2VPDA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
VYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 14
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpdA00
4AP4A 2Y43A 2G43A 5TABA 1N87A 3L1ZB 2YQLA 5FEYA 2EGPA 2ECGA 4NN2A 5H1UA 4GNGA 1ZBDB 2KGIA 2VJEA 4WZ0A 2MNYA 4LK9A 4IC2A 2LV9A 2MA6A 2ECJA 3SHBA 5G0FA 1VYXA 3LRQA 4FO9A 2F6JA 5C11A 2M1RA 2QICA 1HYIA 3GV4A 1DVPA 4AYCB 4I7BA 4IC3A 4B86C 2MD8C 2G6QA 5B79A 2L75A 5AITA 1LDJB 2LGKA 2MNZA 2CSZA 4CA1A 1BORA 3HTKC 3VK6A 2KFTA 1VD4A 2LXHC 2BAYA 3MHHA 1WEQA 3RTRB 1JM7B 4YBTA 2AN6A 5B76A 4A0CD 3ZVZB 2YHNA 5EYAF 2OXQC 3O7AA 3NG2A 3PURA 2H0DA 4MSXA 4V3LC 5D1MB 4A4CA 3L11A 3QZVA 3O37A 2HYED 2FUIA 4BBQA 2MA5A 3GL6A 2ZETC 4O64A 1WEUA 2KGGA 4C9ZA 2KREA 5B8DA 5AIUA 2IDAA 4UI9B 2LQ6A 2LGGA 2YYRA 2Y1MA 3O70A 3T6RA 4ZQLA 3ZPVE 2M85A 5B75A 5C13A 4Q6FA 3FL2A 2LDRA 1WENA 1WEPA 4R7EA 1K2FA 5H1VA 2EA6A 2YUCA 3C5KA 2JRJA 2ECVA 2QJ0A 4AUQB 4YABA 5B77A 4YAXA 2RSDA 1CHCA 5FERA 2YURA 4YBMA 2CT2A 4LKAA 4N3WA 4YC9A 4L7XA 2C2LA 4XI1A 1E4UA 2L5UA 4WZ2A 3ZVYA 1WGMA 2VJFA 2MT5A 3IHPA 2KIZA 1WEMA 2XB1A 4L58A 4A4BA 2M6MA 1IYMA 3I2DA 2YW8A 2ECNA 4GB0A 2JMIA 2H0DB 2LXPC 5G04B 2JMJA 3RPGC 4F52B 1WEWA 2DX8A 2YSMA 3U5OA 2ECWA 4BHWA 2KE1A 2PUYA 2LRIC 1WEOA 2ECTA 2QIZA 4ZUXU 4FJCA 2PNXA 2D8SA 5G05B 1Z2QA 2K4DA 5FB1A 5DKAA 3V43A 1WIMA 3U5NA 1WE9A 2CSYA 3EB5A 2Y1NA 2VNFA 3N9PA 3C6WA 5TDRA 2MD7B 2YREA 3O36A 5LKZA 2MIQA 1LDKC 3ASLA 3SOWA 2LGLA 4WZ3B 2KYUA 4QF3A 2F42A 2C2VS 3ZPV1 2VJEB 5D1KB 2L80A 2VPEA 3U5PA 2KR4A 5H9MA 4GNEA 3DQVR 3LQJA 2F6NA 2E6SA 2K1JA 2VJFB 4YADA 5LKTA 4R8PK 1FBVA 2KWOA 2YHOA 3N9OA 5KH7A 3MHSA 3U5MA 3N9NA 2FSAA 3M99A 1FP0A 2L43A 2YQMA 5JG6A 3HCUA 4V3KC 4S3OC 2CKLA 3O34A 1F62A 3KNVA 2VPGA 5TBNA 2LN0A 1X4JA 3N9MA 2YU4A 2VP7A 1WILA 3M63A 3LQHA 3T7LA 4I7CA 5KH9A 5B78A 5DINA 5J3XA 2XEUA 4ZDTA 4AVXA 2YSJA 4LLBA 5LKXA 1MM3A 1VFYA 2MUMA 2ECIA 3ZNIA 3SOUA 5TRBA 2G45A 1Z60A 2VPBA 1WESA 2M3HA 2VPDA 2KWJA 3ZTGA 2K17A 4GNFA 3KV5A 4P5OB 4B7YC 3KV6A 4TKPB 4LJNA 1WFKA 1MM2A 5D1LB 1T1HA 2UZGA 2KWKA 3RPGB 4UP0A 5H1TA 1U6GB 1G25A 2E6RA 2L0BA 1HYJA 4R2YA 1Z6UA 4A49A 1WEEA 3N9LA 2CKLB 3KQIA 4N4FA 4UP5A 3HCSA 3N9QA 5LCWB 5FB0A 3M62A 4PTBA 4YATA 1RMDA 2HDPA 4MVTA 1V87A 4WA6A 4AYCA 2KU3A 2YT5A 4X3GA 4FIPA 2EODA 2RI7A 3PHDA 5I3LA 3DPLR 2KWNA 2NAAA 4QF2A 2FUUA 1X4IA 4CCGX 1X4UA 2I50A 4LADB 4I7DA 4W4UA 1XWHA 3EB6A 1JOCA 3HCTA 4PPEA 3SOXA 5LKUA 5TDWA 3O33A 1JM7A 4GNDA 2K16A 1WEVA 2LGVA 3PUQA 2JMDA 3LQIA 4FK5A 3L1XA 3ZYQA 3O35A 4S3OB 5KH3A 4YBSA
