2VPDA

Decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'VYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PYGOPUS HOMOLOG 1
publication title Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 14
structure length 59
sequence length 59
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2vpdA00
2ECTA 5FB0A 2E6SA 4CCGX 4AP4A 4UP5A 3U5PA 3MHSA 1WESA 3FL2A 2XEUA 4B86C 4LLBA 3O7AA 5G05B 2OXQC 1WGMA 5B77A 2MIQA 2FUUA 2CSYA 1HYJA 2MUMA 2K4DA 4C9ZA 4PTBA 4R2YA 4IC2A 4N4FA 2YYRA 2G45A 2YT5A 1Z2QA 1WEMA 5AIUA 1WILA 1G25A 2K1JA 5D1MB 3EB6A 1DVPA 4GB0A 5LKXA 2C2LA 2H0DB 5DKAA 5B75A 3L11A 2KWNA 4B7YC 3GL6A 2CT2A 3RTRB 3U5OA 3SHBA 2KWJA 4L7XA 2JMIA 1WEVA 3V43A 4I7CA 1T1HA 3NG2A 5I3LA 4X3GA 5TBNA 2KYUA 4Q6FA 4YABA 1X4UA 2K17A 3SOXA 4S3OB 1X4JA 2M6MA 4LK9A 2LGGA 3KV5A 2ECNA 4BHWA 2AN6A 2Y43A 5JG6A 5KH9A 1X4IA 4XI1A 4TKPB 2VPEA 2H0DA 3O37A 3LQJA 3ASLA 2UZGA 2RI7A 4BBQA 5KH7A 3QZVA 3M63A 4A49A 1LDJB 4AYCA 5DINA 2EA6A 1CHCA 5B76A 4YBTA 2LGKA 5FB1A 2M85A 2KREA 3LRQA 3RPGB 4I7DA 1IYMA 5D1KB 4GNGA 2HDPA 1WFKA 4GNFA 2Y1NA 3L1ZB 1K2FA 1VFYA 3O70A 5H1UA 1HYIA 5TABA 2LV9A 2ECVA 3T7LA 3M99A 1F62A 2KR4A 1JOCA 4YBMA 1JM7B 2MA5A 3L1XA 5C11A 5LKUA 5B8DA 5AITA 2E6RA 3SOWA 3KV6A 2M1RA 4YAXA 2YREA 4LADB 3MHHA 2G43A 2Y1MA 2YSJA 3KNVA 4P5OB 5B79A 3HCUA 3C5KA 2L75A 5C13A 5EYAF 3U5NA 5FEYA 4LJNA 4ZQLA 2KGIA 1WEPA 3DPLR 1VYXA 2YW8A 4YBSA 4AYCB 3T6RA 2L5UA 2PUYA 2MD7B 2L43A 2VP7A 4FIPA 2BAYA 5J3XA 3LQHA 2MD8C 3M62A 3VK6A 4ZDTA 1MM3A 3GV4A 3HTKC 3ZPV1 5H1VA 3HCSA 4MVTA 1JM7A 5LKZA 2ECJA 2QIZA 1WENA 2D8SA 2KU3A 3DQVR 4FO9A 4A4CA 5G04B 1WEOA 2VJFA 2YURA 2MA6A 4YADA 4AVXA 2F6JA 2VNFA 1LDKC 3O36A 2MNZA 1N87A 2LXPC 2NAAA 1FBVA 4UP0A 2IDAA 3PHDA 2ECWA 2YHOA 2F42A 2C2VS 3O34A 4GNEA 4R8PK 1WEUA 2LXHC 2KE1A 2YHNA 3IHPA 2VPBA 3N9MA 4LKAA 2QJ0A 5G0FA 2LGVA 2G6QA 5KH3A 5H9MA 2I50A 1Z60A 3N9NA 2CKLA 2M3HA 4F52B 4V3LC 5TDWA 4AUQB 4WA6A 2LDRA 4V3KC 1XWHA 2ZETC 4IC3A 4NN2A 2KIZA 4O64A 2MNYA 2KGGA 2F6NA 5LCWB 1E4UA 2ECGA 4MSXA 3KQIA 2VJFB 3ZPVE 1U6GB 2FUIA 2L0BA 3C6WA 2VJEB 4A4BA 2ECIA 2CSZA 4CA1A 2JMJA 4S3OC 2YU4A 1WE9A 1WEWA 2HYED 2FSAA 2YUCA 4GNDA 3SOUA 2DX8A 2YQLA 2KWKA 3N9QA 3N9PA 4N3WA 2L80A 3HCTA 1ZBDB 2K16A 2RSDA 4QF3A 2EGPA 2KFTA 2CKLB 4W4UA 5B78A 1RMDA 5D1LB 3ZTGA 5LKTA 2QICA 1WEQA 3ZVYA 1WEEA 4ZUXU 2JMDA 4UI9B 2LN0A 2LQ6A 3RPGC 2EODA 2LGLA 3ZNIA 3EB5A 2VJEA 2VPGA 2JRJA 3PURA 4A0CD 3N9OA 4YC9A 5FERA 1VD4A 1WIMA 2VPDA 4PPEA 3ZYQA 1BORA 3LQIA 2XB1A 2YSMA 5TRBA 2MT5A 4FK5A 3PUQA 5H1TA 4FJCA 5TDRA 3O33A 3U5MA 2YQMA 4WZ0A 2PNXA 4I7BA 2LRIC 4WZ2A 1MM2A 4L58A 1Z6UA 4YATA 3ZVZB 4R7EA 3I2DA 1FP0A 4QF2A 2KWOA 1V87A 3N9LA 3O35A 4WZ3B
