2EODA

Solution structure of traf-type zinc finger domains (190- 248) from human tnf receptor-associated factor 4
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of TRAF-type zinc finger domains (190 - 248) from human TNF receptor-associated factor 4
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 4
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2eodA00
1JOCA 2QICA 5H1VA 3ZVYA 2VPGA 2YYRA 2K17A 1FBVA 4YABA 3HCUA 4YADA 1WEVA 2MIQA 5G05B 2VPEA 3MHHA 2H0DA 2G43A 3U5MA 2D8SA 2KFTA 2YU4A 4ZUXU 2CSZA 1X4JA 2YQLA 4WZ2A 1DVPA 3I2DA 3LQJA 5LKXA 4V3KC 4AYCB 2MUMA 1ZBDB 4ZDTA 1HYJA 4QF3A 2KGGA 2ECVA 3LRQA 2YHOA 4TKPB 1BORA 2Y1NA 1WEPA 4NN2A 2K1JA 2ECJA 4A49A 3N9PA 4L58A 4UP5A 4LJNA 3L1ZB 1CHCA 2DX8A 4XI1A 5G04B 5FB0A 3T7LA 2IDAA 5B8DA 1WE9A 3PURA 1WEMA 2L75A 2K4DA 3U5NA 4GNFA 2VPBA 2AN6A 2M3HA 4A0CD 5DKAA 1WFKA 2Y43A 2L43A 3SHBA 5B77A 2C2VS 2CKLB 1V87A 2EODA 1WEQA 3N9NA 3O34A 4GNEA 2ECWA 4YC9A 3T6RA 4I7BA 2LGKA 4CA1A 3HCSA 2KWOA 2MA6A 5AITA 2LGLA 1K2FA 2KU3A 2I50A 3RPGC 4FK5A 5JG6A 5AIUA 4S3OC 4WZ3B 4PTBA 4F52B 4YBMA 2CKLA 1RMDA 2NAAA 2C2LA 4YATA 4YBSA 4AP4A 2L0BA 3N9LA 2JMJA 3O36A 2KIZA 5TRBA 3U5PA 5B75A 2LDRA 3N9OA 3O33A 3L1XA 2YT5A 5D1KB 1VFYA 5I3LA 2F42A 1WESA 2YQMA 1N87A 2UZGA 2KE1A 2LV9A 4YBTA 3PHDA 2LGVA 3N9QA 4R2YA 2M85A 2ECGA 4IC2A 2YW8A 2LQ6A 3ZVZB 3ZNIA 2M1RA 4YAXA 3HCTA 1T1HA 3M99A 5LKZA 1WEOA 5C11A 2G6QA 2L80A 3N9MA 4MSXA 2H0DB 4ZQLA 2XB1A 3O35A 3KV6A 3ZPVE 2CSYA 2F6NA 2HYED 1MM2A 2YHNA 2JRJA 2LRIC 1X4IA 4C9ZA 2K16A 3ZPV1 3PUQA 3EB6A 3LQHA 5D1MB 2OXQC 5B78A 3KQIA 2PNXA 4UI9B 3KNVA 4A4CA 1Z2QA 4LLBA 2MD8C 4O64A 4R8PK 3SOUA 5C13A 3SOWA 3O7AA 1Z6UA 2MNZA 2KWNA 2VJFA 1MM3A 4B86C 4BBQA 2FUUA 5TBNA 3GL6A 4IC3A 3M62A 4LKAA 2KR4A 1JM7B 4WA6A 3GV4A 2YSJA 4WZ0A 3EB5A 5FERA 4BHWA 4S3OB 2F6JA 3IHPA 3V43A 2ECIA 4GB0A 2YREA 3C6WA 4V3LC 3DPLR 2VJFB 4B7YC 1WILA 4CCGX 2KGIA 2Y1MA 3QZVA 3LQIA 2PUYA 2L5UA 1WIMA 4N4FA 1U6GB 2LXPC 4Q6FA 4QF2A 2LXHC 4UP0A 5J3XA 3U5OA 3L11A 4I7CA 2MNYA 3ZYQA 2G45A 4P5OB 1VD4A 2RSDA 2FSAA 2XEUA 4PPEA 5KH3A 3NG2A 2LN0A 1HYIA 4X3GA 4MVTA 3ZTGA 5G0FA 4GNDA 2MT5A 5TDRA 4LADB 1XWHA 3KV5A 2ECTA 3O70A 5EYAF 2ECNA 2CT2A 1F62A 5B79A 1JM7A 2LGGA 2VJEA 2ZETC 1LDJB 2FUIA 5KH9A 3MHSA 5LCWB 4L7XA 2M6MA 5TABA 1WGMA 2MD7B 4AVXA 1FP0A 5LKTA 5LKUA 1E4UA 2KWJA 2QIZA 5B76A 5H9MA 3ASLA 3DQVR 5H1TA 3VK6A 4AUQB 1WEWA 3HTKC 2VNFA 3M63A 4R7EA 2VPDA 2BAYA 5D1LB 2YUCA 2JMIA 2QJ0A 4FO9A 1WEUA 1IYMA 2RI7A 1Z60A 2EA6A 4I7DA 2E6RA 2VJEB 3FL2A 4GNGA 2KYUA 5KH7A 2KREA 2KWKA 4A4BA 2HDPA 2YSMA 5FB1A 2VP7A 1LDKC 4FIPA 4FJCA 1X4UA 5H1UA 5DINA 4N3WA 3C5KA 1VYXA 2YURA 2EGPA 5FEYA 4W4UA 2E6SA 4LK9A 5TDWA 3O37A 2JMDA 1WENA 1G25A 3RPGB 3SOXA 3RTRB 1WEEA 2MA5A 4AYCA