chains in the Genus database with same CATH superfamily
4AP4A 2Y43A 2G43A 5TABA 1N87A 2CRRA 3L1ZB 2YQLA 5FEYA 2DJAA 3FEHA 2EGPA 2ECGA 4NN2A 5H1UA 4GNGA 1ZBDB 2KGIA 3DDTA 2VJEA 4WZ0A 2MNYA 4LK9A 4IC2A 3KDEC 2LV9A 2MA6A 4H9DA 2ECJA 3SHBA 5SVIA 5G0FA 1VYXA 3LRQA 4FO9A 2F6JA 2KKXA 5C11A 2M1RA 2QICA 1HYIA 3GV4A 1DVPA 4AYCB 4I7BA 4IC3A 4B86C 2MD8C 2G6QA 5B79A 2XOZA 2L75A 5AITA 1LDJB 2LGKA 2EGMA 2CSZA 2MNZA 2RR4A 4CA1A 1BORA 3HTKC 3VK6A 2KFTA 1VD4A 2KKYA 2LXHC 2E61A 2BAYA 3MHHA 1WEQA 3RTRB 3LDYA 1JM7B 4YBTA 2XOCA 2AN6A 2JM3A 3LJUX 5B76A 4A0CD 3ZVZB 3PLWA 2YHNA 5EYAF 2OXQC 2MKEA 3O7AA 3NG2A 2IQJA 2XP0A 2H0DA 3PURA 4MSXA 4V3LC 5D1MB 4A4CA 3L11A 3QZVA 3O37A 2HYED 2FUIA 4BBQA 2MA5A 3GL6A 2ZETC 4O62A 4O64A 1WEUA 2KGGA 4C9ZA 2KREA 5B8DA 5AIUA 2IDAA 4UI9B 2LQ6A 2LGGA 2YYRA 2Y1MA 3O70A 3T6RA 4ZQLA 3ZPVE 2M85A 5B75A 5SVIB 5C13A 4Q6FA 3FL2A 2LDRA 1WENA 1WEPA 4R7EA 1K2FA 5H1VA 2EA6A 2YUCA 3C5KA 2JUNA 3Q1DA 2JRJA 2ECVA 2QJ0A 4AUQB 4YABA 5B77A 4YAXA 3MDBC 2RSDA 1CHCA 2FD4A 5FERA 2YURA 4YBMA 2CT2A 4LKAA 4N3WA 4YC9A 4L7XA 2C2LA 4XI1A 1E4UA 2L5UA 4WZ2A 3ZVYA 1WGMA 2VJFA 2MT5A 3IHPA 2KIZA 1WEMA 2XB1A 4L58A 4A4BA 2M6MA 1IYMA 3I2DA 2DSMA 2YW8A 2ECNA 4GB0A 2JMIA 2CSVA 2H0DB 2LXPC 5G04B 2JMJA 3RPGC 4F52B 1WEWA 2DX8A 2EXUA 2YSMA 3U5OA 5SVXA 2ECWA 4BHWA 2KE1A 2PUYA 2LRIC 1WEOA 2ECTA 2QIZA 3M7KA 4ZUXU 4FJCA 2PNXA 4QQ4A 2D8SA 5G05B 4Z0OA 1Z2QA 2K4DA 4F1PA 5FB1A 5DKAA 3V43A 1WIMA 3U5NA 1WE9A 2P57A 2XOYA 2CSYA 3EB5A 2Y1NA 2VNFA 3N9PA 3C6WA 5TDRA 2MD7B 2YREA 3O36A 5LKZA 2MIQA 1LDKC 3ASLA 3SOWA 2LGLA 4WZ3B 2KYUA 4QF3A 2LAUA 2F42A 2C2VS 3ZPV1 2VJEB 5D1KB 2L80A 2VPEA 3U5PA 2KR4A 4OGEA 5H9MA 4GNEA 3DQVR 4OGCA 3LQJA 2F6NA 2E6SA 2K1JA 2VJFB 4YADA 5LKTA 4R8PK 1FBVA 1DCQA 2KWOA 2YHOA 3N9OA 5KH7A 3MHSA 3U5MA 3JUEA 3N9NA 2FSAA 3M99A 1FP0A 2L43A 2YQMA 2FFWA 5JG6A 3HCUA 4V3KC 4S3OC 2CKLA 3O34A 1F62A 5K3QA 3O47A 3KNVA 2VPGA 5TBNA 2LN0A 1X4JA 3N9MA 2YU4A 3H7HA 2VP7A 1WILA 3M63A 3SUBA 3LQHA 3T7LA 4I7CA 5KH9A 5B78A 5DINA 5J3XA 2XEUA 4ZDTA 4AVXA 2YSJA 4LLBA 3LVRE 5LKXA 1MM3A 1VFYA 2CRWA 2MUMA 2ECIA 3ZNIA 3SOUA 2G45A 5TRBA 1Z60A 2VPBA 2L7PA 1WESA 3LVQE 2M3HA 2VPDA 2KWJA 3ZTGA 2K17A 4GNFA 3KV5A 4P5OB 4B7YC 3KV6A 2CONA 4TKPB 2YVRA 4LJNA 1WFKA 1MM2A 5D1LB 2OWAA 