chains in the Genus database with same CATH superfamily
2ECTA 5FB0A 2E6SA 4CCGX 4AP4A 4UP5A 2JM3A 3U5PA 2EXUA 3FM8C 1WESA 3MHSA 3FL2A 2XEUA 4B86C 4LLBA 3O7AA 5G05B 2OXQC 1WGMA 5B77A 2MIQA 2FUUA 2CSYA 1HYJA 2MUMA 2K4DA 4C9ZA 3DDTA 4PTBA 4R2YA 4IC2A 4N4FA 2YYRA 2G45A 2YT5A 1Z2QA 1WEMA 5AIUA 1WILA 1G25A 2M13A 2K1JA 5D1MB 3EB6A 3Q1DA 1DVPA 4GB0A 5LKXA 2C2LA 3T9KA 2H0DB 5DKAA 5B75A 3L11A 3SUBA 2KWNA 4B7YC 3GL6A 2CT2A 3JUEA 5SVYA 3RTRB 2FFWA 3U5OA 3SHBA 2KWJA 4L7XA 2JMIA 1WEVA 3V43A 4I7CA 1T1HA 3MDBC 3NG2A 3LVQE 5I3LA 4X3GA 5TBNA 2KYUA 4Q6FA 4YABA 1X4UA 2K17A 3LVRE 3SOXA 4S3OB 1X4JA 2M6MA 4LK9A 2LGGA 3KV5A 2ECNA 4BHWA 2AN6A 2Y43A 5JG6A 5KH9A 1X4IA 4XI1A 4TKPB 2VPEA 2H0DA 3LDYA 3O37A 3LQJA 3ASLA 2UZGA 2RI7A 4BBQA 5KH7A 3QZVA 3LJUX 2LAUA 3M63A 4A49A 1LDJB 4AYCA 2P57A 2OWAA 5DINA 4O62A 2EA6A 1CHCA 5B76A 4YBTA 2LGKA 5FB1A 2M85A 5SVIB 2KREA 3LRQA 3RPGB 2XP0A 4I7DA 2D8UA 1IYMA 5D1KB 4GNGA 2HDPA 1WFKA 5SVXA 3FJUB 4GNFA 2Y1NA 3L1ZB 1K2FA 1VFYA 2KKXA 3O70A 5H1UA 1HYIA 5TABA 2LV9A 3FAOA 2ECVA 3T7LA 3M99A 1F62A 2KR4A 1JOCA 4YBMA 1JM7B 2MA5A 3L1XA 5C11A 5LKUA 2KKYA 5B8DA 5AITA 2E6RA 3SOWA 3KV6A 2M1RA 4YAXA 2YREA 4LADB 3MHHA 2G43A 5SVIA 2Y1MA 2YSJA 3KNVA 4P5OB 2CRWA 2XOZA 3HCUA 3C5KA 5B79A 2L75A 5C13A 4QQ4A 5EYAF 3U5NA 5FEYA 4LJNA 4ZQLA 2KGIA 1WEPA 3DPLR 1VYXA 2YW8A 4YBSA 4AYCB 3T6RA 2L5UA 2PUYA 2RR4A 2MD7B 2L43A 2VP7A 4FIPA 2BAYA 5J3XA 3O47A 3LQHA 2MD8C 3M62A 3VK6A 4ZDTA 1MM3A 3GV4A 3HTKC 3ZPV1 2DJAA 5H1VA 3HCSA 4MVTA 1JM7A 5LKZA 2ECJA 2QIZA 3FANA 1WENA 2D8SA 5K3QA 2KU3A 3DQVR 2JUNA 4FO9A 4A4CA 5G04B 1WEOA 2VJFA 2YURA 2MA6A 4YADA 4AVXA 2F6JA 2DSMA 2VNFA 1LDKC 3O36A 2MNZA 1N87A 2LXPC 4F1PA 2NAAA 1FBVA 4UP0A 2IDAA 3PHDA 2ECWA 2YHOA 2F42A 2XOYA 2C2VS 3O34A 3E2DA 4GNEA 4R8PK 1WEUA 2LXHC 2KE1A 2YHNA 3IHPA 2EGMA 2VPBA 3N9MA 4LKAA 2QJ0A 2CONA 5G0FA 2LGVA 2G6QA 5KH3A 3H7HA 5H9MA 2I50A 4OGCA 1Z60A 3FEHA 3N9NA 2CKLA 2M3HA 4F52B 4V3LC 4Z0RA 5TDWA 2FD4A 4OGEA 4AUQB 2CRRA 4WA6A 2LDRA 4Z0OA 4H9DA 4V3KC 1XWHA 2ZETC 4IC3A 4NN2A 2KIZA 4O64A 2MNYA 2KGGA 2F6NA 5LCWB 1E4UA 2ECGA 4MSXA 3KQIA 2VJFB 3ZPVE 1U6GB 2FUIA 2L0BA 3M7KA 3C6WA 2VJEB 4A4BA 2ECIA 