2VPDA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'VYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
molecule tags Gene regulation
source organism Homo sapiens
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
total genus 14
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpdA00
2D8SA 2YW8A 4R7EA 2F6NA 2YT5A 4I7DA 2KYUA 4PPEA 1VD4A 1WESA 3N9MA 4UI9B 3SOUA 4WZ2A 1BORA 3KV5A 4ZDTA 2G6QA 3DPLR 5C13A 1VYXA 2UZGA 3KNVA 4LJNA 2Y1NA 1CHCA 4LKAA 5DINA 2AN6A 2M3HA 4ZQLA 3O33A 4IC3A 2F6JA 3O36A 4TKPB 1LDKC 4GNGA 4YABA 2EGPA 4F52B 4V3LC 3SOWA 1Z2QA 1V87A 2ZETC 3EB6A 5KH3A 4MSXA 3HCTA 1IYMA 4V3KC 1X4JA 4ZUXU 4WZ0A 2L75A 1U6GB 3VK6A 1WEWA 1FP0A 3NG2A 1XWHA 3HCSA 4YC9A 4AUQB 4QF2A 2H0DA 4QF3A 3HTKC 5G04B 2VJFA 2YREA 3KV6A 3U5MA 2M1RA 2RSDA 2VNFA 2RI7A 2G43A 3N9LA 2F42A 5B75A 4FJCA 2EODA 1DVPA 5B77A 2CSYA 4WZ3B 3PUQA 3MHHA 1E4UA 5TBNA 4UP5A 4A4CA 1JM7B 2M6MA 3ZPV1 2MA6A 3L11A 2LQ6A 4YADA 4L7XA 5D1MB 3QZVA 4LK9A 4GNDA 3EB5A 5EYAF 3LRQA 2YURA 4I7BA 2PUYA 4WA6A 3O7AA 3M99A 4YATA 4L58A 1F62A 2LGGA 5D1KB 5G0FA 5FB1A 2K17A 2KWNA 2L0BA 1WILA 2L80A 2JMIA 5H1UA 2HDPA 2MIQA 4O64A 3M62A 3N9NA 3U5OA 1HYJA 2VPEA 4AYCA 2PNXA 3PURA 1LDJB 1X4IA 2VPDA 2VJEA 3PHDA 2LGVA 5AITA 5KH7A 2VPGA 5TABA 2KWOA 3ASLA 4AP4A 3SHBA 2Y43A 3O35A 3HCUA 1G25A 3DQVR 5H1VA 2CKLA 2I50A 3LQIA 2IDAA 1Z6UA 4W4UA 5LCWB 2K16A 2CT2A 4BBQA 1WENA 2KGGA 2EA6A 1WEMA 1VFYA 4A4BA 2E6SA 4YBSA 5LKTA 2BAYA 1MM2A 2MA5A 3O34A 4I7CA 2C2LA 3RPGB 2KIZA 2ECWA 2LDRA 4FIPA 4UP0A 1JOCA 3I2DA 2YQMA 3ZNIA 4CCGX 2LXPC 4X3GA 4CA1A 2HYED 2YYRA 2K4DA 4BHWA 3RTRB 2KE1A 3MHSA 3ZTGA 2KR4A 4FO9A 2K1JA 2YSMA 5TDWA 4R8PK 4B7YC 2JMJA 1JM7A 3M63A 4NN2A 5H1TA 2ECTA 5LKXA 5G05B 1WGMA 3FL2A 1WEUA 3C6WA 3ZPVE 1Z60A 2KWJA 2KWKA 4C9ZA 1RMDA 2MNYA 1WFKA 4N4FA 3GV4A 1X4UA 2LXHC 1ZBDB 4A49A 4YBTA 5B79A 4B86C 2MUMA 4GB0A 4GNFA 3RPGC 1WIMA 4R2YA 1MM3A 2G45A 2MNZA 1WEOA 2MT5A 3N9OA 2LGLA 4IC2A 1WEPA 2KFTA 2QIZA 4AYCB 2M85A 3IHPA 2LGKA 1N87A 3U5PA 5I3LA 2YHOA 2ECIA 1WEVA 3L1ZB 5H9MA 3N9PA 3GL6A 2VJEB 2LRIC 3T7LA 3C5KA 2VP7A 2YU4A 5FB0A 4XI1A 2L5UA 4LLBA 5LKUA 2DX8A 5J3XA 5FERA 2CKLB 2YHNA 2ECVA 2C2VS 2FUIA 4Q6FA 4A0CD 2ECJA 4FK5A 3ZVZB 1K2FA 3V43A 4LADB 1WEQA 3T6RA 2E6RA 5D1LB 2JMDA 2Y1MA 3O37A 2QJ0A 5AIUA 2KU3A 1WEEA 3LQJA 2VPBA 2JRJA 2YUCA 2MD8C 2YQLA 3KQIA 2H0DB 2FUUA 5B76A 2KREA 4N3WA 2QICA 4PTBA 2VJFB 2LN0A 2LV9A 1FBVA 3ZVYA 2L43A 4S3OB 2YSJA 5FEYA 1T1HA 3ZYQA 5JG6A 2XEUA 5TRBA 5B78A 5TDRA 4YBMA 2KGIA 1HYIA 3N9QA 1WE9A 5B8DA 2ECGA 2MD7B 4AVXA 2FSAA 4MVTA 5DKAA 2OXQC 4S3OC 2CSZA 2NAAA 3SOXA 4YAXA 5C11A 3O70A 2ECNA 3L1XA 3LQHA 3U5NA 5KH9A 4GNEA 5LKZA 4P5OB 2XB1A
