2CSYA

Solution structure of the ring domain of the zinc finger protein 183-like 1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
b'GSSGSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger protein 183-like 1
publication title Solution structure of the RING domain of the Zinc finger protein 183-like 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 10
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2csyA01
1FBVA 2LRIC 3FL2A 1VFYA 5D1LB 3RPGC 3N9NA 5FERA 3ZNIA 4QF3A 5G05B 2ECWA 2MUMA 4WZ2A 2HDPA 2D8SA 2M6MA 5LKTA 2FUUA 2CKLB 5EYAF 4LKAA 3SOUA 4UP0A 5H1TA 4B86C 1XWHA 2MA6A 1ZBDB 5DINA 2LXPC 4AYCA 2YQMA 2XEUA 3PHDA 3SOXA 3N9PA 3M62A 2YUCA 1V87A 2F6JA 3U5PA 2KGGA 3V43A 4V3KC 5FB0A 4IC3A 2MT5A 4BBQA 5B78A 2ECIA 4YBMA 1WEMA 4S3OB 3N9LA 4I7BA 4C9ZA 2ECVA 4BHWA 3MHHA 2YSJA 2JMDA 4CA1A 5FEYA 3IHPA 2YREA 4MSXA 5AIUA 5B76A 5H1VA 1WEUA 1JM7B 1Z2QA 1G25A 3NG2A 2F6NA 4YADA 2BAYA 5G0FA 2M1RA 5TDWA 2YSMA 2E6RA 2YHNA 2C2LA 4F52B 5D1MB 1MM2A 2KYUA 4P5OB 2ECGA 2VPGA 2CT2A 3T6RA 3KNVA 3ZVYA 4B7YC 4GNEA 3ZPVE 2KR4A 2QIZA 2L5UA 2YHOA 2LGVA 1Z60A 2KIZA 4S3OC 5FB1A 2JMJA 1WFKA 2L80A 4LADB 4I7DA 2MNYA 2K16A 3PURA 4ZDTA 4PTBA 1LDKC 2FUIA 3N9OA 1WEOA 4N4FA 5H1UA 5KH7A 4YC9A 3LQHA 4TKPB 5C13A 5C11A 4QF2A 5AITA 4LK9A 4PPEA 2VJFA 5D1KB 1WENA 2Y1MA 4I7CA 5KH3A 2LV9A 1X4UA 2G6QA 3ZPV1 4N3WA 1U6GB 2VPEA 2YQLA 3N9MA 3SHBA 4W4UA 2Y1NA 3M63A 2I50A 4V3LC 1VYXA 3GV4A 2VP7A 1X4IA 4FK5A 2OXQC 1LDJB 4Q6FA 4A0CD 3T7LA 4R2YA 2K17A 5B75A 5B77A 4UI9B 2NAAA 1BORA 3EB6A 2UZGA 2VJFB 2VPBA 4FO9A 2KFTA 3QZVA 1WIMA 1DVPA 2QICA 3O7AA 2RI7A 3O35A 2FSAA 1VD4A 4GNGA 1T1HA 2PUYA 4A4BA 3ASLA 4AYCB 1WESA 2K1JA 2VNFA 2XB1A 4AVXA 2KU3A 5LCWB 4ZUXU 1N87A 2VJEA 4FIPA 1Z6UA 3O33A 4NN2A 3ZVZB 5TABA 4WZ0A 3N9QA 3U5MA 4A4CA 4A49A 4YBSA 3L11A 3O70A 3LQJA 3L1XA 4UP5A 1WEEA 4GNDA 2EGPA 2LDRA 5LKZA 2ECTA 2L43A 