2EODA

Solution structure of traf-type zinc finger domains (190- 248) from human tnf receptor-associated factor 4
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TNF receptor-associated factor 4
publication title Solution structure of TRAF-type zinc finger domains (190 - 248) from human TNF receptor-associated factor 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2eodA00
5LKXA 3M63A 2CSZA 4V3LC 5FB1A 4AP4A 1WEMA 1WILA 2M85A 2HDPA 2KR4A 4CA1A 3NG2A 2K1JA 5AIUA 1WEEA 2YREA 3SOXA 2CT2A 1IYMA 2YW8A 3U5MA 1WEQA 2E6SA 4LJNA 4W4UA 4NN2A 3HCTA 4QF2A 2LXPC 5D1KB 3LQHA 2KE1A 3L1ZB 3LQIA 2ECVA 1WEUA 2NAAA 2VPGA 3DQVR 5G04B 1T1HA 3O70A 2VPDA 3O35A 3I2DA 2MT5A 1DVPA 2PUYA 2IDAA 2QIZA 3N9LA 2KGGA 5H9MA 5B78A 4LLBA 2G43A 1XWHA 4WZ3B 4AUQB 2KREA 5H1UA 1FP0A 2YUCA 3T6RA 4UP0A 1WFKA 4QF3A 3M99A 4IC2A 4A49A 3ZVZB 3KQIA 1WEVA 3L1XA 5LCWB 1ZBDB 2LGLA 1JOCA 2C2VS 3O33A 2K16A 4CCGX 3GV4A 4PTBA 4XI1A 5G05B 2YHNA 5TABA 5J3XA 1JM7B 5B79A 3LQJA 1X4UA 4ZUXU 5B77A 2VJFA 2M6MA 4I7CA 2MA5A 2L80A 2Y1NA 2KWOA 1WESA 1F62A 2YHOA 3ZNIA 1VD4A 3DPLR 2CKLA 2YQMA 1WEWA 2L75A 1WGMA 4GNFA 4LADB 2VPEA 5H1VA 4WA6A 3U5OA 5FEYA 2KU3A 2LDRA 2VPBA 4FIPA 3EB5A 2XB1A 5KH9A 3T7LA 4AVXA 2BAYA 2KGIA 5G0FA 2YURA 4MVTA 4F52B 2LGKA 2MIQA 1Z6UA 1WEOA 2Y1MA 2JMDA 3FL2A 1HYIA 5I3LA 2VJEA 3ZVYA 2XEUA 3N9OA 5B75A 4N4FA 5FB0A 1VYXA 2D8SA 4I7BA 1Z60A 4LKAA 4WZ0A 2MNYA 5KH7A 4C9ZA 1MM2A 3PURA 2ECGA 4FO9A 4GNGA 2JMJA 1WIMA 4UI9B 2MD8C 4FK5A 5TDRA 4A4CA 2KWKA 1X4IA 2RI7A 2ECWA 1E4UA 1G25A 4YATA 4A4BA 2ECJA 2MUMA 4R7EA 1RMDA 2ECNA 4B7YC 4BHWA 2VNFA 3C6WA 3KNVA 2YQLA 2YU4A 3O7AA 3V43A 2FUUA 4PPEA 2FSAA 1K2FA 3KV5A 3U5NA 3O34A 4TKPB 5TBNA 2HYED 5B8DA 2DX8A 2ECTA 2MD7B 2VJFB 3C5KA 5DINA 4A0CD 2YT5A 5EYAF 2H0DA 4ZQLA 2QJ0A 4I7DA 2KYUA 2Y43A 3N9QA 1JM7A 1BORA 3SHBA 3N9NA 2PNXA 3N9MA 5B76A 4WZ2A 3U5PA 4AYCA 2C2LA 2JRJA 4GNEA 3KV6A 3O37A 2L43A 3MHSA 2F42A 2LGGA 3N9PA 3HCUA 3MHHA 4MSXA 4FJCA 1VFYA 2LN0A 3GL6A 2YYRA 3HTKC 4YADA 2JMIA 1LDJB 2M3HA 2I50A 2MA6A 1X4JA 4P5OB 1LDKC 2F6JA 2VJEB 2K17A 3ZYQA 5LKZA 1CHCA 3L11A 1WE9A 4YBMA 5C13A 4Q6FA 5KH3A 3RPGC 5JG6A 2OXQC 4IC3A 2LV9A 5AITA 4O64A 4YAXA 1Z2QA 4R2YA 2LGVA 2L0BA 2YSMA 5D1MB 5TRBA 2EA6A 4L58A 1WEPA 5LKTA 2FUIA 4YBTA 4S3OC 5FERA 4GNDA 2ZETC 3RTRB 3ZPV1 3EB6A 2EGPA 3SOUA 3VK6A 3ZTGA 4N3WA 1U6GB 5TDWA 2K4DA 4R8PK 1FBVA 4LK9A 2KIZA 4YC9A 4YABA 2KWJA 2LXHC 4B86C 5LKUA 3PUQA 5H1TA 4BBQA 5DKAA 1N87A 1HYJA 4V3KC 2M1RA 4GB0A 1MM3A 3HCSA 3QZVA 1WENA 2MNZA 2EODA 3RPGB 3ZPVE 2G6QA 2LRIC 3M62A 2H0DB 5D1LB 2G45A 3SOWA 2CKLB 2F6NA 2KWNA 3PHDA 2YSJA 1V87A 2ECIA 4L7XA 4UP5A 5C11A 4AYCB 2LQ6A 3LRQA 2AN6A 3ASLA 4S3OB 4ZDTA 3IHPA 4X3GA 2KFTA 2CSYA 4YBSA 2E6RA 2UZGA 2VP7A 2L5UA 2QICA 3O36A 2RSDA