chains in the Genus database with same CATH superfamily
3LDYA 1JOCA 2QICA 5H1VA 3ZVYA 2VPGA 2YYRA 2LAUA 2JUNA 2K17A 1FBVA 2MKEA 4YABA 3HCUA 4YADA 1WEVA 2MIQA 5G05B 2VPEA 3MHHA 3FAOA 2H0DA 2G43A 3U5MA 2D8SA 2KFTA 2YU4A 4ZUXU 2CSZA 1X4JA 2YQLA 4WZ2A 1DVPA 3I2DA 3LQJA 5LKXA 4V3KC 2OWAA 4AYCB 2MUMA 1ZBDB 4ZDTA 1HYJA 4QF3A 2KGGA 2CSVA 2CONA 2ECVA 3LRQA 2YHOA 4TKPB 1BORA 2Y1NA 1WEPA 4NN2A 3LJUX 2K1JA 2ECJA 4A49A 3N9PA 4L58A 4UP5A 4LJNA 3L1ZB 3LVQE 2L7PA 1CHCA 4OGEA 2DX8A 4XI1A 5G04B 5FB0A 3T7LA 2CRRA 2IDAA 2YVRA 5B8DA 1WE9A 2RR4A 3PURA 1WEMA 2L75A 2K4DA 2KKXA 3U5NA 4GNFA 4Z0OA 2VPBA 2AN6A 1MBMA 2M3HA 4A0CD 5DKAA 3M7KA 1WFKA 2Y43A 2L43A 3SHBA 5B77A 2C2VS 2CKLB 1V87A 2DSMA 2EODA 1WEQA 3N9NA 2P57A 2XOCA 3O34A 4GNEA 2ECWA 4YC9A 3T6RA 4I7BA 4Z0RA 2LGKA 4CA1A 3HCSA 2KWOA 3KDEC 2MA6A 5AITA 2LGLA 1K2FA 2KU3A 2I50A 5SVIA 3RPGC 4FK5A 5JG6A 3FANA 5AIUA 4S3OC 4WZ3B 4PTBA 4F52B 1DCQA 2CKLA 1RMDA 4YBMA 2NAAA 2C2LA 4YATA 4YBSA 4AP4A 2L0BA 3N9LA 2JMJA 3O36A 2KIZA 5TRBA 3U5PA 5B75A 2LDRA 3JUEA 3N9OA 4F1PA 3O33A 2EGMA 3L1XA 2YT5A 5D1KB 1VFYA 5I3LA 2F42A 1WESA 2YQMA 1N87A 2UZGA 2KE1A 2LV9A 3T9KA 4YBTA 3PHDA 2LGVA 3N9QA 4R2YA 2M85A 2ECGA 4IC2A 2YW8A 2LQ6A 3ZVZB 3ZNIA 2M1RA 4YAXA 3HCTA 1T1HA 3M99A 5LKZA 1WEOA 5C11A 2G6QA 2L80A 3N9MA 3FM8C 4MSXA 2H0DB 4ZQLA 2XB1A 3O35A 3KV6A 3ZPVE 2CSYA 3E2DA 4O62A 2F6NA 2HYED 1MM2A 2YHNA 2JRJA 2LRIC 1X4IA 2K16A 4C9ZA 3ZPV1 3PUQA 3EB6A 4OGCA 3DDTA 3LQHA 5D1MB 2FD4A 2OXQC 5B78A 3KQIA 2PNXA 4UI9B 3KNVA 4A4CA 1Z2QA 4LLBA 2MD8C 4O64A 4R8PK 3SOUA 5C13A 4AYCA 3SOWA 3O7AA 1Z6UA 3O47A 2MNZA 2KWNA 2VJFA 1MM3A 4B86C 4BBQA 2FUUA 5TBNA 3GL6A 4IC3A 3M62A 4LKAA 2KR4A 2KKYA 3PLWA 3DWDA 1JM7B 2DJAA 4WA6A 3GV4A 2YSJA 4WZ0A 3EB5A 5FERA 4BHWA 2JM3A 4S3OB 2F6JA 3IHPA 3V43A 2ECIA 4GB0A 2YREA 3C6WA 4V3LC 2B0OE 2EXUA 3DPLR 2VJFB 4B7YC 1WILA 4CCGX 2KGIA 2Y1MA 3QZVA 3LQIA 2PUYA 2FFWA 2L5UA 1WIMA 3SUBA 4N4FA 1U6GB 2LXPC 4Q6FA 4QF2A 2LXHC 4UP0A 5J3XA 3U5OA 3L11A 4I7CA 2MNYA 3ZYQA 2G45A 4P5OB 3Q1DA 1VD4A 2RSDA 2FSAA 2XEUA 4PPEA 5KH3A 2XOZA 3NG2A 2LN0A 3LVRE 1HYIA 4X3GA 4MVTA 5G0FA 3ZTGA 