2EODA

Solution structure of traf-type zinc finger domains (190- 248) from human tnf receptor-associated factor 4
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
GSSGSSGKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords TNF receptor-associated factor 4
publication title Solution structure of TRAF-type zinc finger domains (190 - 248) from human TNF receptor-associated factor 4
rcsb
source organism Homo sapiens
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2007-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2eodA00
2LGLA 3KV6A 5B79A 2ECGA 4BBQA 4ZQLA 1ZBDB 5J3XA 3VK6A 1DVPA 1XWHA 4GNDA 5B75A 3MHSA 4Q6FA 3HCSA 1JM7B 2YQMA 2BAYA 5KH9A 2VPEA 1G25A 3SOXA 3O7AA 2E6RA 1MM3A 1MM2A 4FK5A 5LCWB 5TDWA 4NN2A 3GL6A 4X3GA 4IC2A 4YADA 4R7EA 1WE9A 2FUUA 2PUYA 4UI9B 2VPBA 2LV9A 2I50A 1IYMA 3GV4A 3C5KA 2L0BA 3U5PA 2HDPA 5G0FA 5FB1A 2VPGA 3ZYQA 2KE1A 2VPDA 4QF3A 2Y1NA 4A0CD 2LGGA 5LKZA 4ZDTA 2QIZA 4ZUXU 2CSYA 4C9ZA 3EB6A 4GB0A 5TDRA 1WEUA 1LDKC 3N9NA 2L75A 4R2YA 2ECJA 5AITA 2YHNA 2MUMA 4F52B 2KU3A 2H0DB 4PTBA 5C13A 5FERA 4L7XA 4O64A 1WEOA 2CKLA 4A4CA 1K2FA 5FB0A 2HYED 3SOUA 5D1KB 2KGIA 4V3LC 1Z6UA 2ZETC 4GNGA 4WZ0A 4YABA 5H1TA 1WEVA 3O34A 4AYCB 5LKTA 1JM7A 4TKPB 5G05B 3O37A 2JMJA 5H1VA 1E4UA 5B8DA 5B77A 3DPLR 4GNEA 5H9MA 2KWJA 2L5UA 5D1MB 3T6RA 3PHDA 2LXHC 2ECIA 1HYJA 5JG6A 1LDJB 1RMDA 2OXQC 4W4UA 1WEEA 5G04B 1WEPA 4S3OC 3ZVYA 1N87A 3U5OA 4WZ2A 2MIQA 4N3WA 1WEQA 3ZVZB 1CHCA 3ASLA 2JMDA 2VJEA 2VP7A 2QJ0A 2MA5A 2C2VS 3RPGC 5LKXA 2KWKA 2LN0A 4A4BA 3IHPA 1WESA 4YC9A 2G43A 2YREA 4B7YC 2PNXA 3O70A 5B76A 4AP4A 5KH3A 1F62A 2C2LA 4B86C 2FSAA 3I2DA 2YT5A 3L1XA 2YHOA 1WFKA 2LDRA 3PUQA 5KH7A 3LQHA 3M63A 4L58A 3LQJA 2YUCA 3M99A 1V87A 2MD8C 4YAXA 2Y1MA 3KV5A 1X4JA 5EYAF 3KNVA 3HCUA 2M6MA 3SHBA 4AYCA 5LKUA 1FBVA 2YSJA 4IC3A 2YU4A 2G6QA 4LLBA 1WIMA 3N9OA 4GNFA 2MT5A 2CSZA 5DKAA 3HTKC 3C6WA 3SOWA 2YQLA 1BORA 2G45A 1VFYA 4WA6A 3LRQA 5H1UA 2LGVA 2K1JA 4LKAA 3ZPVE 1T1HA 2M1RA 3L11A 1Z2QA 4AVXA 3NG2A 3FL2A 4FO9A 1U6GB 4UP0A 4S3OB 2QICA 4MVTA 1WEWA 5TBNA 3O33A 2KR4A 1JOCA 5B78A 3LQIA 3L1ZB 2LRIC 2YURA 2XEUA 2CT2A 3T7LA 2YYRA 2RSDA 1WEMA 1X4UA 3MHHA 4LK9A 3O35A 5TABA 1Z60A 2VJFB 3DQVR 2XB1A 4N4FA 3M62A 5TRBA 2ECWA 4I7DA 3N9LA 2UZGA 2LXPC 4V3KC 4AUQB 4CA1A 1WILA 4A49A 2K4DA 4YBTA 2VNFA 2YW8A 1X4IA 3RTRB 5D1LB 2KYUA 2ECTA 2D8SA 2KREA 2EODA 1VD4A 1WGMA 1WENA 4YATA 3V43A 3ZPV1 3N9MA 2F42A 3KQIA 3ZNIA 