4Z0RA 1T1HA 3DWDA 2UZGA 2KWKA 3RPGB 3E2DA 4UP0A 5H1TA 1U6GB 1G25A 2E6RA 2L0BA 5SVYA 1HYJA 4R2YA 1Z6UA 4A49A 1WEEA 3N9LA 2CKLB 3KQIA 4N4FA 4UP5A 3HCSA 3N9QA 5LCWB 5FB0A 3M62A 4PTBA 4YATA 1RMDA 2HDPA 4MVTA 1V87A 1MBMA 4WA6A 4AYCA 2KU3A 2YT5A 4X3GA 4FIPA 2EODA 2RI7A 3PHDA 5I3LA 3DPLR 2KWNA 2NAAA 4QF2A 3FAOA 2FUUA 1X4IA 4CCGX 1X4UA 2I50A 4LADB 4I7DA 4W4UA 1XWHA 3FANA 3EB6A 1JOCA 3HCTA 4PPEA 3SOXA 5LKUA 5TDWA 3O33A 1JM7A 4GNDA 2K16A 1WEVA 2LGVA 3PUQA 2JMDA 2D8UA 3LQIA 4FK5A 3FJUB 3L1XA 2M13A 3FM8C 3T9KA 2B0OE 3ZYQA 3O35A 4S3OB 5KH3A 4YBSA
chains in the Genus database with same CATH topology
4AP4A 2Y43A 2G43A 5TABA 1N87A 3L1ZB 2YQLA 5FEYA 2EGPA 2ECGA 4NN2A 5H1UA 4GNGA 1ZBDB 2KGIA 2VJEA 4WZ0A 2MNYA 4LK9A 4IC2A 2LV9A 2MA6A 2ECJA 3SHBA 5G0FA 1VYXA 3LRQA 4FO9A 2F6JA 5C11A 2M1RA 2QICA 1HYIA 3GV4A 1DVPA 4AYCB 4I7BA 4IC3A 4B86C 2MD8C 2G6QA 5B79A 2L75A 5AITA 1LDJB 2LGKA 2MNZA 2CSZA 4CA1A 1BORA 3HTKC 3VK6A 2KFTA 1VD4A 2LXHC 2BAYA 3MHHA 1WEQA 3RTRB 1JM7B 4YBTA 2AN6A 5B76A 4A0CD 3ZVZB 2YHNA 5EYAF 2OXQC 3O7AA 3NG2A 3PURA 2H0DA 4MSXA 4V3LC 5D1MB 4A4CA 3L11A 3QZVA 3O37A 2HYED 2FUIA 4BBQA 2MA5A 3GL6A 2ZETC 4O64A 1WEUA 2KGGA 4C9ZA 2KREA 5B8DA 5AIUA 2IDAA 4UI9B 2LQ6A 2LGGA 2YYRA 2Y1MA 3O70A 3T6RA 4ZQLA 3ZPVE 2M85A 5B75A 5C13A 4Q6FA 3FL2A 2LDRA 1WENA 1WEPA 4R7EA 1K2FA 5H1VA 2EA6A 2YUCA 3C5KA 2JRJA 2ECVA 2QJ0A 4AUQB 4YABA 5B77A 4YAXA 2RSDA 1CHCA 5FERA 2YURA 4YBMA 2CT2A 4LKAA 4N3WA 4YC9A 4L7XA 2C2LA 4XI1A 1E4UA 2L5UA 4WZ2A 3ZVYA 1WGMA 2VJFA 2MT5A 3IHPA 2KIZA 1WEMA 2XB1A 4L58A 4A4BA 2M6MA 1IYMA 3I2DA 2YW8A 2ECNA 4GB0A 2JMIA 2H0DB 2LXPC 5G04B 2JMJA 3RPGC 4F52B 1WEWA 2DX8A 2YSMA 3U5OA 2ECWA 4BHWA 2KE1A 2PUYA 2LRIC 1WEOA 2ECTA 2QIZA 4ZUXU 4FJCA 2PNXA 2D8SA 5G05B 1Z2QA 2K4DA 5FB1A 5DKAA 3V43A 1WIMA 3U5NA 1WE9A 2CSYA 3EB5A 2Y1NA 2VNFA 3N9PA 3C6WA 5TDRA 2MD7B 2YREA 3O36A 5LKZA 2MIQA 1LDKC 3ASLA 3SOWA 2LGLA 4WZ3B 2KYUA 4QF3A 2F42A 2C2VS 3ZPV1 2VJEB 5D1KB 2L80A 2VPEA 3U5PA 2KR4A 5H9MA 4GNEA 3DQVR 3LQJA 2F6NA 2E6SA 2K1JA 2VJFB 4YADA 5LKTA 4R8PK 1FBVA 2KWOA 2YHOA 3N9OA 5KH7A 3MHSA 3U5MA 3N9NA 2FSAA 3M99A 1FP0A 2L43A 2YQMA 5JG6A 3HCUA 4V3KC 4S3OC 2CKLA 3O34A 1F62A 3KNVA 2VPGA 5TBNA 2LN0A 1X4JA 3N9MA 2YU4A 2VP7A 1WILA 3M63A 3LQHA 3T7LA 4I7CA 5KH9A 5B78A 5DINA 5J3XA 2XEUA 4ZDTA 4AVXA 2YSJA 4LLBA 5LKXA 1MM3A 1VFYA 2MUMA 2ECIA 3ZNIA 3SOUA 5TRBA 2G45A 1Z60A 2VPBA 1WESA 2M3HA 