4GNDA 2MT5A 5TDRA 4LADB 1XWHA 3KV5A 2ECTA 3O70A 5EYAF 2D8UA 2ECNA 3FJUB 2CT2A 1F62A 5B79A 1JM7A 2LGGA 2VJEA 2ZETC 1LDJB 2FUIA 5KH9A 3MHSA 5LCWB 4L7XA 2M6MA 5TABA 1WGMA 2MD7B 4AVXA 5SVYA 1FP0A 5LKTA 5LKUA 1E4UA 2KWJA 2QIZA 5B76A 2CRWA 2M13A 5H9MA 3ASLA 3DQVR 5H1TA 2E61A 4H9DA 3VK6A 4AUQB 1WEWA 5SVIB 3HTKC 5SVXA 2VNFA 3M63A 4R7EA 2VPDA 2BAYA 2XP0A 5D1LB 2YUCA 2JMIA 2QJ0A 4FO9A 1WEUA 1IYMA 2RI7A 2XOYA 1Z60A 3MDBC 2EA6A 4I7DA 2E6RA 2VJEB 3FL2A 4GNGA 2KYUA 5KH7A 2KREA 2KWKA 4A4BA 2HDPA 3FEHA 2YSMA 5FB1A 2VP7A 2IQJA 1LDKC 3H7HA 4FIPA 4FJCA 1X4UA 5H1UA 5DINA 4QQ4A 4N3WA 3C5KA 1VYXA 2YURA 2EGPA 5FEYA 5K3QA 4W4UA 2E6SA 4LK9A 5TDWA 3O37A 2JMDA 1WENA 1G25A 3RPGB 3SOXA 3RTRB 2MA5A 1WEEA
chains in the Genus database with same CATH topology
1JOCA 2QICA 5H1VA 3ZVYA 2VPGA 2YYRA 2K17A 1FBVA 4YABA 3HCUA 4YADA 1WEVA 2MIQA 5G05B 2VPEA 3MHHA 2H0DA 2G43A 3U5MA 2D8SA 2KFTA 2YU4A 4ZUXU 2CSZA 1X4JA 2YQLA 4WZ2A 1DVPA 3I2DA 3LQJA 5LKXA 4V3KC 4AYCB 2MUMA 1ZBDB 4ZDTA 1HYJA 4QF3A 2KGGA 2ECVA 3LRQA 2YHOA 4TKPB 1BORA 2Y1NA 1WEPA 4NN2A 2K1JA 2ECJA 4A49A 3N9PA 4L58A 4UP5A 4LJNA 3L1ZB 1CHCA 2DX8A 4XI1A 5G04B 5FB0A 3T7LA 2IDAA 5B8DA 1WE9A 3PURA 1WEMA 2L75A 2K4DA 3U5NA 4GNFA 2VPBA 2AN6A 2M3HA 4A0CD 5DKAA 1WFKA 2Y43A 2L43A 3SHBA 5B77A 2C2VS 2CKLB 1V87A 2EODA 1WEQA 3N9NA 3O34A 4GNEA 2ECWA 4YC9A 3T6RA 4I7BA 2LGKA 4CA1A 3HCSA 2KWOA 2MA6A 5AITA 2LGLA 1K2FA 2KU3A 2I50A 3RPGC 4FK5A 5JG6A 5AIUA 4S3OC 4WZ3B 4PTBA 4F52B 4YBMA 2CKLA 1RMDA 2NAAA 2C2LA 4YATA 4YBSA 4AP4A 2L0BA 3N9LA 2JMJA 3O36A 2KIZA 5TRBA 3U5PA 5B75A 2LDRA 3N9OA 3O33A 3L1XA 2YT5A 5D1KB 1VFYA 5I3LA 2F42A 1WESA 2YQMA 1N87A 2UZGA 2KE1A 2LV9A 4YBTA 3PHDA 2LGVA 3N9QA 4R2YA 2M85A 2ECGA 4IC2A 2YW8A 2LQ6A 3ZVZB 3ZNIA 2M1RA 4YAXA 3HCTA 1T1HA 3M99A 5LKZA 1WEOA 5C11A 2G6QA 2L80A 3N9MA 4MSXA 2H0DB 4ZQLA 2XB1A 3O35A 3KV6A 3ZPVE 2CSYA 2F6NA 2HYED 1MM2A 2YHNA 2JRJA 2LRIC 1X4IA 4C9ZA 2K16A 3ZPV1 3PUQA 3EB6A 3LQHA 5D1MB 2OXQC 5B78A 3KQIA 2PNXA 4UI9B 3KNVA 4A4CA 1Z2QA 4LLBA 2MD8C 4O64A 4R8PK 3SOUA 5C13A 3SOWA 3O7AA 1Z6UA 2MNZA 2KWNA 2VJFA 1MM3A 4B86C 4BBQA 2FUUA 5TBNA 3GL6A 4IC3A 3M62A 4LKAA 2KR4A 1JM7B 4WA6A 3GV4A 2YSJA 4WZ0A 3EB5A 5FERA 4BHWA 4S3OB 2F6JA 3IHPA 3V43A 2ECIA 4GB0A 2YREA 3C6WA 4V3LC 3DPLR 2VJFB 4B7YC 1WILA 4CCGX 2KGIA 2Y1MA 3QZVA 3LQIA 2PUYA 2L5UA 1WIMA 4N4FA 1U6GB 2LXPC 4Q6FA 4QF2A 2LXHC 4UP0A 5J3XA 3U5OA 3L11A 4I7CA 2MNYA 3ZYQA 2G45A 4P5OB 