2K16A 2KWNA 2H0DA 5C11A 4LADB 2LGKA 3N9PA 4XI1A 5FEYA 2KGGA 4R8PK 3U5NA 2Y43A 2MD7B 2NAAA 2F6JA 2MA6A 2RI7A 2VJEB 4FJCA 4CCGX 2JMIA 2KWOA 3EB5A 2L80A 2MNYA 2M3HA 2KFTA 3O36A 4YBSA 1HYIA 2EGPA 2M85A 2AN6A 3N9QA 2IDAA 4MSXA 1VYXA 3U5MA 4LJNA 4I7CA 4FIPA 2ECNA 3QZVA 5I3LA 2FUIA 4YBMA 4QF2A 2ECVA 2VJFA 2LQ6A 2L43A 4UP5A 3HCTA 2F6NA 2KIZA 3ZTGA 2E6SA 2YSMA 3PURA 5AIUA 4BHWA 1FP0A 5DINA 2MNZA 3RPGB 2EA6A 4I7BA 4WZ3B 2K17A 2DX8A 2CKLB 4P5OB 4PPEA 2JRJA
chains in the Genus database with same CATH superfamily
3FEHA 2LGLA 3KV6A 5B79A 2ECGA 4BBQA 1ZBDB 4ZQLA 5J3XA 3VK6A 1DVPA 1XWHA 4GNDA 5B75A 3MHSA 4Q6FA 3HCSA 1JM7B 2YQMA 2BAYA 5KH9A 2VPEA 1G25A 3LJUX 3SOXA 3O7AA 2E6RA 1MM3A 1MM2A 4FK5A 5LCWB 5TDWA 4NN2A 3GL6A 4X3GA 4IC2A 4YADA 4R7EA 1WE9A 2FUUA 2PUYA 4UI9B 2VPBA 2LV9A 2I50A 1IYMA 3GV4A 3C5KA 2L0BA 3U5PA 2HDPA 5G0FA 5FB1A 2VPGA 4H9DA 3ZYQA 2CONA 2KE1A 2VPDA 4QF3A 2Y1NA 4A0CD 2LGGA 3JUEA 5LKZA 4ZDTA 2QIZA 2E61A 4ZUXU 2CSYA 4C9ZA 3EB6A 4GB0A 5TDRA 1WEUA 1LDKC 3N9NA 2L75A 4R2YA 2ECJA 5AITA 2YHNA 2MUMA 4F52B 2KU3A 2H0DB 4PTBA 5C13A 3O47A 5FERA 4L7XA 4O64A 2CKLA 1DCQA 1WEOA 1K2FA 4A4CA 5FB0A 5SVIB 2HYED 3SOUA 5D1KB 2KGIA 3LVRE 4V3LC 1Z6UA 2ZETC 4GNGA 4WZ0A 4YABA 5H1TA 1WEVA 3O34A 4AYCB 5LKTA 2L7PA 1JM7A 4TKPB 2P57A 5G05B 3O37A 2JMJA 5H1VA 1E4UA 5B8DA 5B77A 3LDYA 4OGCA 3DPLR 4GNEA 5H9MA 2KWJA 2L5UA 5D1MB 3T6RA 3PHDA 2DSMA 2LXHC 4O62A 2ECIA 1HYJA 3H7HA 5JG6A 1LDJB 1RMDA 3FJUB 2OXQC 4W4UA 1WEEA 5G04B 1WEPA 4S3OC 3ZVYA 1N87A 3U5OA 4WZ2A 2MIQA 4N3WA 2M13A 2B0OE 1WEQA 3ZVZB 1CHCA 3ASLA 2JMDA 2VJEA 2VP7A 2QJ0A 2MA5A 2C2VS 2CSVA 3RPGC 5LKXA 2KWKA 2LN0A 4A4BA 3IHPA 1WESA 4YC9A 2G43A 2YREA 4B7YC 2PNXA 3O70A 5B76A 4AP4A 5KH3A 1F62A 2C2LA 4B86C 2CRRA 2KKXA 2FSAA 3I2DA 2YT5A 3LVQE 3L1XA 2YHOA 1WFKA 2LDRA 3PUQA 5KH7A 3LQHA 3M63A 4L58A 3LQJA 2YUCA 2IQJA 3M99A 1V87A 2MD8C 3T9KA 4YAXA 2Y1MA 3KV5A 1X4JA 5EYAF 3KNVA 2RR4A 3HCUA 2M6MA 3SHBA 4AYCA 5SVXA 5LKUA 1FBVA 2LAUA 2YSJA 4IC3A 2YU4A 2G6QA 4LLBA 1WIMA 3N9OA 4GNFA 2MT5A 2CSZA 5DKAA 3HTKC 3C6WA 2XOZA 3SOWA 2YQLA 1BORA 2G45A 1VFYA 4WA6A 3LRQA 5H1UA 2LGVA 2K1JA 2D8UA 4LKAA 3ZPVE 1T1HA 2JM3A 2M1RA 3L11A 1Z2QA 4AVXA 3NG2A 3FL2A 4FO9A 1U6GB 4UP0A 4S3OB 3KDEC 2QICA 4MVTA 1WEWA 2XOYA 5TBNA 2DJAA 3O33A 2KR4A 1JOCA 5B78A 3LQIA 3L1ZB 3SUBA 2LRIC 2YURA 2XEUA 4Z0OA 3FANA 2CT2A 3T7LA 2YYRA 2RSDA 1WEMA 1X4UA 3MHHA 4LK9A 1MBMA 3O35A 4F1PA 5TABA 2KKYA 1Z60A 2VJFB 3DQVR 3Q1DA 