2CSZA 4CA1A 2E61A 2JMJA 4S3OC 2YU4A 1WE9A 1WEWA 2HYED 2FSAA 1MBMA 2YUCA 4GNDA 3SOUA 2DX8A 2YQLA 2KWKA 3N9QA 3N9PA 4N3WA 2L80A 3HCTA 1ZBDB 2K16A 2RSDA 4QF3A 2EGPA 2KFTA 2CKLB 2XOCA 4W4UA 5B78A 1RMDA 5D1LB 3ZTGA 5LKTA 2QICA 1WEQA 3ZVYA 1WEEA 3PLWA 4ZUXU 2JMDA 4UI9B 2LN0A 2LQ6A 3RPGC 2EODA 2LGLA 3ZNIA 3EB5A 2VJEA 2IQJA 2CSVA 2JRJA 2VPGA 3PURA 4A0CD 3N9OA 4YC9A 5FERA 1VD4A 1WIMA 2L7PA 2VPDA 4PPEA 3ZYQA 3DWDA 1BORA 3LQIA 2XB1A 2YSMA 5TRBA 2MT5A 4FK5A 3PUQA 5H1TA 4FJCA 2MKEA 5TDRA 3O33A 3U5MA 2YQMA 4WZ0A 2PNXA 4I7BA 2LRIC 4WZ2A 1MM2A 4L58A 1Z6UA 4YATA 3ZVZB 2YVRA 1DCQA 4R7EA 3I2DA 4QF2A 1FP0A 2B0OE 2KWOA 1V87A 3N9LA 3KDEC 3O35A 4WZ3B
chains in the Genus database with same CATH topology
2ECTA 5FB0A 2E6SA 4CCGX 4AP4A 4UP5A 3U5PA 3MHSA 1WESA 3FL2A 2XEUA 4B86C 4LLBA 3O7AA 5G05B 2OXQC 1WGMA 5B77A 2MIQA 2FUUA 2CSYA 1HYJA 2MUMA 2K4DA 4C9ZA 4PTBA 4R2YA 4IC2A 4N4FA 2YYRA 2G45A 2YT5A 1Z2QA 1WEMA 5AIUA 1WILA 1G25A 2K1JA 5D1MB 3EB6A 1DVPA 4GB0A 5LKXA 2C2LA 2H0DB 5DKAA 5B75A 3L11A 2KWNA 4B7YC 3GL6A 2CT2A 3RTRB 3U5OA 3SHBA 2KWJA 4L7XA 2JMIA 1WEVA 3V43A 4I7CA 1T1HA 3NG2A 5I3LA 4X3GA 5TBNA 2KYUA 4Q6FA 4YABA 1X4UA 2K17A 3SOXA 4S3OB 1X4JA 2M6MA 4LK9A 2LGGA 3KV5A 2ECNA 4BHWA 2AN6A 2Y43A 5JG6A 5KH9A 1X4IA 4XI1A 4TKPB 2VPEA 2H0DA 3O37A 3LQJA 3ASLA 2UZGA 2RI7A 4BBQA 5KH7A 3QZVA 3M63A 4A49A 1LDJB 4AYCA 5DINA 2EA6A 1CHCA 5B76A 4YBTA 2LGKA 5FB1A 2M85A 2KREA 3LRQA 3RPGB 4I7DA 1IYMA 5D1KB 4GNGA 2HDPA 1WFKA 4GNFA 2Y1NA 3L1ZB 1K2FA 1VFYA 3O70A 5H1UA 1HYIA 5TABA 2LV9A 2ECVA 3T7LA 3M99A 1F62A 2KR4A 1JOCA 4YBMA 1JM7B 2MA5A 3L1XA 5C11A 5LKUA 5B8DA 5AITA 2E6RA 3SOWA 3KV6A 2M1RA 4YAXA 2YREA 4LADB 3MHHA 2G43A 2Y1MA 2YSJA 3KNVA 4P5OB 5B79A 3HCUA 3C5KA 2L75A 5C13A 5EYAF 3U5NA 5FEYA 4LJNA 4ZQLA 2KGIA 1WEPA 3DPLR 1VYXA 2YW8A 4YBSA 4AYCB 3T6RA 2L5UA 2PUYA 2MD7B 2L43A 2VP7A 4FIPA 2BAYA 5J3XA 3LQHA 2MD8C 3M62A 3VK6A 4ZDTA 1MM3A 3GV4A 3HTKC 3ZPV1 5H1VA 3HCSA 4MVTA 1JM7A 5LKZA 2ECJA 2QIZA 1WENA 2D8SA 2KU3A 3DQVR 4FO9A 4A4CA 5G04B 1WEOA 2VJFA 2YURA 2MA6A 4YADA 4AVXA 2F6JA 2VNFA 1LDKC 3O36A 2MNZA 1N87A 2LXPC 2NAAA 1FBVA 4UP0A 2IDAA 3PHDA 2ECWA 2YHOA 2F42A 2C2VS 3O34A 4GNEA 4R8PK 1WEUA 2LXHC 2KE1A 2YHNA 3IHPA 2VPBA 3N9MA 4LKAA 2QJ0A 5G0FA 2LGVA 2G6QA 5KH3A 5H9MA 2I50A 1Z60A 3N9NA 2CKLA 2M3HA 4F52B 4V3LC 5TDWA 4AUQB 4WA6A 2LDRA 4V3KC 1XWHA 2ZETC 4IC3A 4NN2A 2KIZA 4O64A 2MNYA 2KGGA 2F6NA 5LCWB 1E4UA 2ECGA 