2VPDA 2KWJA 3ZTGA 2K17A 4GNFA 3KV5A 4P5OB 4B7YC 3KV6A 4TKPB 4LJNA 1WFKA 1MM2A 5D1LB 1T1HA 2UZGA 2KWKA 3RPGB 4UP0A 5H1TA 1U6GB 1G25A 2E6RA 2L0BA 1HYJA 4R2YA 1Z6UA 4A49A 1WEEA 3N9LA 2CKLB 3KQIA 4N4FA 4UP5A 3HCSA 3N9QA 5LCWB 5FB0A 3M62A 4PTBA 4YATA 1RMDA 2HDPA 4MVTA 1V87A 4WA6A 4AYCA 2KU3A 2YT5A 4X3GA 4FIPA 2EODA 2RI7A 3PHDA 5I3LA 3DPLR 2KWNA 2NAAA 4QF2A 2FUUA 1X4IA 4CCGX 1X4UA 2I50A 4LADB 4I7DA 4W4UA 1XWHA 3EB6A 1JOCA 3HCTA 4PPEA 3SOXA 5LKUA 5TDWA 3O33A 1JM7A 4GNDA 2K16A 1WEVA 2LGVA 3PUQA 2JMDA 3LQIA 4FK5A 3L1XA 3ZYQA 3O35A 4S3OB 5KH3A 4YBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP4 A;  2Y43 A;  2G43 A;  5TAB A;  1N87 A;  3L1Z B;  2YQL A;  5FEY A;  2EGP A;  2ECG A;  4NN2 A;  5H1U A;  4GNG A;  1ZBD B;  2KGI A;  2VJE A;  4WZ0 A;  2MNY A;  4LK9 A;  4IC2 A;  2LV9 A;  2MA6 A;  2ECJ A;  3SHB A;  5G0F A;  1VYX A;  3LRQ A;  4FO9 A;  2F6J A;  5C11 A;  2M1R A;  2QIC A;  1HYI A;  3GV4 A;  1DVP A;  4AYC B;  4I7B A;  4IC3 A;  4B86 C;  2MD8 C;  2G6Q A;  5B79 A;  2L75 A;  5AIT A;  1LDJ B;  2LGK A;  2MNZ A;  2CSZ A;  4CA1 A;  1BOR A;  3HTK C;  3VK6 A;  2KFT A;  1VD4 A;  2LXH C;  2BAY A;  3MHH A;  1WEQ A;  3RTR B;  1JM7 B;  4YBT A;  2AN6 A;  5B76 A;  4A0C D;  3ZVZ B;  2YHN A;  5EYA F;  2OXQ C;  3O7A A;  3NG2 A;  3PUR A;  2H0D A;  4MSX A;  4V3L C;  5D1M B;  4A4C A;  3L11 A;  3QZV A;  3O37 A;  2HYE D;  2FUI A;  4BBQ A;  2MA5 A;  3GL6 A;  2ZET C;  4O64 A;  1WEU A;  2KGG A;  4C9Z A;  2KRE A;  5B8D A;  5AIU A;  2IDA A;  4UI9 B;  2LQ6 A;  2LGG A;  2YYR A;  2Y1M A;  3O70 A;  3T6R A;  4ZQL A;  3ZPV E;  2M85 A;  5B75 A;  5C13 A;  4Q6F A;  3FL2 A;  2LDR A;  1WEN A;  1WEP A;  4R7E A;  1K2F A;  5H1V A;  2EA6 A;  2YUC A;  3C5K A;  2JRJ A;  2ECV A;  2QJ0 A;  4AUQ B;  4YAB A;  5B77 A;  4YAX A;  2RSD A;  1CHC A;  5FER A;  2YUR A;  4YBM A;  2CT2 A;  4LKA A;  4N3W A;  4YC9 A;  4L7X A;  2C2L A;  4XI1 A;  1E4U A;  2L5U A;  4WZ2 A;  3ZVY A;  1WGM A;  2VJF A;  2MT5 A;  3IHP A;  2KIZ A;  1WEM A;  2XB1 A;  4L58 A;  4A4B A;  2M6M A;  1IYM A;  3I2D A;  2YW8 A;  2ECN A;  4GB0 A;  2JMI A;  2H0D B;  2LXP C;  5G04 B;  2JMJ A;  3RPG C;  4F52 B;  1WEW A;  2DX8 A;  2YSM A;  3U5O A;  2ECW A;  4BHW A;  2KE1 A;  2PUY A;  2LRI C;  1WEO A;  2ECT A;  2QIZ A;  4ZUX U;  4FJC A;  2PNX A;  2D8S A;  5G05 B;  1Z2Q A;  2K4D A;  5FB1 A;  5DKA A;  3V43 A;  1WIM A;  3U5N A;  1WE9 A;  2CSY A;  