chains in the Genus database with same CATH superfamily
2D8SA 2YW8A 4R7EA 2F6NA 2YT5A 4I7DA 2KYUA 4PPEA 1VD4A 1WESA 3N9MA 4UI9B 3SOUA 4WZ2A 2DSMA 1BORA 3KV5A 4ZDTA 2G6QA 3DPLR 5C13A 1VYXA 2UZGA 3KNVA 4LJNA 2Y1NA 1CHCA 4LKAA 3Q1DA 5DINA 2AN6A 2M3HA 4ZQLA 3O33A 4H9DA 2F6JA 4IC3A 3O36A 4TKPB 1LDKC 1DCQA 4GNGA 4YABA 3FJUB 2EGPA 4F52B 4V3LC 3SOWA 1Z2QA 1V87A 2ZETC 3EB6A 5KH3A 2KKYA 4MSXA 3HCTA 1IYMA 4V3KC 1X4JA 4ZUXU 4WZ0A 2L75A 1U6GB 2XOYA 3M7KA 3VK6A 1WEWA 1FP0A 2DJAA 4F1PA 3FEHA 3NG2A 1XWHA 3HCSA 4YC9A 3JUEA 4AUQB 4QF2A 2H0DA 4QF3A 3HTKC 5G04B 2VJFA 2YREA 3KV6A 3U5MA 2M1RA 2RSDA 2VNFA 2RI7A 2G43A 3N9LA 2F42A 5B75A 4FJCA 2EODA 1DVPA 5B77A 2CSYA 4WZ3B 3PUQA 3MHHA 1E4UA 5TBNA 4UP5A 2P57A 4A4CA 1JM7B 2M6MA 3ZPV1 2B0OE 2MA6A 3L11A 2LQ6A 3FM8C 4YADA 4L7XA 5D1MB 3QZVA 4LK9A 4GNDA 3EB5A 5EYAF 3LRQA 2YURA 5SVXA 4I7BA 2PUYA 4WA6A 2CRRA 3O7AA 3M99A 4YATA 4L58A 1F62A 2LGGA 4QQ4A 5D1KB 5G0FA 5FB1A 2K17A 2KWNA 2L0BA 1WILA 2L80A 2JMIA 5H1UA 2HDPA 2MIQA 4O64A 3M62A 3SUBA 3N9NA 3U5OA 3T9KA 1HYJA 2VPEA 1MBMA 4AYCA 2PNXA 3PURA 1LDJB 1X4IA 2VPDA 2M13A 2VJEA 2RR4A 3PHDA 2LGVA 5K3QA 5AITA 5KH7A 2VPGA 5TABA 2KWOA 3ASLA 4AP4A 3SHBA 2Y43A 3O35A 3HCUA 1G25A 3DQVR 5H1VA 2CKLA 2L7PA 2I50A 2XOZA 3LQIA 2IDAA 2D8UA 3LVQE 4Z0RA 1Z6UA 3LDYA 4W4UA 5LCWB 2LAUA 2K16A 2CT2A 4BBQA 1WENA 2KGGA 2EA6A 1WEMA 1VFYA 4A4BA 2E6SA 4YBSA 5LKTA 2BAYA 2MKEA 1MM2A 2MA5A 3O34A 4I7CA 2C2LA 3RPGB 2KIZA 2ECWA 2CSVA 2LDRA 2JUNA 4FIPA 4UP0A 1JOCA 3I2DA 2YQMA 3ZNIA 4CCGX 2LXPC 4X3GA 4CA1A 2HYED 2YYRA 2K4DA 4Z0OA 4BHWA 3RTRB 2KE1A 3MHSA 3ZTGA 2KR4A 4FO9A 2K1JA 2YSMA 4OGCA 3LVRE 5TDWA 4R8PK 4B7YC 2JMJA 5SVIB 2CONA 3M63A 1JM7A 4NN2A 3FANA 5H1TA 2ECTA 5LKXA 5G05B 1WGMA 3FL2A 1WEUA 3C6WA 3ZPVE 1Z60A 2KWJA 2KWKA 4C9ZA 1RMDA 2MNYA 1WFKA 2KKXA 4N4FA 3GV4A 1X4UA 2LXHC 1ZBDB 4A49A 2OWAA 4YBTA 5B79A 4B86C 2MUMA 2JM3A 4GB0A 4GNFA 3RPGC 1WIMA 4R2YA 1MM3A 5SVYA 2G45A 2MNZA 1WEOA 2E61A 2MT5A 3N9OA 2LGLA 4IC2A 1WEPA 2KFTA 2QIZA 4AYCB 2M85A 3IHPA 2LGKA 1N87A 3U5PA 5I3LA 2YHOA 2ECIA 1WEVA 3L1ZB 3KDEC 5H9MA 3N9PA 3GL6A 2VJEB 2LRIC 3DWDA 3T7LA 3C5KA 2VP7A 2YU4A 3DDTA 5FB0A 4XI1A 2L5UA 4LLBA 5LKUA 