4MSXA 3KQIA 2VJFB 3ZPVE 1U6GB 2FUIA 2L0BA 3C6WA 2VJEB 4A4BA 2ECIA 2CSZA 4CA1A 2JMJA 4S3OC 2YU4A 1WE9A 1WEWA 2HYED 2FSAA 2YUCA 4GNDA 3SOUA 2DX8A 2YQLA 2KWKA 3N9QA 3N9PA 4N3WA 2L80A 3HCTA 1ZBDB 2K16A 2RSDA 4QF3A 2EGPA 2KFTA 2CKLB 4W4UA 5B78A 1RMDA 5D1LB 3ZTGA 5LKTA 2QICA 1WEQA 3ZVYA 1WEEA 4ZUXU 2JMDA 4UI9B 2LN0A 2LQ6A 3RPGC 2EODA 2LGLA 3ZNIA 3EB5A 2VJEA 2VPGA 2JRJA 3PURA 4A0CD 3N9OA 4YC9A 5FERA 1VD4A 1WIMA 2VPDA 4PPEA 3ZYQA 1BORA 3LQIA 2XB1A 2YSMA 5TRBA 2MT5A 4FK5A 3PUQA 5H1TA 4FJCA 5TDRA 3O33A 3U5MA 2YQMA 4WZ0A 2PNXA 4I7BA 2LRIC 4WZ2A 1MM2A 4L58A 1Z6UA 4YATA 3ZVZB 4R7EA 3I2DA 1FP0A 4QF2A 2KWOA 1V87A 3N9LA 3O35A 4WZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ECT A;  5FB0 A;  2E6S A;  4CCG X;  4AP4 A;  4UP5 A;  3U5P A;  3MHS A;  1WES A;  3FL2 A;  2XEU A;  4B86 C;  4LLB A;  3O7A A;  5G05 B;  2OXQ C;  1WGM A;  5B77 A;  2MIQ A;  2FUU A;  2CSY A;  1HYJ A;  2MUM A;  2K4D A;  4C9Z A;  4PTB A;  4R2Y A;  4IC2 A;  4N4F A;  2YYR A;  2G45 A;  2YT5 A;  1Z2Q A;  1WEM A;  5AIU A;  1WIL A;  1G25 A;  2K1J A;  5D1M B;  3EB6 A;  1DVP A;  4GB0 A;  5LKX A;  2C2L A;  2H0D B;  5DKA A;  5B75 A;  3L11 A;  2KWN A;  4B7Y C;  3GL6 A;  2CT2 A;  3RTR B;  3U5O A;  3SHB A;  2KWJ A;  4L7X A;  2JMI A;  1WEV A;  3V43 A;  4I7C A;  1T1H A;  3NG2 A;  5I3L A;  4X3G A;  5TBN A;  2KYU A;  4Q6F A;  4YAB A;  1X4U A;  2K17 A;  3SOX A;  4S3O B;  1X4J A;  2M6M A;  4LK9 A;  2LGG A;  3KV5 A;  2ECN A;  4BHW A;  2AN6 A;  2Y43 A;  5JG6 A;  5KH9 A;  1X4I A;  4XI1 A;  4TKP B;  2VPE A;  2H0D A;  3O37 A;  3LQJ A;  3ASL A;  2UZG A;  2RI7 A;  4BBQ A;  5KH7 A;  3QZV A;  3M63 A;  4A49 A;  1LDJ B;  4AYC A;  5DIN A;  2EA6 A;  1CHC A;  5B76 A;  4YBT A;  2LGK A;  5FB1 A;  2M85 A;  2KRE A;  3LRQ A;  3RPG B;  4I7D A;  1IYM A;  5D1K B;  4GNG A;  2HDP A;  1WFK A;  4GNF A;  2Y1N A;  3L1Z B;  1K2F A;  1VFY A;  3O70 A;  5H1U A;  1HYI A;  5TAB A;  2LV9 A;  2ECV A;  3T7L A;  3M99 A;  1F62 A;  2KR4 A;  1JOC A;  4YBM A;  1JM7 B;  2MA5 A;  3L1X A;  5C11 A;  5LKU A;  5B8D A;  5AIT A;  2E6R A;  3SOW A;  3KV6 A;  2M1R A;  4YAX A;  2YRE A;  4LAD B;  3MHH A;  2G43 A;  2Y1M A;  2YSJ A;  3KNV A;  4P5O B;  5B79 A;  3HCU A;  3C5K A;  2L75 A;  5C13 A;  5EYA F;  3U5N A;  5FEY A;  4LJN A;  4ZQL A;  2KGI A;  1WEP A;  3DPL R;  1VYX A;  2YW8 A;  4YBS A;  4AYC B;  3T6R A;  2L5U A;  2PUY A;  2MD7 B;  2L43 A;  2VP7 A;  4FIP A;  2BAY