3EB5 A;  2Y1N A;  2VNF A;  3N9P A;  3C6W A;  5TDR A;  2MD7 B;  2YRE A;  3O36 A;  5LKZ A;  2MIQ A;  1LDK C;  3ASL A;  3SOW A;  2LGL A;  4WZ3 B;  2KYU A;  4QF3 A;  2F42 A;  2C2V S;  3ZPV 1;  2VJE B;  5D1K B;  2L80 A;  2VPE A;  3U5P A;  2KR4 A;  5H9M A;  4GNE A;  3DQV R;  3LQJ A;  2F6N A;  2E6S A;  2K1J A;  2VJF B;  4YAD A;  5LKT A;  4R8P K;  1FBV A;  2KWO A;  2YHO A;  3N9O A;  5KH7 A;  3MHS A;  3U5M A;  3N9N A;  2FSA A;  3M99 A;  1FP0 A;  2L43 A;  2YQM A;  5JG6 A;  3HCU A;  4V3K C;  4S3O C;  2CKL A;  3O34 A;  1F62 A;  3KNV A;  2VPG A;  5TBN A;  2LN0 A;  1X4J A;  3N9M A;  2YU4 A;  2VP7 A;  1WIL A;  3M63 A;  3LQH A;  3T7L A;  4I7C A;  5KH9 A;  5B78 A;  5DIN A;  5J3X A;  2XEU A;  4ZDT A;  4AVX A;  2YSJ A;  4LLB A;  5LKX A;  1MM3 A;  1VFY A;  2MUM A;  2ECI A;  3ZNI A;  3SOU A;  5TRB A;  2G45 A;  1Z60 A;  2VPB A;  1WES A;  2M3H A;  2VPD A;  2KWJ A;  3ZTG A;  2K17 A;  4GNF A;  3KV5 A;  4P5O B;  4B7Y C;  3KV6 A;  4TKP B;  4LJN A;  1WFK A;  1MM2 A;  5D1L B;  1T1H A;  2UZG A;  2KWK A;  3RPG B;  4UP0 A;  5H1T A;  1U6G B;  1G25 A;  2E6R A;  2L0B A;  1HYJ A;  4R2Y A;  1Z6U A;  4A49 A;  1WEE A;  3N9L A;  2CKL B;  3KQI A;  4N4F A;  4UP5 A;  3HCS A;  3N9Q A;  5LCW B;  5FB0 A;  3M62 A;  4PTB A;  4YAT A;  1RMD A;  2HDP A;  4MVT A;  1V87 A;  4WA6 A;  4AYC A;  2KU3 A;  2YT5 A;  4X3G A;  4FIP A;  2EOD A;  2RI7 A;  3PHD A;  5I3L A;  3DPL R;  2KWN A;  2NAA A;  4QF2 A;  2FUU A;  1X4I A;  4CCG X;  1X4U A;  2I50 A;  4LAD B;  4I7D A;  4W4U A;  1XWH A;  3EB6 A;  1JOC A;  3HCT A;  4PPE A;  3SOX A;  5LKU A;  5TDW A;  3O33 A;  1JM7 A;  4GND A;  2K16 A;  1WEV A;  2LGV A;  3PUQ A;  2JMD A;  3LQI A;  4FK5 A;  3L1X A;  3ZYQ A;  3O35 A;  4S3O B;  5KH3 A;  4YBS A; 
#chains in the Genus database with same CATH topology
 4AP4 A;  2Y43 A;  2G43 A;  5TAB A;  1N87 A;  2CRR A;  3L1Z B;  2YQL A;  5FEY A;  2DJA A;  3FEH A;  2EGP A;  2ECG A;  4NN2 A;  5H1U A;  4GNG A;  1ZBD B;  2KGI A;  3DDT A;  2VJE A;  4WZ0 A;  2MNY A;  4LK9 A;  4IC2 A;  3KDE C;  2LV9 A;  2MA6 A;  4H9D A;  2ECJ A;  3SHB A;  5SVI A;  5G0F A;  1VYX A;  3LRQ A;  4FO9 A;  2F6J A;  2KKX A;  5C11 A;  2M1R A;  2QIC A;  1HYI A;  3GV4 A;  1DVP A;  4AYC B;  4I7B A;  4IC3 A;  4B86 C;  2MD8 C;  2G6Q A;  5B79 A;  2XOZ A;  2L75 A;  5AIT A;  1LDJ B;  2LGK A;  2EGM A;  2CSZ A;  2MNZ A;  2RR4 A;  4CA1 A;  1BOR A;  3HTK C;  3VK6 