1VD4A 2RSDA 2FSAA 2XEUA 4PPEA 5KH3A 3NG2A 2LN0A 1HYIA 4X3GA 4MVTA 3ZTGA 5G0FA 4GNDA 2MT5A 5TDRA 4LADB 1XWHA 3KV5A 2ECTA 3O70A 5EYAF 2ECNA 2CT2A 1F62A 5B79A 1JM7A 2LGGA 2VJEA 2ZETC 1LDJB 2FUIA 5KH9A 3MHSA 5LCWB 4L7XA 2M6MA 5TABA 1WGMA 2MD7B 4AVXA 1FP0A 5LKTA 5LKUA 1E4UA 2KWJA 2QIZA 5B76A 5H9MA 3ASLA 3DQVR 5H1TA 3VK6A 4AUQB 1WEWA 3HTKC 2VNFA 3M63A 4R7EA 2VPDA 2BAYA 5D1LB 2YUCA 2JMIA 2QJ0A 4FO9A 1WEUA 1IYMA 2RI7A 1Z60A 2EA6A 4I7DA 2E6RA 2VJEB 3FL2A 4GNGA 2KYUA 5KH7A 2KREA 2KWKA 4A4BA 2HDPA 2YSMA 5FB1A 2VP7A 1LDKC 4FIPA 4FJCA 1X4UA 5H1UA 5DINA 4N3WA 3C5KA 1VYXA 2YURA 2EGPA 5FEYA 4W4UA 2E6SA 4LK9A 5TDWA 3O37A 2JMDA 1WENA 1G25A 3RPGB 3SOXA 3RTRB 1WEEA 2MA5A 4AYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOC A;  2QIC A;  5H1V A;  3ZVY A;  2VPG A;  2YYR A;  2K17 A;  1FBV A;  4YAB A;  3HCU A;  4YAD A;  1WEV A;  2MIQ A;  5G05 B;  2VPE A;  3MHH A;  2H0D A;  2G43 A;  3U5M A;  2D8S A;  2KFT A;  2YU4 A;  4ZUX U;  2CSZ A;  1X4J A;  2YQL A;  4WZ2 A;  1DVP A;  3I2D A;  3LQJ A;  5LKX A;  4V3K C;  4AYC B;  2MUM A;  1ZBD B;  4ZDT A;  1HYJ A;  4QF3 A;  2KGG A;  2ECV A;  3LRQ A;  2YHO A;  4TKP B;  1BOR A;  2Y1N A;  1WEP A;  4NN2 A;  2K1J A;  2ECJ A;  4A49 A;  3N9P A;  4L58 A;  4UP5 A;  4LJN A;  3L1Z B;  1CHC A;  2DX8 A;  4XI1 A;  5G04 B;  5FB0 A;  3T7L A;  2IDA A;  5B8D A;  1WE9 A;  3PUR A;  1WEM A;  2L75 A;  2K4D A;  3U5N A;  4GNF A;  2VPB A;  2AN6 A;  2M3H A;  4A0C D;  5DKA A;  1WFK A;  2Y43 A;  2L43 A;  3SHB A;  5B77 A;  2C2V S;  2CKL B;  1V87 A;  2EOD A;  1WEQ A;  3N9N A;  3O34 A;  4GNE A;  2ECW A;  4YC9 A;  3T6R A;  4I7B A;  2LGK A;  4CA1 A;  3HCS A;  2KWO A;  2MA6 A;  5AIT A;  2LGL A;  1K2F A;  2KU3 A;  2I50 A;  3RPG C;  4FK5 A;  5JG6 A;  5AIU A;  4S3O C;  4WZ3 B;  4PTB A;  4F52 B;  4YBM A;  2CKL A;  1RMD A;  2NAA A;  2C2L A;  4YAT A;  4YBS A;  4AP4 A;  2L0B A;  3N9L A;  2JMJ A;  3O36 A;  2KIZ A;  5TRB A;  3U5P A;  5B75 A;  2LDR A;  3N9O A;  3O33 A;  3L1X A;  2YT5 A;  5D1K B;  1VFY A;  5I3L A;  2F42 A;  1WES A;  2YQM A;  1N87 A;  2UZG A;  2KE1 A;  2LV9 A;  4YBT A;  3PHD A;  2LGV A;  3N9Q A;  4R2Y A;  2M85 A;  2ECG A;  4IC2 A;  2YW8 A;  2LQ6 A;  3ZVZ B;  3ZNI A;  2M1R A;  4YAX A;  3HCT A;  1T1H A;  3M99 A;  5LKZ A;  1WEO A;  5C11 A;  2G6Q A;  2L80 A;  3N9M A;  4MSX A;  2H0D B;  4ZQL A;  2XB1 A;  3O35 A;  3KV6 A;  3ZPV E;  2CSY A;  2F6N A;  2HYE D;  1MM2 A;  2YHN A;  