A;  5J3X A;  3LQH A;  2MD8 C;  3M62 A;  3VK6 A;  4ZDT A;  1MM3 A;  3GV4 A;  3HTK C;  3ZPV 1;  5H1V A;  3HCS A;  4MVT A;  1JM7 A;  5LKZ A;  2ECJ A;  2QIZ A;  1WEN A;  2D8S A;  2KU3 A;  3DQV R;  4FO9 A;  4A4C A;  5G04 B;  1WEO A;  2VJF A;  2YUR A;  2MA6 A;  4YAD A;  4AVX A;  2F6J A;  2VNF A;  1LDK C;  3O36 A;  2MNZ A;  1N87 A;  2LXP C;  2NAA A;  1FBV A;  4UP0 A;  2IDA A;  3PHD A;  2ECW A;  2YHO A;  2F42 A;  2C2V S;  3O34 A;  4GNE A;  4R8P K;  1WEU A;  2LXH C;  2KE1 A;  2YHN A;  3IHP A;  2VPB A;  3N9M A;  4LKA A;  2QJ0 A;  5G0F A;  2LGV A;  2G6Q A;  5KH3 A;  5H9M A;  2I50 A;  1Z60 A;  3N9N A;  2CKL A;  2M3H A;  4F52 B;  4V3L C;  5TDW A;  4AUQ B;  4WA6 A;  2LDR A;  4V3K C;  1XWH A;  2ZET C;  4IC3 A;  4NN2 A;  2KIZ A;  4O64 A;  2MNY A;  2KGG A;  2F6N A;  5LCW B;  1E4U A;  2ECG A;  4MSX A;  3KQI A;  2VJF B;  3ZPV E;  1U6G B;  2FUI A;  2L0B A;  3C6W A;  2VJE B;  4A4B A;  2ECI A;  2CSZ A;  4CA1 A;  2JMJ A;  4S3O C;  2YU4 A;  1WE9 A;  1WEW A;  2HYE D;  2FSA A;  2YUC A;  4GND A;  3SOU A;  2DX8 A;  2YQL A;  2KWK A;  3N9Q A;  3N9P A;  4N3W A;  2L80 A;  3HCT A;  1ZBD B;  2K16 A;  2RSD A;  4QF3 A;  2EGP A;  2KFT A;  2CKL B;  4W4U A;  5B78 A;  1RMD A;  5D1L B;  3ZTG A;  5LKT A;  2QIC A;  1WEQ A;  3ZVY A;  1WEE A;  4ZUX U;  2JMD A;  4UI9 B;  2LN0 A;  2LQ6 A;  3RPG C;  2EOD A;  2LGL A;  3ZNI A;  3EB5 A;  2VJE A;  2VPG A;  2JRJ A;  3PUR A;  4A0C D;  3N9O A;  4YC9 A;  5FER A;  1VD4 A;  1WIM A;  2VPD A;  4PPE A;  3ZYQ A;  1BOR A;  3LQI A;  2XB1 A;  2YSM A;  5TRB A;  2MT5 A;  4FK5 A;  3PUQ A;  5H1T A;  4FJC A;  5TDR A;  3O33 A;  3U5M A;  2YQM A;  4WZ0 A;  2PNX A;  4I7B A;  2LRI C;  4WZ2 A;  1MM2 A;  4L58 A;  1Z6U A;  4YAT A;  3ZVZ B;  4R7E A;  3I2D A;  1FP0 A;  4QF2 A;  2KWO A;  1V87 A;  3N9L A;  3O35 A;  4WZ3 B; 
#chains in the Genus database with same CATH topology
 2ECT A;  5FB0 A;  2E6S A;  4CCG X;  4AP4 A;  4UP5 A;  2JM3 A;  3U5P A;  2EXU A;  3FM8 C;  1WES A;  3MHS A;  3FL2 A;  2XEU A;  4B86 C;  4LLB A;  3O7A A;  5G05 B;  2OXQ C;  1WGM A;  5B77 A;  2MIQ A;  2FUU A;  2CSY A;  1HYJ A;  2MUM A;  2K4D A;  4C9Z A;  3DDT A;  4PTB A;  4R2Y A;  4IC2 A;  4N4F A;  2YYR A;  2G45 A;  2YT5 A;  1Z2Q A;  1WEM A;  5AIU A;  1WIL A;  1G25 A;  2M13 A;  2K1J A;  5D1M B;  3EB6 A;  3Q1D A;  1DVP A;  4GB0 A;  5LKX A;  2C2L A;  3T9K A;  2H0D B;  5DKA A;  5B75 A;  3L11 A;  3SUB A;  2KWN A;  