4L58A 4L7XA 2IDAA 2JMIA 5KH9A 1RMDA 2PNXA 2F42A 2LXHC 2JRJA 5H9MA 2LGGA 3RTRB 5TBNA 1WILA 1WGMA 2KREA 5TDRA 2L75A 2MA5A 1MM3A 3LQIA 3DQVR 4YATA 2VJEB 3L1ZB 5G04B 3KV5A 4R7EA 2EA6A 1F62A 4LJNA 4R8PK 2E6SA 3O37A 3HTKC 3ZYQA 2YURA 4AP4A 2G43A 5LKUA 3EB5A 3HCSA 1WE9A 3MHSA 2KWOA 2M3HA 3C6WA 1JOCA 2ECJA 2KWJA 5TRBA 2CSYA 1HYIA 1JM7A 5J3XA 4ZQLA 2C2VS 3O34A 2QJ0A 3VK6A 3LRQA 3U5OA 2MD7B 2YT5A 2MD8C 5JG6A 3I2DA 5LKXA 2LGKA 5I3LA 2EODA 2KWKA 2LGLA 4XI1A 4LLBA 1WEQA 1IYMA 1FP0A 2LN0A 3SOWA 1WEWA 3C5KA 5DKAA 2H0DA 2M85A 3KV6A 4WA6A 2Y43A 2K4DA 4FJCA 2KGIA 3KQIA 4YABA 2DX8A 4X3GA 2ECNA 2YW8A 2RSDA 4YAXA 2AN6A 1E4UA 3RPGB 4WZ3B 3M99A 2MNZA 4YBTA 4MVTA 2LQ6A 5B79A 5B8DA 1CHCA 2CSZA 2YU4A 3ZTGA 4GNFA 1WEVA 2KE1A 2HYED 2YYRA 1K2FA 4GB0A 1WEPA 2L0BA 2H0DB 1X4JA 2G45A 2VPDA 2CKLA 3PUQA 4CCGX 3U5NA 3HCUA 4O64A 2KWNA 4IC2A 2MIQA 3GL6A 3O36A 1HYJA 3DPLR 3HCTA 4AUQB 2ZETC
chains in the Genus database with same CATH superfamily
1FBVA 2LRIC 3FL2A 1VFYA 5D1LB 3RPGC 2CONA 3N9NA 5FERA 3FJUB 3ZNIA 4QF3A 5G05B 2ECWA 2MUMA 4WZ2A 2HDPA 2D8SA 2M6MA 5LKTA 2FUUA 2CKLB 2CRRA 5EYAF 4LKAA 3SOUA 4UP0A 5H1TA 4B86C 1XWHA 2MA6A 1ZBDB 5DINA 2LXPC 4AYCA 2YQMA 2XEUA 3PHDA 3SOXA 3N9PA 3M62A 2YUCA 1V87A 2F6JA 3U5PA 2KGGA 2DJAA 3PLWA 3V43A 4V3KC 5FB0A 4IC3A 2MT5A 4BBQA 3MDBC 5B78A 2ECIA 3FANA 4YBMA 1WEMA 4S3OB 3N9LA 4I7BA 4C9ZA 2ECVA 4BHWA 3MHHA 2YSJA 2JMDA 4CA1A 5FEYA 3IHPA 2YREA 4MSXA 5AIUA 5B76A 5H1VA 2IQJA 4OGEA 1WEUA 1JM7B 1Z2QA 1G25A 4Z0OA 3NG2A 2F6NA 4YADA 2XP0A 3T9KA 2BAYA 4O62A 5G0FA 2M1RA 5TDWA 3DWDA 2YSMA 2E6RA 2YHNA 2C2LA 4F52B 2JM3A 5D1MB 1MM2A 2KYUA 4P5OB 2ECGA 2VPGA 2CT2A 4F1PA 3T6RA 3KNVA 3ZVYA 4B7YC 4GNEA 3ZPVE 2FFWA 2KR4A 2QIZA 2L5UA 2YHOA 2LGVA 3FAOA 1Z60A 2KIZA 4S3OC 5FB1A 5SVIA 2JMJA 1WFKA 2L80A 4LADB 4I7DA 2MNYA 2K16A 1MBMA 3M7KA 3PURA 4ZDTA 4QQ4A 4PTBA 1LDKC 2FUIA 3N9OA 1WEOA 4N4FA 5H1UA 