chains in the Genus database with same CATH superfamily
5LKXA 3M63A 2CSZA 4V3LC 5FB1A 5SVIA 4AP4A 3Q1DA 1WEMA 1WILA 2M85A 2HDPA 2KR4A 4CA1A 3NG2A 3FANA 2K1JA 5AIUA 1WEEA 2YREA 3SOXA 2CT2A 1IYMA 2YW8A 3MDBC 3U5MA 1WEQA 2E6SA 4LJNA 4W4UA 4OGCA 4NN2A 3HCTA 4QF2A 2LXPC 5D1KB 3LQHA 2KE1A 3L1ZB 3LQIA 2ECVA 1WEUA 2DSMA 2NAAA 2VPGA 3DQVR 3M7KA 5G04B 1T1HA 3O70A 2VPDA 3O35A 3I2DA 2MT5A 1DVPA 2PUYA 2IDAA 2QIZA 3N9LA 2KGGA 5H9MA 5B78A 4LLBA 2G43A 1XWHA 4WZ3B 4AUQB 2KREA 1MBMA 3SUBA 5H1UA 1FP0A 2YUCA 3T6RA 2LAUA 3KDEC 4UP0A 5K3QA 1WFKA 3FJUB 4QF3A 3H7HA 3M99A 4IC2A 4Z0OA 4A49A 3ZVZB 3KQIA 2L7PA 1WEVA 3L1XA 5LCWB 1ZBDB 2LGLA 1JOCA 2C2VS 3O33A 2K16A 4CCGX 3GV4A 4PTBA 2B0OE 4XI1A 5G05B 2XOCA 4Z0RA 2YHNA 5TABA 5J3XA 1JM7B 5B79A 3LQJA 1X4UA 2EGMA 4ZUXU 5B77A 2VJFA 2M6MA 4I7CA 2MA5A 2L80A 2Y1NA 2RR4A 2JUNA 2KWOA 1WESA 1F62A 2YHOA 3ZNIA 1VD4A 3DPLR 3LJUX 3DWDA 2CKLA 2YQMA 1WEWA 2L75A 1WGMA 4GNFA 4LADB 2VPEA 3PLWA 5H1VA 4WA6A 3U5OA 5FEYA 2KU3A 2LDRA 2VPBA 4FIPA 3EB5A 2XP0A 2XOYA 2XB1A 5KH9A 3T7LA 4AVXA 2KKYA 3O47A 2BAYA 2KGIA 5G0FA 2YURA 4MVTA 2D8UA 4F52B 2LGKA 2MIQA 3LVRE 3FAOA 1Z6UA 1WEOA 2Y1MA 2JMDA 3FL2A 1HYIA 5I3LA 2VJEA 3ZVYA 2XEUA 3N9OA 5B75A 4N4FA 5FB0A 1VYXA 2D8SA 2IQJA 2CSVA 4I7BA 1Z60A 4LKAA 4WZ0A 4OGEA 2MNYA 5KH7A 4C9ZA 1MM2A 3PURA 2ECGA 4FO9A 4GNGA 2E61A 1WIMA 2JMJA 4UI9B 2MD8C 4FK5A 5TDRA 4A4CA 2KWKA 1X4IA 2MKEA 2RI7A 2ECWA 2JM3A 1E4UA 1G25A 4YATA 4A4BA 2ECJA 2MUMA 4R7EA 1RMDA 2ECNA 4B7YC 4BHWA 2VNFA 3C6WA 3KNVA 2YQLA 2YU4A 3O7AA 3V43A 2FUUA 4PPEA 2EXUA 3FM8C 2FSAA 1K2FA 2OWAA 3KV5A 3U5NA 3JUEA 3O34A 3LVQE 4TKPB 5TBNA 2HYED 5B8DA 2DX8A 2ECTA 2MD7B 2VJFB 3T9KA 3C5KA 5DINA 4A0CD 2YT5A 5EYAF 2FFWA 2H0DA 4ZQLA 2QJ0A 4I7DA 2KYUA 2Y43A 3N9QA 1JM7A 3FEHA 1BORA 3SHBA 3N9NA 2PNXA 3N9MA 5B76A 4WZ2A 2CONA 3U5PA 4AYCA 2C2LA 2JRJA 4GNEA 3KV6A 3O37A 2L43A 3MHSA 2F42A 2LGGA 2CRWA 3N9PA 3HCUA 3MHHA 4H9DA 4MSXA 3LDYA 4FJCA 1VFYA 2LN0A 2XOZA 5SVIB 3GL6A 2YYRA 5SVXA 3HTKC 4YADA 2JMIA 1LDJB 2FD4A 2M3HA 2I50A 4QQ4A 2MA6A 1X4JA 4P5OB 2M13A 1LDKC 2F6JA 2VJEB 2K17A 3ZYQA 5LKZA 1CHCA 