4B7Y C;  3GL6 A;  2CT2 A;  3JUE A;  5SVY A;  3RTR B;  2FFW A;  3U5O A;  3SHB A;  2KWJ A;  4L7X A;  2JMI A;  1WEV A;  3V43 A;  4I7C A;  1T1H A;  3MDB C;  3NG2 A;  3LVQ E;  5I3L A;  4X3G A;  5TBN A;  2KYU A;  4Q6F A;  4YAB A;  1X4U A;  2K17 A;  3LVR E;  3SOX A;  4S3O B;  1X4J A;  2M6M A;  4LK9 A;  2LGG A;  3KV5 A;  2ECN A;  4BHW A;  2AN6 A;  2Y43 A;  5JG6 A;  5KH9 A;  1X4I A;  4XI1 A;  4TKP B;  2VPE A;  2H0D A;  3LDY A;  3O37 A;  3LQJ A;  3ASL A;  2UZG A;  2RI7 A;  4BBQ A;  5KH7 A;  3QZV A;  3LJU X;  2LAU A;  3M63 A;  4A49 A;  1LDJ B;  4AYC A;  2P57 A;  2OWA A;  5DIN A;  4O62 A;  2EA6 A;  1CHC A;  5B76 A;  4YBT A;  2LGK A;  5FB1 A;  2M85 A;  5SVI B;  2KRE A;  3LRQ A;  3RPG B;  2XP0 A;  4I7D A;  2D8U A;  1IYM A;  5D1K B;  4GNG A;  2HDP A;  1WFK A;  5SVX A;  3FJU B;  4GNF A;  2Y1N A;  3L1Z B;  1K2F A;  1VFY A;  2KKX A;  3O70 A;  5H1U A;  1HYI A;  5TAB A;  2LV9 A;  3FAO A;  2ECV A;  3T7L A;  3M99 A;  1F62 A;  2KR4 A;  1JOC A;  4YBM A;  1JM7 B;  2MA5 A;  3L1X A;  5C11 A;  5LKU A;  2KKY A;  5B8D A;  5AIT A;  2E6R A;  3SOW A;  3KV6 A;  2M1R A;  4YAX A;  2YRE A;  4LAD B;  3MHH A;  2G43 A;  5SVI A;  2Y1M A;  2YSJ A;  3KNV A;  4P5O B;  2CRW A;  2XOZ A;  3HCU A;  3C5K A;  5B79 A;  2L75 A;  5C13 A;  4QQ4 A;  5EYA F;  3U5N A;  5FEY A;  4LJN A;  4ZQL A;  2KGI A;  1WEP A;  3DPL R;  1VYX A;  2YW8 A;  4YBS A;  4AYC B;  3T6R A;  2L5U A;  2PUY A;  2RR4 A;  2MD7 B;  2L43 A;  2VP7 A;  4FIP A;  2BAY A;  5J3X A;  3O47 A;  3LQH A;  2MD8 C;  3M62 A;  3VK6 A;  4ZDT A;  1MM3 A;  3GV4 A;  3HTK C;  3ZPV 1;  2DJA A;  5H1V A;  3HCS A;  4MVT A;  1JM7 A;  5LKZ A;  2ECJ A;  2QIZ A;  3FAN A;  1WEN A;  2D8S A;  5K3Q A;  2KU3 A;  3DQV R;  2JUN A;  4FO9 A;  4A4C A;  5G04 B;  1WEO A;  2VJF A;  2YUR A;  2MA6 A;  4YAD A;  4AVX A;  2F6J A;  2DSM A;  2VNF A;  1LDK C;  3O36 A;  2MNZ A;  1N87 A;  2LXP C;  4F1P A;  2NAA A;  1FBV A;  4UP0 A;  2IDA A;  3PHD A;  2ECW A;  2YHO A;  2F42 A;  2XOY A;  2C2V S;  3O34 A;  3E2D A;  4GNE A;  4R8P K;  1WEU A;  2LXH C;  2KE1 A;  2YHN A;  3IHP A;  2EGM A;  2VPB A;  3N9M A;  4LKA A;  2QJ0 A;  2CON A;  5G0F A;  2LGV A;  2G6Q A;  5KH3 A;  3H7H A;  5H9M A;  2I50 A;  4OGC A;  1Z60 A;  3FEH A;  3N9N A;  2CKL A;  2M3H A;  4F52 B;  4V3L C;  4Z0R A;  5TDW A;  2FD4 A;  4OGE A;  4AUQ B;  2CRR A;  4WA6 A;  2LDR A;  4Z0O A;  4H9D A;  4V3K C;  1XWH A;  2ZET C;  4IC3 A;  4NN2 