A;  2KFT A;  1VD4 A;  2KKY A;  2LXH C;  2E61 A;  2BAY A;  3MHH A;  1WEQ A;  3RTR B;  3LDY A;  1JM7 B;  4YBT A;  2XOC A;  2AN6 A;  2JM3 A;  3LJU X;  5B76 A;  4A0C D;  3ZVZ B;  3PLW A;  2YHN A;  5EYA F;  2OXQ C;  2MKE A;  3O7A A;  3NG2 A;  2IQJ A;  2XP0 A;  2H0D A;  3PUR A;  4MSX A;  4V3L C;  5D1M B;  4A4C A;  3L11 A;  3QZV A;  3O37 A;  2HYE D;  2FUI A;  4BBQ A;  2MA5 A;  3GL6 A;  2ZET C;  4O62 A;  4O64 A;  1WEU A;  2KGG A;  4C9Z A;  2KRE A;  5B8D A;  5AIU A;  2IDA A;  4UI9 B;  2LQ6 A;  2LGG A;  2YYR A;  2Y1M A;  3O70 A;  3T6R A;  4ZQL A;  3ZPV E;  2M85 A;  5B75 A;  5SVI B;  5C13 A;  4Q6F A;  3FL2 A;  2LDR A;  1WEN A;  1WEP A;  4R7E A;  1K2F A;  5H1V A;  2EA6 A;  2YUC A;  3C5K A;  2JUN A;  3Q1D A;  2JRJ A;  2ECV A;  2QJ0 A;  4AUQ B;  4YAB A;  5B77 A;  4YAX A;  3MDB C;  2RSD A;  1CHC A;  2FD4 A;  5FER A;  2YUR A;  4YBM A;  2CT2 A;  4LKA A;  4N3W A;  4YC9 A;  4L7X A;  2C2L A;  4XI1 A;  1E4U A;  2L5U A;  4WZ2 A;  3ZVY A;  1WGM A;  2VJF A;  2MT5 A;  3IHP A;  2KIZ A;  1WEM A;  2XB1 A;  4L58 A;  4A4B A;  2M6M A;  1IYM A;  3I2D A;  2DSM A;  2YW8 A;  2ECN A;  4GB0 A;  2JMI A;  2CSV A;  2H0D B;  2LXP C;  5G04 B;  2JMJ A;  3RPG C;  4F52 B;  1WEW A;  2DX8 A;  2EXU A;  2YSM A;  3U5O A;  5SVX A;  2ECW A;  4BHW A;  2KE1 A;  2PUY A;  2LRI C;  1WEO A;  2ECT A;  2QIZ A;  3M7K A;  4ZUX U;  4FJC A;  2PNX A;  4QQ4 A;  2D8S A;  5G05 B;  4Z0O A;  1Z2Q A;  2K4D A;  4F1P A;  5FB1 A;  5DKA A;  3V43 A;  1WIM A;  3U5N A;  1WE9 A;  2P57 A;  2XOY A;  2CSY A;  3EB5 A;  2Y1N A;  2VNF A;  3N9P A;  3C6W A;  5TDR A;  2MD7 B;  2YRE A;  3O36 A;  5LKZ A;  2MIQ A;  1LDK C;  3ASL A;  3SOW A;  2LGL A;  4WZ3 B;  2KYU A;  4QF3 A;  2LAU A;  2F42 A;  2C2V S;  3ZPV 1;  2VJE B;  5D1K B;  2L80 A;  2VPE A;  3U5P A;  2KR4 A;  4OGE A;  5H9M A;  4GNE A;  3DQV R;  4OGC A;  3LQJ A;  2F6N A;  2E6S A;  2K1J A;  2VJF B;  4YAD A;  5LKT A;  4R8P K;  1FBV A;  1DCQ A;  2KWO A;  2YHO A;  3N9O A;  5KH7 A;  3MHS A;  3U5M A;  3JUE A;  3N9N A;  2FSA A;  3M99 A;  1FP0 A;  2L43 A;  2YQM A;  2FFW A;  5JG6 A;  3HCU A;  4V3K C;  4S3O C;  2CKL A;  3O34 A;  1F62 A;  5K3Q A;  3O47 A;  3KNV A;  2VPG A;  5TBN A;  2LN0 A;  1X4J A;  3N9M A;  2YU4 A;  3H7H A;  2VP7 A;  1WIL A;  3M63 A;  3SUB A;  3LQH A;  3T7L A;  4I7C A;  5KH9 A;  5B78 A;  5DIN A;  5J3X A;  2XEU A;  4ZDT A;  4AVX A;  2YSJ A;  4LLB A;  3LVR E;  