3L11A 1WE9A 4YBMA 5C13A 4Q6FA 5KH3A 3RPGC 5JG6A 2OXQC 5SVYA 4IC3A 2LV9A 5AITA 4O64A 4YAXA 1Z2QA 2DJAA 4R2YA 2LGVA 2L0BA 2YSMA 5D1MB 5TRBA 2EA6A 4L58A 1WEPA 5LKTA 2FUIA 4YBTA 4O62A 4S3OC 5FERA 4GNDA 2ZETC 3RTRB 3ZPV1 3EB6A 2EGPA 3SOUA 3VK6A 3ZTGA 4N3WA 1U6GB 5TDWA 2K4DA 4R8PK 1DCQA 1FBVA 4LK9A 2KIZA 4YC9A 2P57A 4YABA 2KWJA 2LXHC 4B86C 5LKUA 3PUQA 5H1TA 4BBQA 5DKAA 1N87A 1HYJA 2YVRA 4V3KC 2M1RA 2CRRA 4GB0A 1MM3A 3HCSA 3QZVA 1WENA 2MNZA 2EODA 3RPGB 3ZPVE 2G6QA 2LRIC 3M62A 2H0DB 5D1LB 2G45A 3SOWA 2CKLB 2F6NA 2KWNA 3PHDA 4F1PA 2YSJA 1V87A 3E2DA 2ECIA 4L7XA 4UP5A 5C11A 4AYCB 2LQ6A 3LRQA 2AN6A 3ASLA 4S3OB 4ZDTA 3IHPA 2KKXA 4X3GA 2KFTA 2CSYA 3DDTA 4YBSA 2E6RA 2UZGA 2VP7A 2L5UA 2QICA 3O36A 2RSDA
chains in the Genus database with same CATH topology
5LKXA 3M63A 2CSZA 4V3LC 5FB1A 4AP4A 1WEMA 1WILA 2M85A 2HDPA 2KR4A 4CA1A 3NG2A 2K1JA 5AIUA 1WEEA 2YREA 3SOXA 2CT2A 1IYMA 2YW8A 3U5MA 1WEQA 2E6SA 4LJNA 4W4UA 4NN2A 3HCTA 4QF2A 2LXPC 5D1KB 3LQHA 2KE1A 3L1ZB 3LQIA 2ECVA 1WEUA 2NAAA 2VPGA 3DQVR 5G04B 1T1HA 3O70A 2VPDA 3O35A 3I2DA 2MT5A 1DVPA 2PUYA 2IDAA 2QIZA 3N9LA 2KGGA 5H9MA 5B78A 4LLBA 2G43A 1XWHA 4WZ3B 4AUQB 2KREA 5H1UA 1FP0A 2YUCA 3T6RA 4UP0A 1WFKA 4QF3A 3M99A 4IC2A 4A49A 3ZVZB 3KQIA 1WEVA 3L1XA 5LCWB 1ZBDB 2LGLA 1JOCA 2C2VS 3O33A 2K16A 4CCGX 3GV4A 4PTBA 4XI1A 5G05B 2YHNA 5TABA 5J3XA 1JM7B 5B79A 3LQJA 1X4UA 4ZUXU 5B77A 2VJFA 2M6MA 4I7CA 2MA5A 2L80A 2Y1NA 2KWOA 1WESA 1F62A 2YHOA 3ZNIA 1VD4A 3DPLR 2CKLA 2YQMA 1WEWA 2L75A 1WGMA 4GNFA 4LADB 2VPEA 5H1VA 4WA6A 3U5OA 5FEYA 2KU3A 2LDRA 2VPBA 4FIPA 3EB5A 2XB1A 5KH9A 3T7LA 4AVXA 2BAYA 2KGIA 5G0FA 2YURA 4MVTA 4F52B 2LGKA 2MIQA 1Z6UA 1WEOA 2Y1MA 2JMDA 3FL2A 1HYIA 5I3LA 2VJEA 3ZVYA 2XEUA 3N9OA 5B75A 4N4FA 5FB0A 1VYXA 2D8SA 4I7BA 1Z60A 4LKAA 4WZ0A 2MNYA 5KH7A 4C9ZA 1MM2A 3PURA 2ECGA 4FO9A 4GNGA 2JMJA 1WIMA 4UI9B 2MD8C 4FK5A 5TDRA 4A4CA 2KWKA 1X4IA 2RI7A 2ECWA 1E4UA 1G25A 4YATA 4A4BA 2ECJA 2MUMA 4R7EA 1RMDA 2ECNA 4B7YC 4BHWA 2VNFA 3C6WA 3KNVA 2YQLA 2YU4A 3O7AA 3V43A 2FUUA 4PPEA 2FSAA 1K2FA 3KV5A 3U5NA 3O34A 4TKPB 5TBNA 2HYED 5B8DA 2DX8A 2ECTA 2MD7B 2VJFB 3C5KA 5DINA 4A0CD 2YT5A 5EYAF 2H0DA 4ZQLA 2QJ0A 4I7DA 2KYUA 2Y43A 3N9QA 1JM7A 1BORA 3SHBA 3N9NA 2PNXA 3N9MA 5B76A 4WZ2A 3U5PA 4AYCA 2C2LA 2JRJA 4GNEA 3KV6A 3O37A 2L43A 3MHSA 2F42A 2LGGA 3N9PA 3HCUA 3MHHA 4MSXA 4FJCA 1VFYA 2LN0A 3GL6A 2YYRA 3HTKC 4YADA 2JMIA 1LDJB 2M3HA 2I50A 2MA6A 1X4JA 4P5OB 