2XB1A 4N4FA 3M62A 3DWDA 5TRBA 3FM8C 2ECWA 4I7DA 3N9LA 2UZGA 2LXPC 4QQ4A 4V3KC 4AUQB 4CA1A 1WILA 4A49A 2K4DA 4YBTA 2VNFA 2YW8A 1X4IA 5D1LB 3RTRB 3PLWA 2XOCA 2KYUA 2ECTA 2D8SA 2KREA 2EODA 3M7KA 1VD4A 1WGMA 1WENA 2EGMA 4YATA 3V43A 3ZPV1 3N9MA 2F42A 3KQIA 3ZNIA 2K16A 2KWNA 2H0DA 5C11A 4LADB 2LGKA 3DDTA 4OGEA 3N9PA 4XI1A 5FEYA 2KGGA 4R8PK 3U5NA 5SVIA 2Y43A 2MD7B 2NAAA 2F6JA 2MA6A 2RI7A 2VJEB 2EXUA 2FD4A 4FJCA 4CCGX 3MDBC 2JUNA 2JMIA 2KWOA 3EB5A 2L80A 3FAOA 2OWAA 2MNYA 2M3HA 5SVYA 2KFTA 3O36A 4YBSA 2MKEA 2CRWA 1HYIA 2EGPA 2M85A 2AN6A 2YVRA 3E2DA 2FFWA 3N9QA 2IDAA 4MSXA 1VYXA 5K3QA 3U5MA 4LJNA 2XP0A 4I7CA 4FIPA 2ECNA 4Z0RA 3QZVA 5I3LA 2FUIA 4YBMA 4QF2A 2ECVA 2VJFA 2LQ6A 2L43A 4UP5A 3HCTA 2F6NA 2KIZA 3ZTGA 2E6SA 2YSMA 3PURA 5AIUA 4BHWA 1FP0A 5DINA 2MNZA 3RPGB 2EA6A 4I7BA 4WZ3B 2K17A 2DX8A 2CKLB 4P5OB 4PPEA 2JRJA
chains in the Genus database with same CATH topology
2LGLA 3KV6A 5B79A 2ECGA 4BBQA 4ZQLA 1ZBDB 5J3XA 3VK6A 1DVPA 1XWHA 4GNDA 5B75A 3MHSA 4Q6FA 3HCSA 1JM7B 2YQMA 2BAYA 5KH9A 2VPEA 1G25A 3SOXA 3O7AA 2E6RA 1MM3A 1MM2A 4FK5A 5LCWB 5TDWA 4NN2A 3GL6A 4X3GA 4IC2A 4YADA 4R7EA 1WE9A 2FUUA 2PUYA 4UI9B 2VPBA 2LV9A 2I50A 1IYMA 3GV4A 3C5KA 2L0BA 3U5PA 2HDPA 5G0FA 5FB1A 2VPGA 3ZYQA 2KE1A 2VPDA 4QF3A 2Y1NA 4A0CD 2LGGA 5LKZA 4ZDTA 2QIZA 4ZUXU 2CSYA 4C9ZA 3EB6A 4GB0A 5TDRA 1WEUA 1LDKC 3N9NA 2L75A 4R2YA 2ECJA 5AITA 2YHNA 2MUMA 4F52B 2KU3A 2H0DB 4PTBA 5C13A 5FERA 4L7XA 4O64A 1WEOA 2CKLA 4A4CA 1K2FA 5FB0A 2HYED 3SOUA 5D1KB 2KGIA 4V3LC 1Z6UA 2ZETC 4GNGA 4WZ0A 4YABA 5H1TA 1WEVA 3O34A 4AYCB 5LKTA 1JM7A 4TKPB 5G05B 3O37A 2JMJA 5H1VA 1E4UA 5B8DA 5B77A 3DPLR 4GNEA 5H9MA 2KWJA 2L5UA 5D1MB 3T6RA 3PHDA 2LXHC 2ECIA 1HYJA 5JG6A 1LDJB 1RMDA 2OXQC 4W4UA 1WEEA 5G04B 1WEPA 4S3OC 3ZVYA 1N87A 3U5OA 4WZ2A 2MIQA 4N3WA 1WEQA 3ZVZB 1CHCA 3ASLA 2JMDA 2VJEA 2VP7A 2QJ0A 2MA5A 2C2VS 3RPGC 5LKXA 2KWKA 2LN0A 4A4BA 3IHPA 1WESA 4YC9A 2G43A 2YREA 4B7YC 2PNXA 3O70A 5B76A 4AP4A 5KH3A 1F62A 2C2LA 4B86C 2FSAA 3I2DA 2YT5A 3L1XA 2YHOA 1WFKA 2LDRA 3PUQA 5KH7A 3LQHA 3M63A 4L58A 3LQJA 2YUCA 3M99A 1V87A 2MD8C 4YAXA 2Y1MA 3KV5A 1X4JA 5EYAF 3KNVA 3HCUA 2M6MA 3SHBA 4AYCA 5LKUA 1FBVA 2YSJA 4IC3A 2YU4A 2G6QA 4LLBA 1WIMA 3N9OA 4GNFA 2MT5A 2CSZA 5DKAA 3HTKC 3C6WA 3SOWA 2YQLA 1BORA 2G45A 1VFYA 4WA6A 3LRQA 5H1UA 2LGVA 2K1JA 4LKAA 3ZPVE 1T1HA 2M1RA 3L11A 1Z2QA 4AVXA 3NG2A 3FL2A 4FO9A 1U6GB 4UP0A 4S3OB 2QICA 4MVTA 1WEWA 5TBNA 3O33A 2KR4A 1JOCA 5B78A 