2DX8A 2XOCA 5J3XA 5FERA 2IQJA 2CKLB 2YHNA 2ECVA 2C2VS 2FUIA 4Q6FA 4A0CD 2ECJA 3E2DA 4FK5A 2FFWA 2EGMA 3ZVZB 2YVRA 1K2FA 3V43A 4LADB 2XP0A 1WEQA 3T6RA 2E6RA 5D1LB 2JMDA 2Y1MA 3O37A 2QJ0A 5AIUA 2KU3A 1WEEA 3LQJA 2VPBA 2JRJA 2YUCA 2MD8C 2YQLA 3KQIA 3H7HA 2H0DB 4OGEA 2FUUA 3O47A 5B76A 2KREA 4N3WA 4O62A 2QICA 4PTBA 3PLWA 2VJFB 3FAOA 2LN0A 2LV9A 1FBVA 5SVIA 3LJUX 3ZVYA 2L43A 4S3OB 2YSJA 5FEYA 1T1HA 3ZYQA 2FD4A 5JG6A 2XEUA 5TRBA 5B78A 5TDRA 4YBMA 2KGIA 1HYIA 3N9QA 3MDBC 1WE9A 5B8DA 2ECGA 2MD7B 2FSAA 4MVTA 5DKAA 4AVXA 2OXQC 4S3OC 2CSZA 2NAAA 3SOXA 4YAXA 5C11A 3O70A 2ECNA 3L1XA 3LQHA 3U5NA 2CRWA 5KH9A 2EXUA 4GNEA 5LKZA 4P5OB 2XB1A
chains in the Genus database with same CATH topology
2D8SA 2YW8A 4R7EA 2F6NA 2YT5A 4I7DA 2KYUA 4PPEA 1VD4A 1WESA 3N9MA 4UI9B 3SOUA 4WZ2A 1BORA 3KV5A 4ZDTA 2G6QA 3DPLR 5C13A 1VYXA 2UZGA 3KNVA 4LJNA 2Y1NA 1CHCA 4LKAA 5DINA 2AN6A 2M3HA 4ZQLA 3O33A 4IC3A 2F6JA 3O36A 4TKPB 1LDKC 4GNGA 4YABA 2EGPA 4F52B 4V3LC 3SOWA 1Z2QA 1V87A 2ZETC 3EB6A 5KH3A 4MSXA 3HCTA 1IYMA 4V3KC 1X4JA 4ZUXU 4WZ0A 2L75A 1U6GB 3VK6A 1WEWA 1FP0A 3NG2A 1XWHA 3HCSA 4YC9A 4AUQB 4QF2A 2H0DA 4QF3A 3HTKC 5G04B 2VJFA 2YREA 3KV6A 3U5MA 2M1RA 2RSDA 2VNFA 2RI7A 2G43A 3N9LA 2F42A 5B75A 4FJCA 2EODA 1DVPA 5B77A 2CSYA 4WZ3B 3PUQA 3MHHA 1E4UA 5TBNA 4UP5A 4A4CA 1JM7B 2M6MA 3ZPV1 2MA6A 3L11A 2LQ6A 4YADA 4L7XA 5D1MB 3QZVA 4LK9A 4GNDA 3EB5A 5EYAF 3LRQA 2YURA 4I7BA 2PUYA 4WA6A 3O7AA 3M99A 4YATA 4L58A 1F62A 2LGGA 5D1KB 5G0FA 5FB1A 2K17A 2KWNA 2L0BA 1WILA 2L80A 2JMIA 5H1UA 2HDPA 2MIQA 4O64A 3M62A 3N9NA 3U5OA 1HYJA 2VPEA 4AYCA 2PNXA 3PURA 1LDJB 1X4IA 2VPDA 2VJEA 3PHDA 2LGVA 5AITA 5KH7A 2VPGA 5TABA 2KWOA 3ASLA 4AP4A 3SHBA 2Y43A 3O35A 3HCUA 1G25A 3DQVR 5H1VA 2CKLA 2I50A 3LQIA 2IDAA 1Z6UA 4W4UA 5LCWB 2K16A 2CT2A 4BBQA 1WENA 2KGGA 2EA6A 1WEMA 1VFYA 4A4BA 2E6SA 4YBSA 5LKTA 2BAYA 1MM2A 2MA5A 3O34A 4I7CA 2C2LA 3RPGB 2KIZA 2ECWA 2LDRA 4FIPA 4UP0A 1JOCA 3I2DA 2YQMA 3ZNIA 4CCGX 2LXPC 4X3GA 4CA1A 2HYED 2YYRA 2K4DA 4BHWA 3RTRB 2KE1A 3MHSA 3ZTGA 2KR4A 4FO9A 2K1JA 2YSMA 5TDWA 4R8PK 4B7YC 2JMJA 1JM7A 3M63A 4NN2A 5H1TA 2ECTA 5LKXA 5G05B 1WGMA 3FL2A 1WEUA 3C6WA 3ZPVE 1Z60A 2KWJA 2KWKA 4C9ZA 1RMDA 2MNYA 1WFKA 4N4FA 3GV4A 1X4UA 2LXHC 1ZBDB 4A49A 4YBTA 5B79A 4B86C 2MUMA 4GB0A 4GNFA 3RPGC 1WIMA 4R2YA 1MM3A 2G45A 2MNZA 1WEOA 2MT5A 3N9OA 2LGLA 4IC2A 1WEPA 2KFTA 2QIZA 4AYCB 2M85A 3IHPA 2LGKA 1N87A 3U5PA 5I3LA 