1LDKC 2F6JA 2VJEB 2K17A 3ZYQA 5LKZA 1CHCA 3L11A 1WE9A 4YBMA 5C13A 4Q6FA 5KH3A 3RPGC 5JG6A 2OXQC 4IC3A 2LV9A 5AITA 4O64A 4YAXA 1Z2QA 4R2YA 2LGVA 2L0BA 2YSMA 5D1MB 5TRBA 2EA6A 4L58A 1WEPA 5LKTA 2FUIA 4YBTA 4S3OC 5FERA 4GNDA 2ZETC 3RTRB 3ZPV1 3EB6A 2EGPA 3SOUA 3VK6A 3ZTGA 4N3WA 1U6GB 5TDWA 2K4DA 4R8PK 1FBVA 4LK9A 2KIZA 4YC9A 4YABA 2KWJA 2LXHC 4B86C 5LKUA 3PUQA 5H1TA 4BBQA 5DKAA 1N87A 1HYJA 4V3KC 2M1RA 4GB0A 1MM3A 3HCSA 3QZVA 1WENA 2MNZA 2EODA 3RPGB 3ZPVE 2G6QA 2LRIC 3M62A 2H0DB 5D1LB 2G45A 3SOWA 2CKLB 2F6NA 2KWNA 3PHDA 2YSJA 1V87A 2ECIA 4L7XA 4UP5A 5C11A 4AYCB 2LQ6A 3LRQA 2AN6A 3ASLA 4S3OB 4ZDTA 3IHPA 4X3GA 2KFTA 2CSYA 4YBSA 2E6RA 2UZGA 2VP7A 2L5UA 2QICA 3O36A 2RSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKX A;  3M63 A;  2CSZ A;  4V3L C;  5FB1 A;  4AP4 A;  1WEM A;  1WIL A;  2M85 A;  2HDP A;  2KR4 A;  4CA1 A;  3NG2 A;  2K1J A;  5AIU A;  1WEE A;  2YRE A;  3SOX A;  2CT2 A;  1IYM A;  2YW8 A;  3U5M A;  1WEQ A;  2E6S A;  4LJN A;  4W4U A;  4NN2 A;  3HCT A;  4QF2 A;  2LXP C;  5D1K B;  3LQH A;  2KE1 A;  3L1Z B;  3LQI A;  2ECV A;  1WEU A;  2NAA A;  2VPG A;  3DQV R;  5G04 B;  1T1H A;  3O70 A;  2VPD A;  3O35 A;  3I2D A;  2MT5 A;  1DVP A;  2PUY A;  2IDA A;  2QIZ A;  3N9L A;  2KGG A;  5H9M A;  5B78 A;  4LLB A;  2G43 A;  1XWH A;  4WZ3 B;  4AUQ B;  2KRE A;  5H1U A;  1FP0 A;  2YUC A;  3T6R A;  4UP0 A;  1WFK A;  4QF3 A;  3M99 A;  4IC2 A;  4A49 A;  3ZVZ B;  3KQI A;  1WEV A;  3L1X A;  5LCW B;  1ZBD B;  2LGL A;  1JOC A;  2C2V S;  3O33 A;  2K16 A;  4CCG X;  3GV4 A;  4PTB A;  4XI1 A;  5G05 B;  2YHN A;  5TAB A;  5J3X A;  1JM7 B;  5B79 A;  3LQJ A;  1X4U A;  4ZUX U;  5B77 A;  2VJF A;  2M6M A;  4I7C A;  2MA5 A;  2L80 A;  2Y1N A;  2KWO A;  1WES A;  1F62 A;  2YHO A;  3ZNI A;  1VD4 A;  3DPL R;  2CKL A;  2YQM A;  1WEW A;  2L75 A;  1WGM A;  4GNF A;  4LAD B;  2VPE A;  5H1V A;  4WA6 A;  3U5O A;  5FEY A;  2KU3 A;  2LDR A;  2VPB A;  4FIP A;  3EB5 A;  2XB1 A;  5KH9 A;  3T7L A;  4AVX A;  2BAY A;  2KGI A;  5G0F A;  2YUR A;  4MVT A;  4F52 B;  2LGK A;  2MIQ A;  1Z6U A;  1WEO A;  2Y1M A;  2JMD A;  3FL2 A;  1HYI A;  5I3L A;  2VJE A;  3ZVY A;  2XEU A;  3N9O A;  5B75 A;  4N4F A;  5FB0 A;  1VYX A;  2D8S A;  4I7B A;  1Z60 A;  4LKA A;  4WZ0 A;  2MNY A;  5KH7 A;  4C9Z A;  1MM2 A;  3PUR A;  2ECG A;  4FO9 A;  4GNG A;  2JMJ A;  1WIM A;  4UI9 B;  2MD8 C;  4FK5 A;  5TDR A;  4A4C A;  2KWK A;  1X4I A;  2RI7 