A;  2KIZ A;  4O64 A;  2MNY A;  2KGG A;  2F6N A;  5LCW B;  1E4U A;  2ECG A;  4MSX A;  3KQI A;  2VJF B;  3ZPV E;  1U6G B;  2FUI A;  2L0B A;  3M7K A;  3C6W A;  2VJE B;  4A4B A;  2ECI A;  2CSZ A;  4CA1 A;  2E61 A;  2JMJ A;  4S3O C;  2YU4 A;  1WE9 A;  1WEW A;  2HYE D;  2FSA A;  1MBM A;  2YUC A;  4GND A;  3SOU A;  2DX8 A;  2YQL A;  2KWK A;  3N9Q A;  3N9P A;  4N3W A;  2L80 A;  3HCT A;  1ZBD B;  2K16 A;  2RSD A;  4QF3 A;  2EGP A;  2KFT A;  2CKL B;  2XOC A;  4W4U A;  5B78 A;  1RMD A;  5D1L B;  3ZTG A;  5LKT A;  2QIC A;  1WEQ A;  3ZVY A;  1WEE A;  3PLW A;  4ZUX U;  2JMD A;  4UI9 B;  2LN0 A;  2LQ6 A;  3RPG C;  2EOD A;  2LGL A;  3ZNI A;  3EB5 A;  2VJE A;  2IQJ A;  2CSV A;  2JRJ A;  2VPG A;  3PUR A;  4A0C D;  3N9O A;  4YC9 A;  5FER A;  1VD4 A;  1WIM A;  2L7P A;  2VPD A;  4PPE A;  3ZYQ A;  3DWD A;  1BOR A;  3LQI A;  2XB1 A;  2YSM A;  5TRB A;  2MT5 A;  4FK5 A;  3PUQ A;  5H1T A;  4FJC A;  2MKE A;  5TDR A;  3O33 A;  3U5M A;  2YQM A;  4WZ0 A;  2PNX A;  4I7B A;  2LRI C;  4WZ2 A;  1MM2 A;  4L58 A;  1Z6U A;  4YAT A;  3ZVZ B;  2YVR A;  1DCQ A;  4R7E A;  3I2D A;  4QF2 A;  1FP0 A;  2B0O E;  2KWO A;  1V87 A;  3N9L A;  3KDE C;  3O35 A;  4WZ3 B; 
#chains in the Genus database with same CATH homology
 2ECT A;  5FB0 A;  2E6S A;  4CCG X;  4AP4 A;  4UP5 A;  3U5P A;  3MHS A;  1WES A;  3FL2 A;  2XEU A;  4B86 C;  4LLB A;  3O7A A;  5G05 B;  2OXQ C;  1WGM A;  5B77 A;  2MIQ A;  2FUU A;  2CSY A;  1HYJ A;  2MUM A;  2K4D A;  4C9Z A;  4PTB A;  4R2Y A;  4IC2 A;  4N4F A;  2YYR A;  2G45 A;  2YT5 A;  1Z2Q A;  1WEM A;  5AIU A;  1WIL A;  1G25 A;  2K1J A;  5D1M B;  3EB6 A;  1DVP A;  4GB0 A;  5LKX A;  2C2L A;  2H0D B;  5DKA A;  5B75 A;  3L11 A;  2KWN A;  4B7Y C;  3GL6 A;  2CT2 A;  3RTR B;  3U5O A;  3SHB A;  2KWJ A;  4L7X A;  2JMI A;  1WEV A;  3V43 A;  4I7C A;  1T1H A;  3NG2 A;  5I3L A;  4X3G A;  5TBN A;  2KYU A;  4Q6F A;  4YAB A;  1X4U A;  2K17 A;  3SOX A;  4S3O B;  1X4J A;  2M6M A;  4LK9 A;  2LGG A;  3KV5 A;  2ECN A;  4BHW A;  2AN6 A;  2Y43 A;  5JG6 A;  5KH9 A;  1X4I A;  4XI1 A;  4TKP B;  2VPE A;  2H0D A;  3O37 A;  3LQJ A;  3ASL A;  2UZG A;  2RI7 A;  4BBQ A;  5KH7 A;  3QZV A;  3M63 A;  4A49 A;  1LDJ B;  4AYC A;  5DIN A;  2EA6 A;  1CHC A;  5B76 A;  4YBT A;  2LGK A;  5FB1 A;  2M85 A;  2KRE A;  3LRQ A;  3RPG B;  4I7D A;  1IYM A;  5D1K B;  4GNG A;  2HDP A;  1WFK A;  4GNF A;  2Y1N A;  3L1Z B;  1K2F A;  