2JRJ A;  2LRI C;  1X4I A;  4C9Z A;  2K16 A;  3ZPV 1;  3PUQ A;  3EB6 A;  3LQH A;  5D1M B;  2OXQ C;  5B78 A;  3KQI A;  2PNX A;  4UI9 B;  3KNV A;  4A4C A;  1Z2Q A;  4LLB A;  2MD8 C;  4O64 A;  4R8P K;  3SOU A;  5C13 A;  3SOW A;  3O7A A;  1Z6U A;  2MNZ A;  2KWN A;  2VJF A;  1MM3 A;  4B86 C;  4BBQ A;  2FUU A;  5TBN A;  3GL6 A;  4IC3 A;  3M62 A;  4LKA A;  2KR4 A;  1JM7 B;  4WA6 A;  3GV4 A;  2YSJ A;  4WZ0 A;  3EB5 A;  5FER A;  4BHW A;  4S3O B;  2F6J A;  3IHP A;  3V43 A;  2ECI A;  4GB0 A;  2YRE A;  3C6W A;  4V3L C;  3DPL R;  2VJF B;  4B7Y C;  1WIL A;  4CCG X;  2KGI A;  2Y1M A;  3QZV A;  3LQI A;  2PUY A;  2L5U A;  1WIM A;  4N4F A;  1U6G B;  2LXP C;  4Q6F A;  4QF2 A;  2LXH C;  4UP0 A;  5J3X A;  3U5O A;  3L11 A;  4I7C A;  2MNY A;  3ZYQ A;  2G45 A;  4P5O B;  1VD4 A;  2RSD A;  2FSA A;  2XEU A;  4PPE A;  5KH3 A;  3NG2 A;  2LN0 A;  1HYI A;  4X3G A;  4MVT A;  3ZTG A;  5G0F A;  4GND A;  2MT5 A;  5TDR A;  4LAD B;  1XWH A;  3KV5 A;  2ECT A;  3O70 A;  5EYA F;  2ECN A;  2CT2 A;  1F62 A;  5B79 A;  1JM7 A;  2LGG A;  2VJE A;  2ZET C;  1LDJ B;  2FUI A;  5KH9 A;  3MHS A;  5LCW B;  4L7X A;  2M6M A;  5TAB A;  1WGM A;  2MD7 B;  4AVX A;  1FP0 A;  5LKT A;  5LKU A;  1E4U A;  2KWJ A;  2QIZ A;  5B76 A;  5H9M A;  3ASL A;  3DQV R;  5H1T A;  3VK6 A;  4AUQ B;  1WEW A;  3HTK C;  2VNF A;  3M63 A;  4R7E A;  2VPD A;  2BAY A;  5D1L B;  2YUC A;  2JMI A;  2QJ0 A;  4FO9 A;  1WEU A;  1IYM A;  2RI7 A;  1Z60 A;  2EA6 A;  4I7D A;  2E6R A;  2VJE B;  3FL2 A;  4GNG A;  2KYU A;  5KH7 A;  2KRE A;  2KWK A;  4A4B A;  2HDP A;  2YSM A;  5FB1 A;  2VP7 A;  1LDK C;  4FIP A;  4FJC A;  1X4U A;  5H1U A;  5DIN A;  4N3W A;  3C5K A;  1VYX A;  2YUR A;  2EGP A;  5FEY A;  4W4U A;  2E6S A;  4LK9 A;  5TDW A;  3O37 A;  2JMD A;  1WEN A;  1G25 A;  3RPG B;  3SOX A;  3RTR B;  1WEE A;  2MA5 A;  4AYC A; 
#chains in the Genus database with same CATH topology
 3LDY A;  1JOC A;  2QIC A;  5H1V A;  3ZVY A;  2VPG A;  2YYR A;  2LAU A;  2JUN A;  2K17 A;  1FBV A;  2MKE A;  4YAB A;  3HCU A;  4YAD A;  1WEV A;  2MIQ A;  5G05 B;  2VPE A;  3MHH A;  3FAO A;  2H0D A;  2G43 A;  3U5M A;  2D8S A;  2KFT A;  2YU4 A;  4ZUX U;  2CSZ A;  1X4J A;  2YQL A;  4WZ2 A;  1DVP A;  3I2D A;  3LQJ A;  5LKX A;  4V3K C;  2OWA A;  4AYC B;  2MUM A;  1ZBD B;  4ZDT A;  1HYJ A;  4QF3 A;  2KGG A;  2CSV A;  2CON A;  2ECV A;  3LRQ A;  2YHO A;  4TKP B;  1BOR A;  2Y1N A;  1WEP A;  4NN2 