5LKX A;  1MM3 A;  1VFY A;  2CRW A;  2MUM A;  2ECI A;  3ZNI A;  3SOU A;  2G45 A;  5TRB A;  1Z60 A;  2VPB A;  2L7P A;  1WES A;  3LVQ E;  2M3H A;  2VPD A;  2KWJ A;  3ZTG A;  2K17 A;  4GNF A;  3KV5 A;  4P5O B;  4B7Y C;  3KV6 A;  2CON A;  4TKP B;  2YVR A;  4LJN A;  1WFK A;  1MM2 A;  5D1L B;  2OWA A;  4Z0R A;  1T1H A;  3DWD A;  2UZG A;  2KWK A;  3RPG B;  3E2D A;  4UP0 A;  5H1T A;  1U6G B;  1G25 A;  2E6R A;  2L0B A;  5SVY A;  1HYJ A;  4R2Y A;  1Z6U A;  4A49 A;  1WEE A;  3N9L A;  2CKL B;  3KQI A;  4N4F A;  4UP5 A;  3HCS A;  3N9Q A;  5LCW B;  5FB0 A;  3M62 A;  4PTB A;  4YAT A;  1RMD A;  2HDP A;  4MVT A;  1V87 A;  1MBM A;  4WA6 A;  4AYC A;  2KU3 A;  2YT5 A;  4X3G A;  4FIP A;  2EOD A;  2RI7 A;  3PHD A;  5I3L A;  3DPL R;  2KWN A;  2NAA A;  4QF2 A;  3FAO A;  2FUU A;  1X4I A;  4CCG X;  1X4U A;  2I50 A;  4LAD B;  4I7D A;  4W4U A;  1XWH A;  3FAN A;  3EB6 A;  1JOC A;  3HCT A;  4PPE A;  3SOX A;  5LKU A;  5TDW A;  3O33 A;  1JM7 A;  4GND A;  2K16 A;  1WEV A;  2LGV A;  3PUQ A;  2JMD A;  2D8U A;  3LQI A;  4FK5 A;  3FJU B;  3L1X A;  2M13 A;  3FM8 C;  3T9K A;  2B0O E;  3ZYQ A;  3O35 A;  4S3O B;  5KH3 A;  4YBS A; 
#chains in the Genus database with same CATH homology
 4AP4 A;  2Y43 A;  2G43 A;  5TAB A;  1N87 A;  3L1Z B;  2YQL A;  5FEY A;  2EGP A;  2ECG A;  4NN2 A;  5H1U A;  4GNG A;  1ZBD B;  2KGI A;  2VJE A;  4WZ0 A;  2MNY A;  4LK9 A;  4IC2 A;  2LV9 A;  2MA6 A;  2ECJ A;  3SHB A;  5G0F A;  1VYX A;  3LRQ A;  4FO9 A;  2F6J A;  5C11 A;  2M1R A;  2QIC A;  1HYI A;  3GV4 A;  1DVP A;  4AYC B;  4I7B A;  4IC3 A;  4B86 C;  2MD8 C;  2G6Q A;  5B79 A;  2L75 A;  5AIT A;  1LDJ B;  2LGK A;  2MNZ A;  2CSZ A;  4CA1 A;  1BOR A;  3HTK C;  3VK6 A;  2KFT A;  1VD4 A;  2LXH C;  2BAY A;  3MHH A;  1WEQ A;  3RTR B;  1JM7 B;  4YBT A;  2AN6 A;  5B76 A;  4A0C D;  3ZVZ B;  2YHN A;  5EYA F;  2OXQ C;  3O7A A;  3NG2 A;  3PUR A;  2H0D A;  4MSX A;  4V3L C;  5D1M B;  4A4C A;  3L11 A;  3QZV A;  3O37 A;  2HYE D;  2FUI A;  4BBQ A;  2MA5 A;  3GL6 A;  2ZET C;  4O64 A;  1WEU A;  2KGG A;  4C9Z A;  2KRE A;  5B8D A;  5AIU A;  2IDA A;  4UI9 B;  2LQ6 A;  2LGG A;  2YYR A;  2Y1M A;  3O70 A;  3T6R A;  4ZQL A;  3ZPV E;  2M85 A;  5B75 A;  5C13 A;  4Q6F A;  3FL2 A;  2LDR A;  1WEN A;  1WEP A;  4R7E A;  1K2F A;  5H1V A;  2EA6 A;  2YUC A;  3C5K A;  2JRJ A;  2ECV A;  2QJ0 A;  4AUQ B;  4YAB A;  5B77 A;  4YAX A;  2RSD A;  