2YHOA 2ECIA 1WEVA 3L1ZB 5H9MA 3N9PA 3GL6A 2VJEB 2LRIC 3T7LA 3C5KA 2VP7A 2YU4A 5FB0A 4XI1A 2L5UA 4LLBA 5LKUA 2DX8A 5J3XA 5FERA 2CKLB 2YHNA 2ECVA 2C2VS 2FUIA 4Q6FA 4A0CD 2ECJA 4FK5A 3ZVZB 1K2FA 3V43A 4LADB 1WEQA 3T6RA 2E6RA 5D1LB 2JMDA 2Y1MA 3O37A 2QJ0A 5AIUA 2KU3A 1WEEA 3LQJA 2VPBA 2JRJA 2YUCA 2MD8C 2YQLA 3KQIA 2H0DB 2FUUA 5B76A 2KREA 4N3WA 2QICA 4PTBA 2VJFB 2LN0A 2LV9A 1FBVA 3ZVYA 2L43A 4S3OB 2YSJA 5FEYA 1T1HA 3ZYQA 5JG6A 2XEUA 5TRBA 5B78A 5TDRA 4YBMA 2KGIA 1HYIA 3N9QA 1WE9A 5B8DA 2ECGA 2MD7B 4AVXA 2FSAA 4MVTA 5DKAA 2OXQC 4S3OC 2CSZA 2NAAA 3SOXA 4YAXA 5C11A 3O70A 2ECNA 3L1XA 3LQHA 3U5NA 5KH9A 4GNEA 5LKZA 4P5OB 2XB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8S A;  2YW8 A;  4R7E A;  2F6N A;  2YT5 A;  4I7D A;  2KYU A;  4PPE A;  1VD4 A;  1WES A;  3N9M A;  4UI9 B;  3SOU A;  4WZ2 A;  1BOR A;  3KV5 A;  4ZDT A;  2G6Q A;  3DPL R;  5C13 A;  1VYX A;  2UZG A;  3KNV A;  4LJN A;  2Y1N A;  1CHC A;  4LKA A;  5DIN A;  2AN6 A;  2M3H A;  4ZQL A;  3O33 A;  4IC3 A;  2F6J A;  3O36 A;  4TKP B;  1LDK C;  4GNG A;  4YAB A;  2EGP A;  4F52 B;  4V3L C;  3SOW A;  1Z2Q A;  1V87 A;  2ZET C;  3EB6 A;  5KH3 A;  4MSX A;  3HCT A;  1IYM A;  4V3K C;  1X4J A;  4ZUX U;  4WZ0 A;  2L75 A;  1U6G B;  3VK6 A;  1WEW A;  1FP0 A;  3NG2 A;  1XWH A;  3HCS A;  4YC9 A;  4AUQ B;  4QF2 A;  2H0D A;  4QF3 A;  3HTK C;  5G04 B;  2VJF A;  2YRE A;  3KV6 A;  3U5M A;  2M1R A;  2RSD A;  2VNF A;  2RI7 A;  2G43 A;  3N9L A;  2F42 A;  5B75 A;  4FJC A;  2EOD A;  1DVP A;  5B77 A;  2CSY A;  4WZ3 B;  3PUQ A;  3MHH A;  1E4U A;  5TBN A;  4UP5 A;  4A4C A;  1JM7 B;  2M6M A;  3ZPV 1;  2MA6 A;  3L11 A;  2LQ6 A;  4YAD A;  4L7X A;  5D1M B;  3QZV A;  4LK9 A;  4GND A;  3EB5 A;  5EYA F;  3LRQ A;  2YUR A;  4I7B A;  2PUY A;  4WA6 A;  3O7A A;  3M99 A;  4YAT A;  4L58 A;  1F62 A;  2LGG A;  5D1K B;  5G0F A;  5FB1 A;  2K17 A;  2KWN A;  2L0B A;  1WIL A;  2L80 A;  2JMI A;  5H1U A;  2HDP A;  2MIQ A;  4O64 A;  3M62 A;  3N9N A;  3U5O A;  1HYJ A;  2VPE A;  4AYC A;  2PNX A;  3PUR A;  1LDJ B;  1X4I A;  2VPD A;  2VJE A;  3PHD A;  2LGV A;  5AIT A;  5KH7 A;  2VPG A;  5TAB A;  2KWO A;  3ASL A;  4AP4 A;  3SHB A;  2Y43 A;  3O35 A;  3HCU A;  1G25 A;  3DQV R;  5H1V A;  2CKL A;  2I50 A;  3LQI A;  2IDA A;  1Z6U A;  4W4U A;  5LCW B;  2K16 A;  2CT2 A;  4BBQ A;  1WEN A;  2KGG A;  2EA6 A;  1WEM A;  1VFY A;  4A4B A;  2E6S A;  4YBS A;  5LKT A;  2BAY A;  