1FBV A;  2KRE A;  2YSJ A;  4ZQL A;  2EOD A;  2L75 A;  3T6R A;  1U6G B;  4YBS A;  2MNZ A;  3LRQ A;  1WIL A;  5G04 B;  4V3K C;  5AIT A;  2VPE A;  5B75 A;  2KU3 A;  4R7E A;  5H1T A;  2YSM A;  2H0D A;  2QIZ A;  1WEE A;  2BAY A;  1WFK A;  2VJE A;  3HCT A;  5B8D A;  3O37 A;  2JMI A;  4R2Y A;  5H1V A;  5B77 A;  2LXH C;  2Y1N A;  2YUC A;  1WEU A;  2HYE D;  4FJC A;  2L80 A;  4V3L C;  4I7C A;  2FUU A;  4ZDT A;  1V87 A;  5LKT A;  1FP0 A;  3M99 A;  2VPG A;  4MVT A;  1WEW A;  2CSY A;  3KNV A;  4AP4 A;  2ECN A;  1HYJ A;  2YUR A;  1WEP A;  4I7B A;  2CKL A;  1T1H A;  4YC9 A;  3LQH A;  4Q6F A;  1WGM A;  3U5N A;  5TAB A;  3N9Q A;  2KE1 A;  2CSZ A;  1WEQ A;  1IYM A;  3GL6 A;  1LDJ B;  4A4B A;  2LGV A;  2G45 A;  2YHN A;  2H0D B;  4WZ2 A;  2VPB A;  5KH9 A;  2VJE B;  4LLB A;  3C5K A;  3ZNI A;  4X3G A;  4A4C A;  5C11 A;  4R8P K;  2Y43 A;  4UP0 A;  3MHS A;  1F62 A;  4A49 A;  2VP7 A;  2ZET C;  2VPD A;  2NAA A;  2KFT A;  3N9N A;  4FK5 A;  1WEV A;  2ECV A;  3N9P A;  2MNY A;  4IC3 A;  5D1L B;  5TBN A;  3I2D A;  2YT5 A;  2I50 A;  1XWH A;  3MHH A;  2LGG A;  4F52 B;  2ECG A;  5G05 B;  4AYC A;  4PTB A;  4B7Y C;  2XEU A;  3L1Z B;  3C6W A;  5J3X A;  2M3H A;  4WZ0 A;  2ECJ A;  3RPG C;  4YBT A;  2ECI A;  2LV9 A;  2XB1 A;  4YAT A;  2Y1M A;  4BBQ A;  2KWJ A;  2DX8 A;  2RI7 A;  2MA6 A;  4LKA A;  5TRB A;  3ASL A;  1X4U A;  3L11 A;  3ZVY A;  1N87 A;  4S3O C;  2C2V S;  3RTR B;  2E6S A;  5DIN A;  2F6J A;  2YQL A;  2LDR A;  4LAD B;  4C9Z A;  2KYU A;  4UP5 A;  5D1K B;  1MM3 A;  5TDW A;  4W4U A;  4AYC B;  1HYI A;  1WEO A;  4MSX A;  5C13 A;  2D8S A;  5I3L A;  3O35 A;  5FER A;  4I7D A;  4WA6 A;  2LXP C;  1K2F A;  2MUM A;  3LQI A;  5AIU A;  2F42 A;  3VK6 A;  4GNE A;  2PNX A;  2L5U A;  2AN6 A;  4L58 A;  2KWN A;  3SOW A;  3SHB A;  4BHW A;  3HTK C;  2JMD A;  3U5P A;  2LGK A;  3M63 A;  2KWO A;  4GNF A;  1LDK C;  3V43 A;  2K4D A;  1WEN A;  2JMJ A;  4GND A;  3N9M A;  3RPG B;  1BOR A;  5LKU A;  3N9L A;  2MD7 B;  4FIP A;  2PUY A;  2VJF A;  1JM7 A;  4GB0 A;  2G43 A;  1DVP A;  3SOU A;  5H9M A;  2YQM A;  1Z6U A;  4A0C D;  4FO9 A;  1WE9 A;  3SOX A;  4PPE A;  2ECT A;  3HCU A;  2CT2 A;  3QZV A;  2CKL B;  3O36 A;  2KR4 A;  3L1X A;  3PUQ A;  3ZVZ B;  4CA1 A;  3O7A A;  2L0B A;  2G6Q A;  2IDA A;  4L7X A;  4XI1 A;  3KV5 A;  3IHP A;  2KGI A;  3U5O A;  2YYR A;  2E6R A;  5LCW B;  2VJF B;  1VD4 A;  1JM7 B;  3U5M A;  1JOC A;  2L43 A;  4N4F A;  1E4U A;  2C2L A;  2FUI A;  2RSD A;  1VFY A;  2YW8 A;  3HCS A;  3PHD A;  1WEM A;  3NG2 A;  2EA6 A;  2KGG A;  3KV6 A;  3KQI A;  3T7L A;  1X4J A;  3PUR A;  5FEY A;  3O34 A;  1WES A;  3GV4 A;  3M62 A;  4ZUX U;  5B79 A;  3O70 A;  3LQJ A;  2MT5 A;  5KH7 A;  4CCG X;  4UI9 B;  3N9O A;  3ZYQ A;  4LJN A;  5LKX A;  4LK9 A;  5KH3 A;  1MM2 A;  5H1U A;  2OXQ C;  3DPL R;  4N3W A;  2M6M A;  3EB6 A;  3ZPV 1;  4WZ3 B;  3EB5 A;  2UZG A;  1Z60 A;  2LGL A;  5TDR A;  2MIQ A;  5G0F A;  1Z2Q A;  4TKP B;  2MA5 A;  2JRJ A;  1RMD A;  2QJ0 A;  2EGP A;  4YAB A;  2YU4 A;  5D1M B;  4YBM A;  1ZBD B;  3ZTG A;  4NN2 A;  3ZPV E;  2QIC A;  2K16 A;  2LRI C;  3FL2 A;  4GNG A;  2YRE A;  5FB0 A;  4QF3 A;  2KIZ A;  4YAD A;  4S3O B;  2K1J A;  1G25 A;  5JG6 A;  5FB1 A;  4IC2 A;  2FSA A;  2LQ6 A;  2KWK A;  4AVX A;  2K17 A;  5DKA A;  5B76 A;  5LKZ A;  3DQV R;  4QF2 A;  1CHC A;  2VNF A;  4O64 A;  4P5O B;  4AUQ B;  2HDP A;  2ECW A;  5B78 A;  4YAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...