A;  3LJU X;  2K1J A;  2ECJ A;  4A49 A;  3N9P A;  4L58 A;  4UP5 A;  4LJN A;  3L1Z B;  3LVQ E;  2L7P A;  1CHC A;  4OGE A;  2DX8 A;  4XI1 A;  5G04 B;  5FB0 A;  3T7L A;  2CRR A;  2IDA A;  2YVR A;  5B8D A;  1WE9 A;  2RR4 A;  3PUR A;  1WEM A;  2L75 A;  2K4D A;  2KKX A;  3U5N A;  4GNF A;  4Z0O A;  2VPB A;  2AN6 A;  1MBM A;  2M3H A;  4A0C D;  5DKA A;  3M7K A;  1WFK A;  2Y43 A;  2L43 A;  3SHB A;  5B77 A;  2C2V S;  2CKL B;  1V87 A;  2DSM A;  2EOD A;  1WEQ A;  3N9N A;  2P57 A;  2XOC A;  3O34 A;  4GNE A;  2ECW A;  4YC9 A;  3T6R A;  4I7B A;  4Z0R A;  2LGK A;  4CA1 A;  3HCS A;  2KWO A;  3KDE C;  2MA6 A;  5AIT A;  2LGL A;  1K2F A;  2KU3 A;  2I50 A;  5SVI A;  3RPG C;  4FK5 A;  5JG6 A;  3FAN A;  5AIU A;  4S3O C;  4WZ3 B;  4PTB A;  4F52 B;  1DCQ A;  2CKL A;  1RMD A;  4YBM A;  2NAA A;  2C2L A;  4YAT A;  4YBS A;  4AP4 A;  2L0B A;  3N9L A;  2JMJ A;  3O36 A;  2KIZ A;  5TRB A;  3U5P A;  5B75 A;  2LDR A;  3JUE A;  3N9O A;  4F1P A;  3O33 A;  2EGM A;  3L1X A;  2YT5 A;  5D1K B;  1VFY A;  5I3L A;  2F42 A;  1WES A;  2YQM A;  1N87 A;  2UZG A;  2KE1 A;  2LV9 A;  3T9K A;  4YBT A;  3PHD A;  2LGV A;  3N9Q A;  4R2Y A;  2M85 A;  2ECG A;  4IC2 A;  2YW8 A;  2LQ6 A;  3ZVZ B;  3ZNI A;  2M1R A;  4YAX A;  3HCT A;  1T1H A;  3M99 A;  5LKZ A;  1WEO A;  5C11 A;  2G6Q A;  2L80 A;  3N9M A;  3FM8 C;  4MSX A;  2H0D B;  4ZQL A;  2XB1 A;  3O35 A;  3KV6 A;  3ZPV E;  2CSY A;  3E2D A;  4O62 A;  2F6N A;  2HYE D;  1MM2 A;  2YHN A;  2JRJ A;  2LRI C;  1X4I A;  2K16 A;  4C9Z A;  3ZPV 1;  3PUQ A;  3EB6 A;  4OGC A;  3DDT A;  3LQH A;  5D1M B;  2FD4 A;  2OXQ C;  5B78 A;  3KQI A;  2PNX A;  4UI9 B;  3KNV A;  4A4C A;  1Z2Q A;  4LLB A;  2MD8 C;  4O64 A;  4R8P K;  3SOU A;  5C13 A;  4AYC A;  3SOW A;  3O7A A;  1Z6U A;  3O47 A;  2MNZ A;  2KWN A;  2VJF A;  1MM3 A;  4B86 C;  4BBQ A;  2FUU A;  5TBN A;  3GL6 A;  4IC3 A;  3M62 A;  4LKA A;  2KR4 A;  2KKY A;  3PLW A;  3DWD A;  1JM7 B;  2DJA A;  4WA6 A;  3GV4 A;  2YSJ A;  4WZ0 A;  3EB5 A;  5FER A;  4BHW A;  2JM3 A;  4S3O B;  2F6J A;  3IHP A;  3V43 A;  2ECI A;  4GB0 A;  2YRE A;  3C6W A;  4V3L C;  2B0O E;  2EXU A;  3DPL R;  2VJF B;  4B7Y C;  1WIL A;  4CCG X;  2KGI A;  2Y1M A;  3QZV A;  3LQI A;  2PUY A;  2FFW A;  2L5U A;  1WIM A;  3SUB A;  4N4F A;  1U6G B;  2LXP C;  4Q6F A;  4QF2 A;  2LXH C;  4UP0 A;  5J3X A;  3U5O A;  3L11 A;  4I7C A;  2MNY A;  3ZYQ A;  2G45 A;  4P5O B;  3Q1D A;  1VD4 A;  