1MM2 A;  2MA5 A;  3O34 A;  4I7C A;  2C2L A;  3RPG B;  2KIZ A;  2ECW A;  2LDR A;  4FIP A;  4UP0 A;  1JOC A;  3I2D A;  2YQM A;  3ZNI A;  4CCG X;  2LXP C;  4X3G A;  4CA1 A;  2HYE D;  2YYR A;  2K4D A;  4BHW A;  3RTR B;  2KE1 A;  3MHS A;  3ZTG A;  2KR4 A;  4FO9 A;  2K1J A;  2YSM A;  5TDW A;  4R8P K;  4B7Y C;  2JMJ A;  1JM7 A;  3M63 A;  4NN2 A;  5H1T A;  2ECT A;  5LKX A;  5G05 B;  1WGM A;  3FL2 A;  1WEU A;  3C6W A;  3ZPV E;  1Z60 A;  2KWJ A;  2KWK A;  4C9Z A;  1RMD A;  2MNY A;  1WFK A;  4N4F A;  3GV4 A;  1X4U A;  2LXH C;  1ZBD B;  4A49 A;  4YBT A;  5B79 A;  4B86 C;  2MUM A;  4GB0 A;  4GNF A;  3RPG C;  1WIM A;  4R2Y A;  1MM3 A;  2G45 A;  2MNZ A;  1WEO A;  2MT5 A;  3N9O A;  2LGL A;  4IC2 A;  1WEP A;  2KFT A;  2QIZ A;  4AYC B;  2M85 A;  3IHP A;  2LGK A;  1N87 A;  3U5P A;  5I3L A;  2YHO A;  2ECI A;  1WEV A;  3L1Z B;  5H9M A;  3N9P A;  3GL6 A;  2VJE B;  2LRI C;  3T7L A;  3C5K A;  2VP7 A;  2YU4 A;  5FB0 A;  4XI1 A;  2L5U A;  4LLB A;  5LKU A;  2DX8 A;  5J3X A;  5FER A;  2CKL B;  2YHN A;  2ECV A;  2C2V S;  2FUI A;  4Q6F A;  4A0C D;  2ECJ A;  4FK5 A;  3ZVZ B;  1K2F A;  3V43 A;  4LAD B;  1WEQ A;  3T6R A;  2E6R A;  5D1L B;  2JMD A;  2Y1M A;  3O37 A;  2QJ0 A;  5AIU A;  2KU3 A;  1WEE A;  3LQJ A;  2VPB A;  2JRJ A;  2YUC A;  2MD8 C;  2YQL A;  3KQI A;  2H0D B;  2FUU A;  5B76 A;  2KRE A;  4N3W A;  2QIC A;  4PTB A;  2VJF B;  2LN0 A;  2LV9 A;  1FBV A;  3ZVY A;  2L43 A;  4S3O B;  2YSJ A;  5FEY A;  1T1H A;  3ZYQ A;  5JG6 A;  2XEU A;  5TRB A;  5B78 A;  5TDR A;  4YBM A;  2KGI A;  1HYI A;  3N9Q A;  1WE9 A;  5B8D A;  2ECG A;  2MD7 B;  4AVX A;  2FSA A;  4MVT A;  5DKA A;  2OXQ C;  4S3O C;  2CSZ A;  2NAA A;  3SOX A;  4YAX A;  5C11 A;  3O70 A;  2ECN A;  3L1X A;  3LQH A;  3U5N A;  5KH9 A;  4GNE A;  5LKZ A;  4P5O B;  2XB1 A; 
#chains in the Genus database with same CATH topology
 2D8S A;  2YW8 A;  4R7E A;  2F6N A;  2YT5 A;  4I7D A;  2KYU A;  4PPE A;  1VD4 A;  1WES A;  3N9M A;  4UI9 B;  3SOU A;  4WZ2 A;  2DSM A;  1BOR A;  3KV5 A;  4ZDT A;  2G6Q A;  3DPL R;  5C13 A;  1VYX A;  2UZG A;  3KNV A;  4LJN A;  2Y1N A;  1CHC A;  4LKA A;  3Q1D A;  5DIN A;  2AN6 A;  2M3H A;  4ZQL A;  3O33 A;  4H9D A;  2F6J A;  4IC3 A;  3O36 A;  4TKP B;  1LDK C;  1DCQ A;  4GNG A;  4YAB A;  3FJU B;  2EGP A;  4F52 B;  4V3L C;  3SOW A;  1Z2Q A;  1V87 A;  2ZET C;  3EB6 A;  5KH3 A;  2KKY A;  4MSX A;  3HCT A;  1IYM A;  4V3K