3LQIA 3L1ZB 2LRIC 2YURA 2XEUA 2CT2A 3T7LA 2YYRA 2RSDA 1WEMA 1X4UA 3MHHA 4LK9A 3O35A 5TABA 1Z60A 2VJFB 3DQVR 2XB1A 4N4FA 3M62A 5TRBA 2ECWA 4I7DA 3N9LA 2UZGA 2LXPC 4V3KC 4AUQB 4CA1A 1WILA 4A49A 2K4DA 4YBTA 2VNFA 2YW8A 1X4IA 3RTRB 5D1LB 2KYUA 2ECTA 2D8SA 2KREA 2EODA 1VD4A 1WGMA 1WENA 4YATA 3V43A 3ZPV1 3N9MA 2F42A 3KQIA 3ZNIA 2K16A 2KWNA 2H0DA 5C11A 4LADB 2LGKA 3N9PA 4XI1A 5FEYA 2KGGA 4R8PK 3U5NA 2Y43A 2MD7B 2NAAA 2F6JA 2MA6A 2RI7A 2VJEB 4FJCA 4CCGX 2JMIA 2KWOA 3EB5A 2L80A 2MNYA 2M3HA 2KFTA 3O36A 4YBSA 1HYIA 2EGPA 2M85A 2AN6A 3N9QA 2IDAA 4MSXA 1VYXA 3U5MA 4LJNA 4I7CA 4FIPA 2ECNA 3QZVA 5I3LA 2FUIA 4YBMA 4QF2A 2ECVA 2VJFA 2LQ6A 2L43A 4UP5A 3HCTA 2F6NA 2KIZA 3ZTGA 2E6SA 2YSMA 3PURA 5AIUA 4BHWA 1FP0A 5DINA 2MNZA 3RPGB 2EA6A 4I7BA 4WZ3B 2K17A 2DX8A 2CKLB 4P5OB 4PPEA 2JRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGL A;  3KV6 A;  5B79 A;  2ECG A;  4BBQ A;  4ZQL A;  1ZBD B;  5J3X A;  3VK6 A;  1DVP A;  1XWH A;  4GND A;  5B75 A;  3MHS A;  4Q6F A;  3HCS A;  1JM7 B;  2YQM A;  2BAY A;  5KH9 A;  2VPE A;  1G25 A;  3SOX A;  3O7A A;  2E6R A;  1MM3 A;  1MM2 A;  4FK5 A;  5LCW B;  5TDW A;  4NN2 A;  3GL6 A;  4X3G A;  4IC2 A;  4YAD A;  4R7E A;  1WE9 A;  2FUU A;  2PUY A;  4UI9 B;  2VPB A;  2LV9 A;  2I50 A;  1IYM A;  3GV4 A;  3C5K A;  2L0B A;  3U5P A;  2HDP A;  5G0F A;  5FB1 A;  2VPG A;  3ZYQ A;  2KE1 A;  2VPD A;  4QF3 A;  2Y1N A;  4A0C D;  2LGG A;  5LKZ A;  4ZDT A;  2QIZ A;  4ZUX U;  2CSY A;  4C9Z A;  3EB6 A;  4GB0 A;  5TDR A;  1WEU A;  1LDK C;  3N9N A;  2L75 A;  4R2Y A;  2ECJ A;  5AIT A;  2YHN A;  2MUM A;  4F52 B;  2KU3 A;  2H0D B;  4PTB A;  5C13 A;  5FER A;  4L7X A;  4O64 A;  1WEO A;  2CKL A;  4A4C A;  1K2F A;  5FB0 A;  2HYE D;  3SOU A;  5D1K B;  2KGI A;  4V3L C;  1Z6U A;  2ZET C;  4GNG A;  4WZ0 A;  4YAB A;  5H1T A;  1WEV A;  3O34 A;  4AYC B;  5LKT A;  1JM7 A;  4TKP B;  5G05 B;  3O37 A;  2JMJ A;  5H1V A;  1E4U A;  5B8D A;  5B77 A;  3DPL R;  4GNE A;  5H9M A;  2KWJ A;  2L5U A;  5D1M B;  3T6R A;  3PHD A;  2LXH C;  2ECI A;  1HYJ A;  5JG6 A;  1LDJ B;  1RMD A;  2OXQ C;  4W4U A;  1WEE A;  5G04 B;  1WEP A;  4S3O C;  3ZVY A;  1N87 A;  3U5O A;  4WZ2 A;  2MIQ A;  4N3W A;  1WEQ A;  3ZVZ B;  1CHC A;  3ASL A;  2JMD A;  2VJE A;  2VP7 A;  2QJ0 A;  2MA5 A;  2C2V S;  3RPG C;  5LKX A;  2KWK A;  2LN0 A;  4A4B A;  3IHP A;  1WES A;  4YC9 A;  2G43 A;  2YRE A;  4B7Y C;  2PNX A;  3O70 A;  5B76 A;  4AP4 A;  5KH3 A;  1F62 