2RSD A;  2FSA A;  2XEU A;  4PPE A;  5KH3 A;  2XOZ A;  3NG2 A;  2LN0 A;  3LVR E;  1HYI A;  4X3G A;  4MVT A;  5G0F A;  3ZTG A;  4GND A;  2MT5 A;  5TDR A;  4LAD B;  1XWH A;  3KV5 A;  2ECT A;  3O70 A;  5EYA F;  2D8U A;  2ECN A;  3FJU B;  2CT2 A;  1F62 A;  5B79 A;  1JM7 A;  2LGG A;  2VJE A;  2ZET C;  1LDJ B;  2FUI A;  5KH9 A;  3MHS A;  5LCW B;  4L7X A;  2M6M A;  5TAB A;  1WGM A;  2MD7 B;  4AVX A;  5SVY A;  1FP0 A;  5LKT A;  5LKU A;  1E4U A;  2KWJ A;  2QIZ A;  5B76 A;  2CRW A;  2M13 A;  5H9M A;  3ASL A;  3DQV R;  5H1T A;  2E61 A;  4H9D A;  3VK6 A;  4AUQ B;  1WEW A;  5SVI B;  3HTK C;  5SVX A;  2VNF A;  3M63 A;  4R7E A;  2VPD A;  2BAY A;  2XP0 A;  5D1L B;  2YUC A;  2JMI A;  2QJ0 A;  4FO9 A;  1WEU A;  1IYM A;  2RI7 A;  2XOY A;  1Z60 A;  3MDB C;  2EA6 A;  4I7D A;  2E6R A;  2VJE B;  3FL2 A;  4GNG A;  2KYU A;  5KH7 A;  2KRE A;  2KWK A;  4A4B A;  2HDP A;  3FEH A;  2YSM A;  5FB1 A;  2VP7 A;  2IQJ A;  1LDK C;  3H7H A;  4FIP A;  4FJC A;  1X4U A;  5H1U A;  5DIN A;  4QQ4 A;  4N3W A;  3C5K A;  1VYX A;  2YUR A;  2EGP A;  5FEY A;  5K3Q A;  4W4U A;  2E6S A;  4LK9 A;  5TDW A;  3O37 A;  2JMD A;  1WEN A;  1G25 A;  3RPG B;  3SOX A;  3RTR B;  2MA5 A;  1WEE A; 
#chains in the Genus database with same CATH homology
 1JOC A;  2QIC A;  5H1V A;  3ZVY A;  2VPG A;  2YYR A;  2K17 A;  1FBV A;  4YAB A;  3HCU A;  4YAD A;  1WEV A;  2MIQ A;  5G05 B;  2VPE A;  3MHH A;  2H0D A;  2G43 A;  3U5M A;  2D8S A;  2KFT A;  2YU4 A;  4ZUX U;  2CSZ A;  1X4J A;  2YQL A;  4WZ2 A;  1DVP A;  3I2D A;  3LQJ A;  5LKX A;  4V3K C;  4AYC B;  2MUM A;  1ZBD B;  4ZDT A;  1HYJ A;  4QF3 A;  2KGG A;  2ECV A;  3LRQ A;  2YHO A;  4TKP B;  1BOR A;  2Y1N A;  1WEP A;  4NN2 A;  2K1J A;  2ECJ A;  4A49 A;  3N9P A;  4L58 A;  4UP5 A;  4LJN A;  3L1Z B;  1CHC A;  2DX8 A;  4XI1 A;  5G04 B;  5FB0 A;  3T7L A;  2IDA A;  5B8D A;  1WE9 A;  3PUR A;  1WEM A;  2L75 A;  2K4D A;  3U5N A;  4GNF A;  2VPB A;  2AN6 A;  2M3H A;  4A0C D;  5DKA A;  1WFK A;  2Y43 A;  2L43 A;  3SHB A;  5B77 A;  2C2V S;  2CKL B;  1V87 A;  2EOD A;  1WEQ A;  3N9N A;  3O34 A;  4GNE A;  2ECW A;  4YC9 A;  3T6R A;  4I7B A;  2LGK A;  4CA1 A;  3HCS A;  2KWO A;  2MA6 A;  5AIT A;  2LGL A;  1K2F A;  2KU3 A;  2I50 A;  3RPG C;  4FK5 A;  5JG6 A;  5AIU A;  4S3O C;  4WZ3 B;  4PTB A;  4F52 B;  4YBM A;  2CKL A;  1RMD A;  2NAA A;  2C2L A;  4YAT A;  4YBS A;  4AP4 A;  2L0B A;  3N9L A;  2JMJ A;  