A;  2ECW A;  1E4U A;  1G25 A;  4YAT A;  4A4B A;  2ECJ A;  2MUM A;  4R7E A;  1RMD A;  2ECN A;  4B7Y C;  4BHW A;  2VNF A;  3C6W A;  3KNV A;  2YQL A;  2YU4 A;  3O7A A;  3V43 A;  2FUU A;  4PPE A;  2FSA A;  1K2F A;  3KV5 A;  3U5N A;  3O34 A;  4TKP B;  5TBN A;  2HYE D;  5B8D A;  2DX8 A;  2ECT A;  2MD7 B;  2VJF B;  3C5K A;  5DIN A;  4A0C D;  2YT5 A;  5EYA F;  2H0D A;  4ZQL A;  2QJ0 A;  4I7D A;  2KYU A;  2Y43 A;  3N9Q A;  1JM7 A;  1BOR A;  3SHB A;  3N9N A;  2PNX A;  3N9M A;  5B76 A;  4WZ2 A;  3U5P A;  4AYC A;  2C2L A;  2JRJ A;  4GNE A;  3KV6 A;  3O37 A;  2L43 A;  3MHS A;  2F42 A;  2LGG A;  3N9P A;  3HCU A;  3MHH A;  4MSX A;  4FJC A;  1VFY A;  2LN0 A;  3GL6 A;  2YYR A;  3HTK C;  4YAD A;  2JMI A;  1LDJ B;  2M3H A;  2I50 A;  2MA6 A;  1X4J A;  4P5O B;  1LDK C;  2F6J A;  2VJE B;  2K17 A;  3ZYQ A;  5LKZ A;  1CHC A;  3L11 A;  1WE9 A;  4YBM A;  5C13 A;  4Q6F A;  5KH3 A;  3RPG C;  5JG6 A;  2OXQ C;  4IC3 A;  2LV9 A;  5AIT A;  4O64 A;  4YAX A;  1Z2Q A;  4R2Y A;  2LGV A;  2L0B A;  2YSM A;  5D1M B;  5TRB A;  2EA6 A;  4L58 A;  1WEP A;  5LKT A;  2FUI A;  4YBT A;  4S3O C;  5FER A;  4GND A;  2ZET C;  3RTR B;  3ZPV 1;  3EB6 A;  2EGP A;  3SOU A;  3VK6 A;  3ZTG A;  4N3W A;  1U6G B;  5TDW A;  2K4D A;  4R8P K;  1FBV A;  4LK9 A;  2KIZ A;  4YC9 A;  4YAB A;  2KWJ A;  2LXH C;  4B86 C;  5LKU A;  3PUQ A;  5H1T A;  4BBQ A;  5DKA A;  1N87 A;  1HYJ A;  4V3K C;  2M1R A;  4GB0 A;  1MM3 A;  3HCS A;  3QZV A;  1WEN A;  2MNZ A;  2EOD A;  3RPG B;  3ZPV E;  2G6Q A;  2LRI C;  3M62 A;  2H0D B;  5D1L B;  2G45 A;  3SOW A;  2CKL B;  2F6N A;  2KWN A;  3PHD A;  2YSJ A;  1V87 A;  2ECI A;  4L7X A;  4UP5 A;  5C11 A;  4AYC B;  2LQ6 A;  3LRQ A;  2AN6 A;  3ASL A;  4S3O B;  4ZDT A;  3IHP A;  4X3G A;  2KFT A;  2CSY A;  4YBS A;  2E6R A;  2UZG A;  2VP7 A;  2L5U A;  2QIC A;  3O36 A;  2RSD A; 
#chains in the Genus database with same CATH topology
 5LKX A;  3M63 A;  2CSZ A;  4V3L C;  5FB1 A;  5SVI A;  4AP4 A;  3Q1D A;  1WEM A;  1WIL A;  2M85 A;  2HDP A;  2KR4 A;  4CA1 A;  3NG2 A;  3FAN A;  2K1J A;  5AIU A;  1WEE A;  2YRE A;  3SOX A;  2CT2 A;  1IYM A;  2YW8 A;  3MDB C;  3U5M A;  1WEQ A;  2E6S A;  4LJN A;  4W4U A;  4OGC A;  4NN2 A;  3HCT A;  4QF2 A;  2LXP C;  5D1K B;  3LQH A;  2KE1 A;  3L1Z B;  3LQI A;  2ECV A;  1WEU A;  2DSM A;  2NAA A;  2VPG A;  3DQV R;  3M7K A;  5G04 B;  1T1H A;  3O70 A;  2VPD A;  3O35 A;  3I2D A;  2MT5 A;  