A;  2C2L A;  4B86 C;  2FSA A;  3I2D A;  2YT5 A;  3L1X A;  2YHO A;  1WFK A;  2LDR A;  3PUQ A;  5KH7 A;  3LQH A;  3M63 A;  4L58 A;  3LQJ A;  2YUC A;  3M99 A;  1V87 A;  2MD8 C;  4YAX A;  2Y1M A;  3KV5 A;  1X4J A;  5EYA F;  3KNV A;  3HCU A;  2M6M A;  3SHB A;  4AYC A;  5LKU A;  1FBV A;  2YSJ A;  4IC3 A;  2YU4 A;  2G6Q A;  4LLB A;  1WIM A;  3N9O A;  4GNF A;  2MT5 A;  2CSZ A;  5DKA A;  3HTK C;  3C6W A;  3SOW A;  2YQL A;  1BOR A;  2G45 A;  1VFY A;  4WA6 A;  3LRQ A;  5H1U A;  2LGV A;  2K1J A;  4LKA A;  3ZPV E;  1T1H A;  2M1R A;  3L11 A;  1Z2Q A;  4AVX A;  3NG2 A;  3FL2 A;  4FO9 A;  1U6G B;  4UP0 A;  4S3O B;  2QIC A;  4MVT A;  1WEW A;  5TBN A;  3O33 A;  2KR4 A;  1JOC A;  5B78 A;  3LQI A;  3L1Z B;  2LRI C;  2YUR A;  2XEU A;  2CT2 A;  3T7L A;  2YYR A;  2RSD A;  1WEM A;  1X4U A;  3MHH A;  4LK9 A;  3O35 A;  5TAB A;  1Z60 A;  2VJF B;  3DQV R;  2XB1 A;  4N4F A;  3M62 A;  5TRB A;  2ECW A;  4I7D A;  3N9L A;  2UZG A;  2LXP C;  4V3K C;  4AUQ B;  4CA1 A;  1WIL A;  4A49 A;  2K4D A;  4YBT A;  2VNF A;  2YW8 A;  1X4I A;  3RTR B;  5D1L B;  2KYU A;  2ECT A;  2D8S A;  2KRE A;  2EOD A;  1VD4 A;  1WGM A;  1WEN A;  4YAT A;  3V43 A;  3ZPV 1;  3N9M A;  2F42 A;  3KQI A;  3ZNI A;  2K16 A;  2KWN A;  2H0D A;  5C11 A;  4LAD B;  2LGK A;  3N9P A;  4XI1 A;  5FEY A;  2KGG A;  4R8P K;  3U5N A;  2Y43 A;  2MD7 B;  2NAA A;  2F6J A;  2MA6 A;  2RI7 A;  2VJE B;  4FJC A;  4CCG X;  2JMI A;  2KWO A;  3EB5 A;  2L80 A;  2MNY A;  2M3H A;  2KFT A;  3O36 A;  4YBS A;  1HYI A;  2EGP A;  2M85 A;  2AN6 A;  3N9Q A;  2IDA A;  4MSX A;  1VYX A;  3U5M A;  4LJN A;  4I7C A;  4FIP A;  2ECN A;  3QZV A;  5I3L A;  2FUI A;  4YBM A;  4QF2 A;  2ECV A;  2VJF A;  2LQ6 A;  2L43 A;  4UP5 A;  3HCT A;  2F6N A;  2KIZ A;  3ZTG A;  2E6S A;  2YSM A;  3PUR A;  5AIU A;  4BHW A;  1FP0 A;  5DIN A;  2MNZ A;  3RPG B;  2EA6 A;  4I7B A;  4WZ3 B;  2K17 A;  2DX8 A;  2CKL B;  4P5O B;  4PPE A;  2JRJ A; 
#chains in the Genus database with same CATH topology
 3FEH A;  2LGL A;  3KV6 A;  5B79 A;  2ECG A;  4BBQ A;  1ZBD B;  4ZQL A;  5J3X A;  3VK6 A;  1DVP A;  1XWH A;  4GND A;  5B75 A;  3MHS A;  4Q6F A;  3HCS A;  1JM7 B;  2YQM A;  2BAY A;  5KH9 A;  2VPE A;  1G25 A;  3LJU X;  3SOX A;  3O7A A;  2E6R A;  1MM3 A;  1MM2 A;  4FK5 A;  5LCW B;  5TDW A;  4NN2 A;  3GL6 A;  4X3G A;  4IC2 A;  4YAD A;  4R7E A;  1WE9 A;  2FUU A;  2PUY A;  4UI9 B;  2VPB A;  2LV9 A;  2I50 A;  1IYM A;  3GV4 A;  