C;  1X4J A;  4ZUX U;  4WZ0 A;  2L75 A;  1U6G B;  2XOY A;  3M7K A;  3VK6 A;  1WEW A;  1FP0 A;  2DJA A;  4F1P A;  3FEH A;  3NG2 A;  1XWH A;  3HCS A;  4YC9 A;  3JUE A;  4AUQ B;  4QF2 A;  2H0D A;  4QF3 A;  3HTK C;  5G04 B;  2VJF A;  2YRE A;  3KV6 A;  3U5M A;  2M1R A;  2RSD A;  2VNF A;  2RI7 A;  2G43 A;  3N9L A;  2F42 A;  5B75 A;  4FJC A;  2EOD A;  1DVP A;  5B77 A;  2CSY A;  4WZ3 B;  3PUQ A;  3MHH A;  1E4U A;  5TBN A;  4UP5 A;  2P57 A;  4A4C A;  1JM7 B;  2M6M A;  3ZPV 1;  2B0O E;  2MA6 A;  3L11 A;  2LQ6 A;  3FM8 C;  4YAD A;  4L7X A;  5D1M B;  3QZV A;  4LK9 A;  4GND A;  3EB5 A;  5EYA F;  3LRQ A;  2YUR A;  5SVX A;  4I7B A;  2PUY A;  4WA6 A;  2CRR A;  3O7A A;  3M99 A;  4YAT A;  4L58 A;  1F62 A;  2LGG A;  4QQ4 A;  5D1K B;  5G0F A;  5FB1 A;  2K17 A;  2KWN A;  2L0B A;  1WIL A;  2L80 A;  2JMI A;  5H1U A;  2HDP A;  2MIQ A;  4O64 A;  3M62 A;  3SUB A;  3N9N A;  3U5O A;  3T9K A;  1HYJ A;  2VPE A;  1MBM A;  4AYC A;  2PNX A;  3PUR A;  1LDJ B;  1X4I A;  2VPD A;  2M13 A;  2VJE A;  2RR4 A;  3PHD A;  2LGV A;  5K3Q A;  5AIT A;  5KH7 A;  2VPG A;  5TAB A;  2KWO A;  3ASL A;  4AP4 A;  3SHB A;  2Y43 A;  3O35 A;  3HCU A;  1G25 A;  3DQV R;  5H1V A;  2CKL A;  2L7P A;  2I50 A;  2XOZ A;  3LQI A;  2IDA A;  2D8U A;  3LVQ E;  4Z0R A;  1Z6U A;  3LDY A;  4W4U A;  5LCW B;  2LAU A;  2K16 A;  2CT2 A;  4BBQ A;  1WEN A;  2KGG A;  2EA6 A;  1WEM A;  1VFY A;  4A4B A;  2E6S A;  4YBS A;  5LKT A;  2BAY A;  2MKE A;  1MM2 A;  2MA5 A;  3O34 A;  4I7C A;  2C2L A;  3RPG B;  2KIZ A;  2ECW A;  2CSV A;  2LDR A;  2JUN A;  4FIP A;  4UP0 A;  1JOC A;  3I2D A;  2YQM A;  3ZNI A;  4CCG X;  2LXP C;  4X3G A;  4CA1 A;  2HYE D;  2YYR A;  2K4D A;  4Z0O A;  4BHW A;  3RTR B;  2KE1 A;  3MHS A;  3ZTG A;  2KR4 A;  4FO9 A;  2K1J A;  2YSM A;  4OGC A;  3LVR E;  5TDW A;  4R8P K;  4B7Y C;  2JMJ A;  5SVI B;  2CON A;  3M63 A;  1JM7 A;  4NN2 A;  3FAN A;  5H1T A;  2ECT A;  5LKX A;  5G05 B;  1WGM A;  3FL2 A;  1WEU A;  3C6W A;  3ZPV E;  1Z60 A;  2KWJ A;  2KWK A;  4C9Z A;  1RMD A;  2MNY A;  1WFK A;  2KKX A;  4N4F A;  3GV4 A;  1X4U A;  2LXH C;  1ZBD B;  4A49 A;  2OWA A;  4YBT A;  5B79 A;  4B86 C;  2MUM A;  2JM3 A;  4GB0 A;  4GNF A;  3RPG C;  1WIM A;  4R2Y A;  1MM3 A;  5SVY A;  2G45 A;  2MNZ A;  1WEO A;  2E61 A;  2MT5 A;  3N9O A;  2LGL A;  4IC2 A;  1WEP A;  2KFT A;  2QIZ A;  4AYC B;  2M85 A;  3IHP A;  2LGK A;  1N87 A;  3U5P A;  5I3L A;  