1DVP A;  2PUY A;  2IDA A;  2QIZ A;  3N9L A;  2KGG A;  5H9M A;  5B78 A;  4LLB A;  2G43 A;  1XWH A;  4WZ3 B;  4AUQ B;  2KRE A;  1MBM A;  3SUB A;  5H1U A;  1FP0 A;  2YUC A;  3T6R A;  2LAU A;  3KDE C;  4UP0 A;  5K3Q A;  1WFK A;  3FJU B;  4QF3 A;  3H7H A;  3M99 A;  4IC2 A;  4Z0O A;  4A49 A;  3ZVZ B;  3KQI A;  2L7P A;  1WEV A;  3L1X A;  5LCW B;  1ZBD B;  2LGL A;  1JOC A;  2C2V S;  3O33 A;  2K16 A;  4CCG X;  3GV4 A;  4PTB A;  2B0O E;  4XI1 A;  5G05 B;  2XOC A;  4Z0R A;  2YHN A;  5TAB A;  5J3X A;  1JM7 B;  5B79 A;  3LQJ A;  1X4U A;  2EGM A;  4ZUX U;  5B77 A;  2VJF A;  2M6M A;  4I7C A;  2MA5 A;  2L80 A;  2Y1N A;  2RR4 A;  2JUN A;  2KWO A;  1WES A;  1F62 A;  2YHO A;  3ZNI A;  1VD4 A;  3DPL R;  3LJU X;  3DWD A;  2CKL A;  2YQM A;  1WEW A;  2L75 A;  1WGM A;  4GNF A;  4LAD B;  2VPE A;  3PLW A;  5H1V A;  4WA6 A;  3U5O A;  5FEY A;  2KU3 A;  2LDR A;  2VPB A;  4FIP A;  3EB5 A;  2XP0 A;  2XOY A;  2XB1 A;  5KH9 A;  3T7L A;  4AVX A;  2KKY A;  3O47 A;  2BAY A;  2KGI A;  5G0F A;  2YUR A;  4MVT A;  2D8U A;  4F52 B;  2LGK A;  2MIQ A;  3LVR E;  3FAO A;  1Z6U A;  1WEO A;  2Y1M A;  2JMD A;  3FL2 A;  1HYI A;  5I3L A;  2VJE A;  3ZVY A;  2XEU A;  3N9O A;  5B75 A;  4N4F A;  5FB0 A;  1VYX A;  2D8S A;  2IQJ A;  2CSV A;  4I7B A;  1Z60 A;  4LKA A;  4WZ0 A;  4OGE A;  2MNY A;  5KH7 A;  4C9Z A;  1MM2 A;  3PUR A;  2ECG A;  4FO9 A;  4GNG A;  2E61 A;  1WIM A;  2JMJ A;  4UI9 B;  2MD8 C;  4FK5 A;  5TDR A;  4A4C A;  2KWK A;  1X4I A;  2MKE A;  2RI7 A;  2ECW A;  2JM3 A;  1E4U A;  1G25 A;  4YAT A;  4A4B A;  2ECJ A;  2MUM A;  4R7E A;  1RMD A;  2ECN A;  4B7Y C;  4BHW A;  2VNF A;  3C6W A;  3KNV A;  2YQL A;  2YU4 A;  3O7A A;  3V43 A;  2FUU A;  4PPE A;  2EXU A;  3FM8 C;  2FSA A;  1K2F A;  2OWA A;  3KV5 A;  3U5N A;  3JUE A;  3O34 A;  3LVQ E;  4TKP B;  5TBN A;  2HYE D;  5B8D A;  2DX8 A;  2ECT A;  2MD7 B;  2VJF B;  3T9K A;  3C5K A;  5DIN A;  4A0C D;  2YT5 A;  5EYA F;  2FFW A;  2H0D A;  4ZQL A;  2QJ0 A;  4I7D A;  2KYU A;  2Y43 A;  3N9Q A;  1JM7 A;  3FEH A;  1BOR A;  3SHB A;  3N9N A;  2PNX A;  3N9M A;  5B76 A;  4WZ2 A;  2CON A;  3U5P A;  4AYC A;  2C2L A;  2JRJ A;  4GNE A;  3KV6 A;  3O37 A;  2L43 A;  3MHS A;  2F42 A;  2LGG A;  2CRW A;  3N9P A;  3HCU A;  3MHH A;  4H9D A;  4MSX A;  3LDY A;  4FJC A;  1VFY A;  2LN0 A;  2XOZ A;  5SVI B;  3GL6 A;  2YYR A;  5SVX A;  3HTK C;  4YAD A;  2JMI A;  1LDJ B;  2FD4 A;  2M3H A;  2I50 