3C5K A;  2L0B A;  3U5P A;  2HDP A;  5G0F A;  5FB1 A;  2VPG A;  4H9D A;  3ZYQ A;  2CON A;  2KE1 A;  2VPD A;  4QF3 A;  2Y1N A;  4A0C D;  2LGG A;  3JUE A;  5LKZ A;  4ZDT A;  2QIZ A;  2E61 A;  4ZUX U;  2CSY A;  4C9Z A;  3EB6 A;  4GB0 A;  5TDR A;  1WEU A;  1LDK C;  3N9N A;  2L75 A;  4R2Y A;  2ECJ A;  5AIT A;  2YHN A;  2MUM A;  4F52 B;  2KU3 A;  2H0D B;  4PTB A;  5C13 A;  3O47 A;  5FER A;  4L7X A;  4O64 A;  2CKL A;  1DCQ A;  1WEO A;  1K2F A;  4A4C A;  5FB0 A;  5SVI B;  2HYE D;  3SOU A;  5D1K B;  2KGI A;  3LVR E;  4V3L C;  1Z6U A;  2ZET C;  4GNG A;  4WZ0 A;  4YAB A;  5H1T A;  1WEV A;  3O34 A;  4AYC B;  5LKT A;  2L7P A;  1JM7 A;  4TKP B;  2P57 A;  5G05 B;  3O37 A;  2JMJ A;  5H1V A;  1E4U A;  5B8D A;  5B77 A;  3LDY A;  4OGC A;  3DPL R;  4GNE A;  5H9M A;  2KWJ A;  2L5U A;  5D1M B;  3T6R A;  3PHD A;  2DSM A;  2LXH C;  4O62 A;  2ECI A;  1HYJ A;  3H7H A;  5JG6 A;  1LDJ B;  1RMD A;  3FJU B;  2OXQ C;  4W4U A;  1WEE A;  5G04 B;  1WEP A;  4S3O C;  3ZVY A;  1N87 A;  3U5O A;  4WZ2 A;  2MIQ A;  4N3W A;  2M13 A;  2B0O E;  1WEQ A;  3ZVZ B;  1CHC A;  3ASL A;  2JMD A;  2VJE A;  2VP7 A;  2QJ0 A;  2MA5 A;  2C2V S;  2CSV A;  3RPG C;  5LKX A;  2KWK A;  2LN0 A;  4A4B A;  3IHP A;  1WES A;  4YC9 A;  2G43 A;  2YRE A;  4B7Y C;  2PNX A;  3O70 A;  5B76 A;  4AP4 A;  5KH3 A;  1F62 A;  2C2L A;  4B86 C;  2CRR A;  2KKX A;  2FSA A;  3I2D A;  2YT5 A;  3LVQ E;  3L1X A;  2YHO A;  1WFK A;  2LDR A;  3PUQ A;  5KH7 A;  3LQH A;  3M63 A;  4L58 A;  3LQJ A;  2YUC A;  2IQJ A;  3M99 A;  1V87 A;  2MD8 C;  3T9K A;  4YAX A;  2Y1M A;  3KV5 A;  1X4J A;  5EYA F;  3KNV A;  2RR4 A;  3HCU A;  2M6M A;  3SHB A;  4AYC A;  5SVX A;  5LKU A;  1FBV A;  2LAU A;  2YSJ A;  4IC3 A;  2YU4 A;  2G6Q A;  4LLB A;  1WIM A;  3N9O A;  4GNF A;  2MT5 A;  2CSZ A;  5DKA A;  3HTK C;  3C6W A;  2XOZ A;  3SOW A;  2YQL A;  1BOR A;  2G45 A;  1VFY A;  4WA6 A;  3LRQ A;  5H1U A;  2LGV A;  2K1J A;  2D8U A;  4LKA A;  3ZPV E;  1T1H A;  2JM3 A;  2M1R A;  3L11 A;  1Z2Q A;  4AVX A;  3NG2 A;  3FL2 A;  4FO9 A;  1U6G B;  4UP0 A;  4S3O B;  3KDE C;  2QIC A;  4MVT A;  1WEW A;  2XOY A;  5TBN A;  2DJA A;  3O33 A;  2KR4 A;  1JOC A;  5B78 A;  3LQI A;  3L1Z B;  3SUB A;  2LRI C;  2YUR A;  2XEU A;  4Z0O A;  3FAN A;  2CT2 A;  3T7L A;  2YYR A;  2RSD A;  1WEM A;  1X4U A;  3MHH A;  4LK9 A;  1MBM A;  3O35 A;  4F1P A;  5TAB A;  2KKY A;  1Z60 A;  2VJF B;  3DQV R;  3Q1D A;  2XB1 A;  4N4F A;  3M62 A;  