2YHO A;  2ECI A;  1WEV A;  3L1Z B;  3KDE C;  5H9M A;  3N9P A;  3GL6 A;  2VJE B;  2LRI C;  3DWD A;  3T7L A;  3C5K A;  2VP7 A;  2YU4 A;  3DDT A;  5FB0 A;  4XI1 A;  2L5U A;  4LLB A;  5LKU A;  2DX8 A;  2XOC A;  5J3X A;  5FER A;  2IQJ A;  2CKL B;  2YHN A;  2ECV A;  2C2V S;  2FUI A;  4Q6F A;  4A0C D;  2ECJ A;  3E2D A;  4FK5 A;  2FFW A;  2EGM A;  3ZVZ B;  2YVR A;  1K2F A;  3V43 A;  4LAD B;  2XP0 A;  1WEQ A;  3T6R A;  2E6R A;  5D1L B;  2JMD A;  2Y1M A;  3O37 A;  2QJ0 A;  5AIU A;  2KU3 A;  1WEE A;  3LQJ A;  2VPB A;  2JRJ A;  2YUC A;  2MD8 C;  2YQL A;  3KQI A;  3H7H A;  2H0D B;  4OGE A;  2FUU A;  3O47 A;  5B76 A;  2KRE A;  4N3W A;  4O62 A;  2QIC A;  4PTB A;  3PLW A;  2VJF B;  3FAO A;  2LN0 A;  2LV9 A;  1FBV A;  5SVI A;  3LJU X;  3ZVY A;  2L43 A;  4S3O B;  2YSJ A;  5FEY A;  1T1H A;  3ZYQ A;  2FD4 A;  5JG6 A;  2XEU A;  5TRB A;  5B78 A;  5TDR A;  4YBM A;  2KGI A;  1HYI A;  3N9Q A;  3MDB C;  1WE9 A;  5B8D A;  2ECG A;  2MD7 B;  2FSA A;  4MVT A;  5DKA A;  4AVX A;  2OXQ C;  4S3O C;  2CSZ A;  2NAA A;  3SOX A;  4YAX A;  5C11 A;  3O70 A;  2ECN A;  3L1X A;  3LQH A;  3U5N A;  2CRW A;  5KH9 A;  2EXU A;  4GNE A;  5LKZ A;  4P5O B;  2XB1 A; 
#chains in the Genus database with same CATH homology
 2D8S A;  2YW8 A;  4R7E A;  2F6N A;  2YT5 A;  4I7D A;  2KYU A;  4PPE A;  1VD4 A;  1WES A;  3N9M A;  4UI9 B;  3SOU A;  4WZ2 A;  1BOR A;  3KV5 A;  4ZDT A;  2G6Q A;  3DPL R;  5C13 A;  1VYX A;  2UZG A;  3KNV A;  4LJN A;  2Y1N A;  1CHC A;  4LKA A;  5DIN A;  2AN6 A;  2M3H A;  4ZQL A;  3O33 A;  4IC3 A;  2F6J A;  3O36 A;  4TKP B;  1LDK C;  4GNG A;  4YAB A;  2EGP A;  4F52 B;  4V3L C;  3SOW A;  1Z2Q A;  1V87 A;  2ZET C;  3EB6 A;  5KH3 A;  4MSX A;  3HCT A;  1IYM A;  4V3K C;  1X4J A;  4ZUX U;  4WZ0 A;  2L75 A;  1U6G B;  3VK6 A;  1WEW A;  1FP0 A;  3NG2 A;  1XWH A;  3HCS A;  4YC9 A;  4AUQ B;  4QF2 A;  2H0D A;  4QF3 A;  3HTK C;  5G04 B;  2VJF A;  2YRE A;  3KV6 A;  3U5M A;  2M1R A;  2RSD A;  2VNF A;  2RI7 A;  2G43 A;  3N9L A;  2F42 A;  5B75 A;  4FJC A;  2EOD A;  1DVP A;  5B77 A;  2CSY A;  4WZ3 B;  3PUQ A;  3MHH A;  1E4U A;  5TBN A;  4UP5 A;  4A4C A;  1JM7 B;  2M6M A;  3ZPV 1;  2MA6 A;  3L11 A;  2LQ6 A;  4YAD A;  4L7X A;  5D1M B;  3QZV A;  4LK9 A;  4GND A;  3EB5 A;  5EYA F;  3LRQ A;  2YUR A;  4I7B A;  2PUY A;  4WA6 A;  3O7A A;  3M99 A;  4YAT A;  4L58 A;  1F62 A;  2LGG A;  5D1K B;  5G0F A;  5FB1 A;  