A;  4QQ4 A;  2MA6 A;  1X4J A;  4P5O B;  2M13 A;  1LDK C;  2F6J A;  2VJE B;  2K17 A;  3ZYQ A;  5LKZ A;  1CHC A;  3L11 A;  1WE9 A;  4YBM A;  5C13 A;  4Q6F A;  5KH3 A;  3RPG C;  5JG6 A;  2OXQ C;  5SVY A;  4IC3 A;  2LV9 A;  5AIT A;  4O64 A;  4YAX A;  1Z2Q A;  2DJA A;  4R2Y A;  2LGV A;  2L0B A;  2YSM A;  5D1M B;  5TRB A;  2EA6 A;  4L58 A;  1WEP A;  5LKT A;  2FUI A;  4YBT A;  4O62 A;  4S3O C;  5FER A;  4GND A;  2ZET C;  3RTR B;  3ZPV 1;  3EB6 A;  2EGP A;  3SOU A;  3VK6 A;  3ZTG A;  4N3W A;  1U6G B;  5TDW A;  2K4D A;  4R8P K;  1DCQ A;  1FBV A;  4LK9 A;  2KIZ A;  4YC9 A;  2P57 A;  4YAB A;  2KWJ A;  2LXH C;  4B86 C;  5LKU A;  3PUQ A;  5H1T A;  4BBQ A;  5DKA A;  1N87 A;  1HYJ A;  2YVR A;  4V3K C;  2M1R A;  2CRR A;  4GB0 A;  1MM3 A;  3HCS A;  3QZV A;  1WEN A;  2MNZ A;  2EOD A;  3RPG B;  3ZPV E;  2G6Q A;  2LRI C;  3M62 A;  2H0D B;  5D1L B;  2G45 A;  3SOW A;  2CKL B;  2F6N A;  2KWN A;  3PHD A;  4F1P A;  2YSJ A;  1V87 A;  3E2D A;  2ECI A;  4L7X A;  4UP5 A;  5C11 A;  4AYC B;  2LQ6 A;  3LRQ A;  2AN6 A;  3ASL A;  4S3O B;  4ZDT A;  3IHP A;  2KKX A;  4X3G A;  2KFT A;  2CSY A;  3DDT A;  4YBS A;  2E6R A;  2UZG A;  2VP7 A;  2L5U A;  2QIC A;  3O36 A;  2RSD A; 
#chains in the Genus database with same CATH homology
 5LKX A;  3M63 A;  2CSZ A;  4V3L C;  5FB1 A;  4AP4 A;  1WEM A;  1WIL A;  2M85 A;  2HDP A;  2KR4 A;  4CA1 A;  3NG2 A;  2K1J A;  5AIU A;  1WEE A;  2YRE A;  3SOX A;  2CT2 A;  1IYM A;  2YW8 A;  3U5M A;  1WEQ A;  2E6S A;  4LJN A;  4W4U A;  4NN2 A;  3HCT A;  4QF2 A;  2LXP C;  5D1K B;  3LQH A;  2KE1 A;  3L1Z B;  3LQI A;  2ECV A;  1WEU A;  2NAA A;  2VPG A;  3DQV R;  5G04 B;  1T1H A;  3O70 A;  2VPD A;  3O35 A;  3I2D A;  2MT5 A;  1DVP A;  2PUY A;  2IDA A;  2QIZ A;  3N9L A;  2KGG A;  5H9M A;  5B78 A;  4LLB A;  2G43 A;  1XWH A;  4WZ3 B;  4AUQ B;  2KRE A;  5H1U A;  1FP0 A;  2YUC A;  3T6R A;  4UP0 A;  1WFK A;  4QF3 A;  3M99 A;  4IC2 A;  4A49 A;  3ZVZ B;  3KQI A;  1WEV A;  3L1X A;  5LCW B;  1ZBD B;  2LGL A;  1JOC A;  2C2V S;  3O33 A;  2K16 A;  4CCG X;  3GV4 A;  4PTB A;  4XI1 A;  5G05 B;  2YHN A;  5TAB A;  5J3X A;  1JM7 B;  5B79 A;  3LQJ A;  1X4U A;  4ZUX U;  5B77 A;  2VJF A;  2M6M A;  4I7C A;  2MA5 A;  2L80 A;  2Y1N A;  2KWO A;  1WES A;  1F62 A;  2YHO A;  3ZNI A;  1VD4 A;  3DPL R;  2CKL A;  2YQM A;  1WEW A;  2L75 A;  1WGM A;  4GNF A;  4LAD B;  2VPE A;  5H1V A;  4WA6 A;  3U5O A;  5FEY A;  