3DWD A;  5TRB A;  3FM8 C;  2ECW A;  4I7D A;  3N9L A;  2UZG A;  2LXP C;  4QQ4 A;  4V3K C;  4AUQ B;  4CA1 A;  1WIL A;  4A49 A;  2K4D A;  4YBT A;  2VNF A;  2YW8 A;  1X4I A;  5D1L B;  3RTR B;  3PLW A;  2XOC A;  2KYU A;  2ECT A;  2D8S A;  2KRE A;  2EOD A;  3M7K A;  1VD4 A;  1WGM A;  1WEN A;  2EGM A;  4YAT A;  3V43 A;  3ZPV 1;  3N9M A;  2F42 A;  3KQI A;  3ZNI A;  2K16 A;  2KWN A;  2H0D A;  5C11 A;  4LAD B;  2LGK A;  3DDT A;  4OGE A;  3N9P A;  4XI1 A;  5FEY A;  2KGG A;  4R8P K;  3U5N A;  5SVI A;  2Y43 A;  2MD7 B;  2NAA A;  2F6J A;  2MA6 A;  2RI7 A;  2VJE B;  2EXU A;  2FD4 A;  4FJC A;  4CCG X;  3MDB C;  2JUN A;  2JMI A;  2KWO A;  3EB5 A;  2L80 A;  3FAO A;  2OWA A;  2MNY A;  2M3H A;  5SVY A;  2KFT A;  3O36 A;  4YBS A;  2MKE A;  2CRW A;  1HYI A;  2EGP A;  2M85 A;  2AN6 A;  2YVR A;  3E2D A;  2FFW A;  3N9Q A;  2IDA A;  4MSX A;  1VYX A;  5K3Q A;  3U5M A;  4LJN A;  2XP0 A;  4I7C A;  4FIP A;  2ECN A;  4Z0R A;  3QZV A;  5I3L A;  2FUI A;  4YBM A;  4QF2 A;  2ECV A;  2VJF A;  2LQ6 A;  2L43 A;  4UP5 A;  3HCT A;  2F6N A;  2KIZ A;  3ZTG A;  2E6S A;  2YSM A;  3PUR A;  5AIU A;  4BHW A;  1FP0 A;  5DIN A;  2MNZ A;  3RPG B;  2EA6 A;  4I7B A;  4WZ3 B;  2K17 A;  2DX8 A;  2CKL B;  4P5O B;  4PPE A;  2JRJ A; 
#chains in the Genus database with same CATH homology
 2LGL A;  3KV6 A;  5B79 A;  2ECG A;  4BBQ A;  4ZQL A;  1ZBD B;  5J3X A;  3VK6 A;  1DVP A;  1XWH A;  4GND A;  5B75 A;  3MHS A;  4Q6F A;  3HCS A;  1JM7 B;  2YQM A;  2BAY A;  5KH9 A;  2VPE A;  1G25 A;  3SOX A;  3O7A A;  2E6R A;  1MM3 A;  1MM2 A;  4FK5 A;  5LCW B;  5TDW A;  4NN2 A;  3GL6 A;  4X3G A;  4IC2 A;  4YAD A;  4R7E A;  1WE9 A;  2FUU A;  2PUY A;  4UI9 B;  2VPB A;  2LV9 A;  2I50 A;  1IYM A;  3GV4 A;  3C5K A;  2L0B A;  3U5P A;  2HDP A;  5G0F A;  5FB1 A;  2VPG A;  3ZYQ A;  2KE1 A;  2VPD A;  4QF3 A;  2Y1N A;  4A0C D;  2LGG A;  5LKZ A;  4ZDT A;  2QIZ A;  4ZUX U;  2CSY A;  4C9Z A;  3EB6 A;  4GB0 A;  5TDR A;  1WEU A;  1LDK C;  3N9N A;  2L75 A;  4R2Y A;  2ECJ A;  5AIT A;  2YHN A;  2MUM A;  4F52 B;  2KU3 A;  2H0D B;  4PTB A;  5C13 A;  5FER A;  4L7X A;  4O64 A;  1WEO A;  2CKL A;  4A4C A;  1K2F A;  5FB0 A;  2HYE D;  3SOU A;  5D1K B;  2KGI A;  4V3L C;  1Z6U A;  2ZET C;  4GNG A;  4WZ0 A;  4YAB A;  5H1T A;  1WEV A;  3O34 A;  4AYC B;  5LKT A;  1JM7 A;  4TKP B;  5G05 B;  3O37 A;  2JMJ A;  5H1V A;  1E4U A;  5B8D A;  5B77 A;  3DPL R;  4GNE A;  5H9M A;  2KWJ A;  2L5U