1CHC A;  5FER A;  2YUR A;  4YBM A;  2CT2 A;  4LKA A;  4N3W A;  4YC9 A;  4L7X A;  2C2L A;  4XI1 A;  1E4U A;  2L5U A;  4WZ2 A;  3ZVY A;  1WGM A;  2VJF A;  2MT5 A;  3IHP A;  2KIZ A;  1WEM A;  2XB1 A;  4L58 A;  4A4B A;  2M6M A;  1IYM A;  3I2D A;  2YW8 A;  2ECN A;  4GB0 A;  2JMI A;  2H0D B;  2LXP C;  5G04 B;  2JMJ A;  3RPG C;  4F52 B;  1WEW A;  2DX8 A;  2YSM A;  3U5O A;  2ECW A;  4BHW A;  2KE1 A;  2PUY A;  2LRI C;  1WEO A;  2ECT A;  2QIZ A;  4ZUX U;  4FJC A;  2PNX A;  2D8S A;  5G05 B;  1Z2Q A;  2K4D A;  5FB1 A;  5DKA A;  3V43 A;  1WIM A;  3U5N A;  1WE9 A;  2CSY A;  3EB5 A;  2Y1N A;  2VNF A;  3N9P A;  3C6W A;  5TDR A;  2MD7 B;  2YRE A;  3O36 A;  5LKZ A;  2MIQ A;  1LDK C;  3ASL A;  3SOW A;  2LGL A;  4WZ3 B;  2KYU A;  4QF3 A;  2F42 A;  2C2V S;  3ZPV 1;  2VJE B;  5D1K B;  2L80 A;  2VPE A;  3U5P A;  2KR4 A;  5H9M A;  4GNE A;  3DQV R;  3LQJ A;  2F6N A;  2E6S A;  2K1J A;  2VJF B;  4YAD A;  5LKT A;  4R8P K;  1FBV A;  2KWO A;  2YHO A;  3N9O A;  5KH7 A;  3MHS A;  3U5M A;  3N9N A;  2FSA A;  3M99 A;  1FP0 A;  2L43 A;  2YQM A;  5JG6 A;  3HCU A;  4V3K C;  4S3O C;  2CKL A;  3O34 A;  1F62 A;  3KNV A;  2VPG A;  5TBN A;  2LN0 A;  1X4J A;  3N9M A;  2YU4 A;  2VP7 A;  1WIL A;  3M63 A;  3LQH A;  3T7L A;  4I7C A;  5KH9 A;  5B78 A;  5DIN A;  5J3X A;  2XEU A;  4ZDT A;  4AVX A;  2YSJ A;  4LLB A;  5LKX A;  1MM3 A;  1VFY A;  2MUM A;  2ECI A;  3ZNI A;  3SOU A;  5TRB A;  2G45 A;  1Z60 A;  2VPB A;  1WES A;  2M3H A;  2VPD A;  2KWJ A;  3ZTG A;  2K17 A;  4GNF A;  3KV5 A;  4P5O B;  4B7Y C;  3KV6 A;  4TKP B;  4LJN A;  1WFK A;  1MM2 A;  5D1L B;  1T1H A;  2UZG A;  2KWK A;  3RPG B;  4UP0 A;  5H1T A;  1U6G B;  1G25 A;  2E6R A;  2L0B A;  1HYJ A;  4R2Y A;  1Z6U A;  4A49 A;  1WEE A;  3N9L A;  2CKL B;  3KQI A;  4N4F A;  4UP5 A;  3HCS A;  3N9Q A;  5LCW B;  5FB0 A;  3M62 A;  4PTB A;  4YAT A;  1RMD A;  2HDP A;  4MVT A;  1V87 A;  4WA6 A;  4AYC A;  2KU3 A;  2YT5 A;  4X3G A;  4FIP A;  2EOD A;  2RI7 A;  3PHD A;  5I3L A;  3DPL R;  2KWN A;  2NAA A;  4QF2 A;  2FUU A;  1X4I A;  4CCG X;  1X4U A;  2I50 A;  4LAD B;  4I7D A;  4W4U A;  1XWH A;  3EB6 A;  1JOC A;  3HCT A;  4PPE A;  3SOX A;  5LKU A;  5TDW A;  3O33 A;  1JM7 A;  4GND A;  2K16 A;  1WEV A;  2LGV A;  3PUQ A;  2JMD A;  3LQI A;  4FK5 A;  3L1X A;  3ZYQ A;  3O35 A;  4S3O B;  5KH3 A;  4YBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...