2K17 A;  2KWN A;  2L0B A;  1WIL A;  2L80 A;  2JMI A;  5H1U A;  2HDP A;  2MIQ A;  4O64 A;  3M62 A;  3N9N A;  3U5O A;  1HYJ A;  2VPE A;  4AYC A;  2PNX A;  3PUR A;  1LDJ B;  1X4I A;  2VPD A;  2VJE A;  3PHD A;  2LGV A;  5AIT A;  5KH7 A;  2VPG A;  5TAB A;  2KWO A;  3ASL A;  4AP4 A;  3SHB A;  2Y43 A;  3O35 A;  3HCU A;  1G25 A;  3DQV R;  5H1V A;  2CKL A;  2I50 A;  3LQI A;  2IDA A;  1Z6U A;  4W4U A;  5LCW B;  2K16 A;  2CT2 A;  4BBQ A;  1WEN A;  2KGG A;  2EA6 A;  1WEM A;  1VFY A;  4A4B A;  2E6S A;  4YBS A;  5LKT A;  2BAY A;  1MM2 A;  2MA5 A;  3O34 A;  4I7C A;  2C2L A;  3RPG B;  2KIZ A;  2ECW A;  2LDR A;  4FIP A;  4UP0 A;  1JOC A;  3I2D A;  2YQM A;  3ZNI A;  4CCG X;  2LXP C;  4X3G A;  4CA1 A;  2HYE D;  2YYR A;  2K4D A;  4BHW A;  3RTR B;  2KE1 A;  3MHS A;  3ZTG A;  2KR4 A;  4FO9 A;  2K1J A;  2YSM A;  5TDW A;  4R8P K;  4B7Y C;  2JMJ A;  1JM7 A;  3M63 A;  4NN2 A;  5H1T A;  2ECT A;  5LKX A;  5G05 B;  1WGM A;  3FL2 A;  1WEU A;  3C6W A;  3ZPV E;  1Z60 A;  2KWJ A;  2KWK A;  4C9Z A;  1RMD A;  2MNY A;  1WFK A;  4N4F A;  3GV4 A;  1X4U A;  2LXH C;  1ZBD B;  4A49 A;  4YBT A;  5B79 A;  4B86 C;  2MUM A;  4GB0 A;  4GNF A;  3RPG C;  1WIM A;  4R2Y A;  1MM3 A;  2G45 A;  2MNZ A;  1WEO A;  2MT5 A;  3N9O A;  2LGL A;  4IC2 A;  1WEP A;  2KFT A;  2QIZ A;  4AYC B;  2M85 A;  3IHP A;  2LGK A;  1N87 A;  3U5P A;  5I3L A;  2YHO A;  2ECI A;  1WEV A;  3L1Z B;  5H9M A;  3N9P A;  3GL6 A;  2VJE B;  2LRI C;  3T7L A;  3C5K A;  2VP7 A;  2YU4 A;  5FB0 A;  4XI1 A;  2L5U A;  4LLB A;  5LKU A;  2DX8 A;  5J3X A;  5FER A;  2CKL B;  2YHN A;  2ECV A;  2C2V S;  2FUI A;  4Q6F A;  4A0C D;  2ECJ A;  4FK5 A;  3ZVZ B;  1K2F A;  3V43 A;  4LAD B;  1WEQ A;  3T6R A;  2E6R A;  5D1L B;  2JMD A;  2Y1M A;  3O37 A;  2QJ0 A;  5AIU A;  2KU3 A;  1WEE A;  3LQJ A;  2VPB A;  2JRJ A;  2YUC A;  2MD8 C;  2YQL A;  3KQI A;  2H0D B;  2FUU A;  5B76 A;  2KRE A;  4N3W A;  2QIC A;  4PTB A;  2VJF B;  2LN0 A;  2LV9 A;  1FBV A;  3ZVY A;  2L43 A;  4S3O B;  2YSJ A;  5FEY A;  1T1H A;  3ZYQ A;  5JG6 A;  2XEU A;  5TRB A;  5B78 A;  5TDR A;  4YBM A;  2KGI A;  1HYI A;  3N9Q A;  1WE9 A;  5B8D A;  2ECG A;  2MD7 B;  4AVX A;  2FSA A;  4MVT A;  5DKA A;  2OXQ C;  4S3O C;  2CSZ A;  2NAA A;  3SOX A;  4YAX A;  5C11 A;  3O70 A;  2ECN A;  3L1X A;  3LQH A;  3U5N A;  5KH9 A;  4GNE A;  5LKZ A;  4P5O B;  2XB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...