A;  5D1M B;  3T6R A;  3PHD A;  2LXH C;  2ECI A;  1HYJ A;  5JG6 A;  1LDJ B;  1RMD A;  2OXQ C;  4W4U A;  1WEE A;  5G04 B;  1WEP A;  4S3O C;  3ZVY A;  1N87 A;  3U5O A;  4WZ2 A;  2MIQ A;  4N3W A;  1WEQ A;  3ZVZ B;  1CHC A;  3ASL A;  2JMD A;  2VJE A;  2VP7 A;  2QJ0 A;  2MA5 A;  2C2V S;  3RPG C;  5LKX A;  2KWK A;  2LN0 A;  4A4B A;  3IHP A;  1WES A;  4YC9 A;  2G43 A;  2YRE A;  4B7Y C;  2PNX A;  3O70 A;  5B76 A;  4AP4 A;  5KH3 A;  1F62 A;  2C2L A;  4B86 C;  2FSA A;  3I2D A;  2YT5 A;  3L1X A;  2YHO A;  1WFK A;  2LDR A;  3PUQ A;  5KH7 A;  3LQH A;  3M63 A;  4L58 A;  3LQJ A;  2YUC A;  3M99 A;  1V87 A;  2MD8 C;  4YAX A;  2Y1M A;  3KV5 A;  1X4J A;  5EYA F;  3KNV A;  3HCU A;  2M6M A;  3SHB A;  4AYC A;  5LKU A;  1FBV A;  2YSJ A;  4IC3 A;  2YU4 A;  2G6Q A;  4LLB A;  1WIM A;  3N9O A;  4GNF A;  2MT5 A;  2CSZ A;  5DKA A;  3HTK C;  3C6W A;  3SOW A;  2YQL A;  1BOR A;  2G45 A;  1VFY A;  4WA6 A;  3LRQ A;  5H1U A;  2LGV A;  2K1J A;  4LKA A;  3ZPV E;  1T1H A;  2M1R A;  3L11 A;  1Z2Q A;  4AVX A;  3NG2 A;  3FL2 A;  4FO9 A;  1U6G B;  4UP0 A;  4S3O B;  2QIC A;  4MVT A;  1WEW A;  5TBN A;  3O33 A;  2KR4 A;  1JOC A;  5B78 A;  3LQI A;  3L1Z B;  2LRI C;  2YUR A;  2XEU A;  2CT2 A;  3T7L A;  2YYR A;  2RSD A;  1WEM A;  1X4U A;  3MHH A;  4LK9 A;  3O35 A;  5TAB A;  1Z60 A;  2VJF B;  3DQV R;  2XB1 A;  4N4F A;  3M62 A;  5TRB A;  2ECW A;  4I7D A;  3N9L A;  2UZG A;  2LXP C;  4V3K C;  4AUQ B;  4CA1 A;  1WIL A;  4A49 A;  2K4D A;  4YBT A;  2VNF A;  2YW8 A;  1X4I A;  3RTR B;  5D1L B;  2KYU A;  2ECT A;  2D8S A;  2KRE A;  2EOD A;  1VD4 A;  1WGM A;  1WEN A;  4YAT A;  3V43 A;  3ZPV 1;  3N9M A;  2F42 A;  3KQI A;  3ZNI A;  2K16 A;  2KWN A;  2H0D A;  5C11 A;  4LAD B;  2LGK A;  3N9P A;  4XI1 A;  5FEY A;  2KGG A;  4R8P K;  3U5N A;  2Y43 A;  2MD7 B;  2NAA A;  2F6J A;  2MA6 A;  2RI7 A;  2VJE B;  4FJC A;  4CCG X;  2JMI A;  2KWO A;  3EB5 A;  2L80 A;  2MNY A;  2M3H A;  2KFT A;  3O36 A;  4YBS A;  1HYI A;  2EGP A;  2M85 A;  2AN6 A;  3N9Q A;  2IDA A;  4MSX A;  1VYX A;  3U5M A;  4LJN A;  4I7C A;  4FIP A;  2ECN A;  3QZV A;  5I3L A;  2FUI A;  4YBM A;  4QF2 A;  2ECV A;  2VJF A;  2LQ6 A;  2L43 A;  4UP5 A;  3HCT A;  2F6N A;  2KIZ A;  3ZTG A;  2E6S A;  2YSM A;  3PUR A;  5AIU A;  4BHW A;  1FP0 A;  5DIN A;  2MNZ A;  3RPG B;  2EA6 A;  4I7B A;  4WZ3 B;  2K17 A;  2DX8 A;  2CKL B;  4P5O B;  4PPE A;  2JRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...