3O36 A;  2KIZ A;  5TRB A;  3U5P A;  5B75 A;  2LDR A;  3N9O A;  3O33 A;  3L1X A;  2YT5 A;  5D1K B;  1VFY A;  5I3L A;  2F42 A;  1WES A;  2YQM A;  1N87 A;  2UZG A;  2KE1 A;  2LV9 A;  4YBT A;  3PHD A;  2LGV A;  3N9Q A;  4R2Y A;  2M85 A;  2ECG A;  4IC2 A;  2YW8 A;  2LQ6 A;  3ZVZ B;  3ZNI A;  2M1R A;  4YAX A;  3HCT A;  1T1H A;  3M99 A;  5LKZ A;  1WEO A;  5C11 A;  2G6Q A;  2L80 A;  3N9M A;  4MSX A;  2H0D B;  4ZQL A;  2XB1 A;  3O35 A;  3KV6 A;  3ZPV E;  2CSY A;  2F6N A;  2HYE D;  1MM2 A;  2YHN A;  2JRJ A;  2LRI C;  1X4I A;  4C9Z A;  2K16 A;  3ZPV 1;  3PUQ A;  3EB6 A;  3LQH A;  5D1M B;  2OXQ C;  5B78 A;  3KQI A;  2PNX A;  4UI9 B;  3KNV A;  4A4C A;  1Z2Q A;  4LLB A;  2MD8 C;  4O64 A;  4R8P K;  3SOU A;  5C13 A;  3SOW A;  3O7A A;  1Z6U A;  2MNZ A;  2KWN A;  2VJF A;  1MM3 A;  4B86 C;  4BBQ A;  2FUU A;  5TBN A;  3GL6 A;  4IC3 A;  3M62 A;  4LKA A;  2KR4 A;  1JM7 B;  4WA6 A;  3GV4 A;  2YSJ A;  4WZ0 A;  3EB5 A;  5FER A;  4BHW A;  4S3O B;  2F6J A;  3IHP A;  3V43 A;  2ECI A;  4GB0 A;  2YRE A;  3C6W A;  4V3L C;  3DPL R;  2VJF B;  4B7Y C;  1WIL A;  4CCG X;  2KGI A;  2Y1M A;  3QZV A;  3LQI A;  2PUY A;  2L5U A;  1WIM A;  4N4F A;  1U6G B;  2LXP C;  4Q6F A;  4QF2 A;  2LXH C;  4UP0 A;  5J3X A;  3U5O A;  3L11 A;  4I7C A;  2MNY A;  3ZYQ A;  2G45 A;  4P5O B;  1VD4 A;  2RSD A;  2FSA A;  2XEU A;  4PPE A;  5KH3 A;  3NG2 A;  2LN0 A;  1HYI A;  4X3G A;  4MVT A;  3ZTG A;  5G0F A;  4GND A;  2MT5 A;  5TDR A;  4LAD B;  1XWH A;  3KV5 A;  2ECT A;  3O70 A;  5EYA F;  2ECN A;  2CT2 A;  1F62 A;  5B79 A;  1JM7 A;  2LGG A;  2VJE A;  2ZET C;  1LDJ B;  2FUI A;  5KH9 A;  3MHS A;  5LCW B;  4L7X A;  2M6M A;  5TAB A;  1WGM A;  2MD7 B;  4AVX A;  1FP0 A;  5LKT A;  5LKU A;  1E4U A;  2KWJ A;  2QIZ A;  5B76 A;  5H9M A;  3ASL A;  3DQV R;  5H1T A;  3VK6 A;  4AUQ B;  1WEW A;  3HTK C;  2VNF A;  3M63 A;  4R7E A;  2VPD A;  2BAY A;  5D1L B;  2YUC A;  2JMI A;  2QJ0 A;  4FO9 A;  1WEU A;  1IYM A;  2RI7 A;  1Z60 A;  2EA6 A;  4I7D A;  2E6R A;  2VJE B;  3FL2 A;  4GNG A;  2KYU A;  5KH7 A;  2KRE A;  2KWK A;  4A4B A;  2HDP A;  2YSM A;  5FB1 A;  2VP7 A;  1LDK C;  4FIP A;  4FJC A;  1X4U A;  5H1U A;  5DIN A;  4N3W A;  3C5K A;  1VYX A;  2YUR A;  2EGP A;  5FEY A;  4W4U A;  2E6S A;  4LK9 A;  5TDW A;  3O37 A;  2JMD A;  1WEN A;  1G25 A;  3RPG B;  3SOX A;  3RTR B;  1WEE A;  2MA5 A;  4AYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...