2KU3 A;  2LDR A;  2VPB A;  4FIP A;  3EB5 A;  2XB1 A;  5KH9 A;  3T7L A;  4AVX A;  2BAY A;  2KGI A;  5G0F A;  2YUR A;  4MVT A;  4F52 B;  2LGK A;  2MIQ A;  1Z6U A;  1WEO A;  2Y1M A;  2JMD A;  3FL2 A;  1HYI A;  5I3L A;  2VJE A;  3ZVY A;  2XEU A;  3N9O A;  5B75 A;  4N4F A;  5FB0 A;  1VYX A;  2D8S A;  4I7B A;  1Z60 A;  4LKA A;  4WZ0 A;  2MNY A;  5KH7 A;  4C9Z A;  1MM2 A;  3PUR A;  2ECG A;  4FO9 A;  4GNG A;  2JMJ A;  1WIM A;  4UI9 B;  2MD8 C;  4FK5 A;  5TDR A;  4A4C A;  2KWK A;  1X4I A;  2RI7 A;  2ECW A;  1E4U A;  1G25 A;  4YAT A;  4A4B A;  2ECJ A;  2MUM A;  4R7E A;  1RMD A;  2ECN A;  4B7Y C;  4BHW A;  2VNF A;  3C6W A;  3KNV A;  2YQL A;  2YU4 A;  3O7A A;  3V43 A;  2FUU A;  4PPE A;  2FSA A;  1K2F A;  3KV5 A;  3U5N A;  3O34 A;  4TKP B;  5TBN A;  2HYE D;  5B8D A;  2DX8 A;  2ECT A;  2MD7 B;  2VJF B;  3C5K A;  5DIN A;  4A0C D;  2YT5 A;  5EYA F;  2H0D A;  4ZQL A;  2QJ0 A;  4I7D A;  2KYU A;  2Y43 A;  3N9Q A;  1JM7 A;  1BOR A;  3SHB A;  3N9N A;  2PNX A;  3N9M A;  5B76 A;  4WZ2 A;  3U5P A;  4AYC A;  2C2L A;  2JRJ A;  4GNE A;  3KV6 A;  3O37 A;  2L43 A;  3MHS A;  2F42 A;  2LGG A;  3N9P A;  3HCU A;  3MHH A;  4MSX A;  4FJC A;  1VFY A;  2LN0 A;  3GL6 A;  2YYR A;  3HTK C;  4YAD A;  2JMI A;  1LDJ B;  2M3H A;  2I50 A;  2MA6 A;  1X4J A;  4P5O B;  1LDK C;  2F6J A;  2VJE B;  2K17 A;  3ZYQ A;  5LKZ A;  1CHC A;  3L11 A;  1WE9 A;  4YBM A;  5C13 A;  4Q6F A;  5KH3 A;  3RPG C;  5JG6 A;  2OXQ C;  4IC3 A;  2LV9 A;  5AIT A;  4O64 A;  4YAX A;  1Z2Q A;  4R2Y A;  2LGV A;  2L0B A;  2YSM A;  5D1M B;  5TRB A;  2EA6 A;  4L58 A;  1WEP A;  5LKT A;  2FUI A;  4YBT A;  4S3O C;  5FER A;  4GND A;  2ZET C;  3RTR B;  3ZPV 1;  3EB6 A;  2EGP A;  3SOU A;  3VK6 A;  3ZTG A;  4N3W A;  1U6G B;  5TDW A;  2K4D A;  4R8P K;  1FBV A;  4LK9 A;  2KIZ A;  4YC9 A;  4YAB A;  2KWJ A;  2LXH C;  4B86 C;  5LKU A;  3PUQ A;  5H1T A;  4BBQ A;  5DKA A;  1N87 A;  1HYJ A;  4V3K C;  2M1R A;  4GB0 A;  1MM3 A;  3HCS A;  3QZV A;  1WEN A;  2MNZ A;  2EOD A;  3RPG B;  3ZPV E;  2G6Q A;  2LRI C;  3M62 A;  2H0D B;  5D1L B;  2G45 A;  3SOW A;  2CKL B;  2F6N A;  2KWN A;  3PHD A;  2YSJ A;  1V87 A;  2ECI A;  4L7X A;  4UP5 A;  5C11 A;  4AYC B;  2LQ6 A;  3LRQ A;  2AN6 A;  3ASL A;  4S3O B;  4ZDT A;  3IHP A;  4X3G A;  2KFT A;  2CSY A;  4YBS A;  2E6R A;  2UZG A;  2VP7 A;  2L5U A;  2QIC A;  3O36 A;  2RSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...