1VFY A;  3O70 A;  5H1U A;  1HYI A;  5TAB A;  2LV9 A;  2ECV A;  3T7L A;  3M99 A;  1F62 A;  2KR4 A;  1JOC A;  4YBM A;  1JM7 B;  2MA5 A;  3L1X A;  5C11 A;  5LKU A;  5B8D A;  5AIT A;  2E6R A;  3SOW A;  3KV6 A;  2M1R A;  4YAX A;  2YRE A;  4LAD B;  3MHH A;  2G43 A;  2Y1M A;  2YSJ A;  3KNV A;  4P5O B;  5B79 A;  3HCU A;  3C5K A;  2L75 A;  5C13 A;  5EYA F;  3U5N A;  5FEY A;  4LJN A;  4ZQL A;  2KGI A;  1WEP A;  3DPL R;  1VYX A;  2YW8 A;  4YBS A;  4AYC B;  3T6R A;  2L5U A;  2PUY A;  2MD7 B;  2L43 A;  2VP7 A;  4FIP A;  2BAY A;  5J3X A;  3LQH A;  2MD8 C;  3M62 A;  3VK6 A;  4ZDT A;  1MM3 A;  3GV4 A;  3HTK C;  3ZPV 1;  5H1V A;  3HCS A;  4MVT A;  1JM7 A;  5LKZ A;  2ECJ A;  2QIZ A;  1WEN A;  2D8S A;  2KU3 A;  3DQV R;  4FO9 A;  4A4C A;  5G04 B;  1WEO A;  2VJF A;  2YUR A;  2MA6 A;  4YAD A;  4AVX A;  2F6J A;  2VNF A;  1LDK C;  3O36 A;  2MNZ A;  1N87 A;  2LXP C;  2NAA A;  1FBV A;  4UP0 A;  2IDA A;  3PHD A;  2ECW A;  2YHO A;  2F42 A;  2C2V S;  3O34 A;  4GNE A;  4R8P K;  1WEU A;  2LXH C;  2KE1 A;  2YHN A;  3IHP A;  2VPB A;  3N9M A;  4LKA A;  2QJ0 A;  5G0F A;  2LGV A;  2G6Q A;  5KH3 A;  5H9M A;  2I50 A;  1Z60 A;  3N9N A;  2CKL A;  2M3H A;  4F52 B;  4V3L C;  5TDW A;  4AUQ B;  4WA6 A;  2LDR A;  4V3K C;  1XWH A;  2ZET C;  4IC3 A;  4NN2 A;  2KIZ A;  4O64 A;  2MNY A;  2KGG A;  2F6N A;  5LCW B;  1E4U A;  2ECG A;  4MSX A;  3KQI A;  2VJF B;  3ZPV E;  1U6G B;  2FUI A;  2L0B A;  3C6W A;  2VJE B;  4A4B A;  2ECI A;  2CSZ A;  4CA1 A;  2JMJ A;  4S3O C;  2YU4 A;  1WE9 A;  1WEW A;  2HYE D;  2FSA A;  2YUC A;  4GND A;  3SOU A;  2DX8 A;  2YQL A;  2KWK A;  3N9Q A;  3N9P A;  4N3W A;  2L80 A;  3HCT A;  1ZBD B;  2K16 A;  2RSD A;  4QF3 A;  2EGP A;  2KFT A;  2CKL B;  4W4U A;  5B78 A;  1RMD A;  5D1L B;  3ZTG A;  5LKT A;  2QIC A;  1WEQ A;  3ZVY A;  1WEE A;  4ZUX U;  2JMD A;  4UI9 B;  2LN0 A;  2LQ6 A;  3RPG C;  2EOD A;  2LGL A;  3ZNI A;  3EB5 A;  2VJE A;  2VPG A;  2JRJ A;  3PUR A;  4A0C D;  3N9O A;  4YC9 A;  5FER A;  1VD4 A;  1WIM A;  2VPD A;  4PPE A;  3ZYQ A;  1BOR A;  3LQI A;  2XB1 A;  2YSM A;  5TRB A;  2MT5 A;  4FK5 A;  3PUQ A;  5H1T A;  4FJC A;  5TDR A;  3O33 A;  3U5M A;  2YQM A;  4WZ0 A;  2PNX A;  4I7B A;  2LRI C;  4WZ2 A;  1MM2 A;  4L58 A;  1Z6U A;  4YAT A;  3ZVZ B;  4R7E A;  3I2D A;  1FP0 A;  4QF2 A;  2KWO A;  1V87 A;  3N9L A;  3O35 A;  4WZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...