5KH7A 4YC9A 3LQHA 4TKPB 5C13A 5C11A 2P57A 4QF2A 5AITA 4LK9A 2XOYA 4PPEA 2VJFA 5D1KB 1WENA 2Y1MA 4I7CA 5KH3A 2LV9A 3LVQE 1X4UA 2G6QA 3ZPV1 4N3WA 1U6GB 2VPEA 3JUEA 5SVIB 2YQLA 3N9MA 3SHBA 4W4UA 2Y1NA 3M63A 2I50A 4V3LC 2JUNA 1VYXA 3GV4A 2VP7A 1X4IA 2RR4A 4FK5A 2OXQC 1LDJB 2YVRA 4Q6FA 3SUBA 4A0CD 2EXUA 3T7LA 4H9DA 4R2YA 2K17A 5B75A 2LAUA 5B77A 4UI9B 4OGCA 2NAAA 1BORA 3EB6A 2UZGA 2VJFB 2VPBA 2MKEA 4FO9A 2KFTA 3QZVA 1WIMA 1DVPA 2QICA 3O7AA 2RI7A 2KKXA 2DSMA 3O35A 2FSAA 1VD4A 4GNGA 1T1HA 2PUYA 4A4BA 3ASLA 4AYCB 1WESA 2EGMA 2K1JA 2VNFA 2XB1A 4AVXA 2KU3A 5LCWB 4ZUXU 1N87A 2VJEA 4FIPA 1Z6UA 3O33A 2CRWA 4NN2A 3ZVZB 5TABA 4WZ0A 3N9QA 3U5MA 4A4CA 4A49A 4YBSA 3L11A 3O70A 3LQJA 3L1XA 4UP5A 1WEEA 4GNDA 2OWAA 2EGPA 2CSVA 2LDRA 5SVYA 5LKZA 2ECTA 2L43A 4L58A 3E2DA 4L7XA 2IDAA 2JMIA 5K3QA 5KH9A 1RMDA 2PNXA 2F42A 2LXHC 2JRJA 5H9MA 2LGGA 3Q1DA 3RTRB 5TBNA 1WILA 1WGMA 2KREA 5TDRA 2L75A 3DDTA 2MA5A 1MM3A 3LQIA 3DQVR 4YATA 2VJEB 3L1ZB 5G04B 3KV5A 4R7EA 2EA6A 1F62A 4LJNA 4R8PK 2E6SA 3H7HA 3O37A 4Z0RA 3HTKC 3ZYQA 2YURA 4AP4A 2G43A 5LKUA 3EB5A 3HCSA 1WE9A 3MHSA 2KWOA 2M3HA 3C6WA 1JOCA 2ECJA 2KWJA 5TRBA 2CSYA 1HYIA 1JM7A 5J3XA 4ZQLA 2C2VS 3O34A 2QJ0A 3FM8C 3VK6A 3LRQA 2D8UA 3U5OA 2MD7B 2YT5A 3LJUX 2MD8C 5SVXA 5JG6A 3I2DA 5LKXA 2LGKA 5I3LA 2EODA 2KWKA 2LGLA 4XI1A 4LLBA 1WEQA 1IYMA 1FP0A 2LN0A 3SOWA 1WEWA 3C5KA 5DKAA 2H0DA 2M85A 3KV6A 4WA6A 2FD4A 2Y43A 2K4DA 2XOZA 4FJCA 2KGIA 3KQIA 4YABA 2DX8A 4X3GA 2ECNA 2YW8A 2RSDA 4YAXA 2AN6A 1E4UA 2E61A 3RPGB 4WZ3B 3M99A 2MNZA 2XOCA 3LDYA 4YBTA 1DCQA 4MVTA 2LQ6A 5B79A 5B8DA 1CHCA 2CSZA 2YU4A 3ZTGA 4GNFA 1WEVA 2KE1A 2HYED 2M13A 2YYRA 2KKYA 1K2FA 2L7PA 4GB0A 1WEPA 2L0BA 2H0DB 1X4JA 2G45A 2B0OE 2VPDA 2CKLA 3PUQA 4CCGX 3KDEC 3U5NA 3HCUA 3FEHA 3LVRE 4O64A 2KWNA 4IC2A 3O47A 2MIQA 3GL6A 3O36A 1HYJA 3DPLR 3HCTA 4AUQB 2ZETC
chains in the Genus database with same CATH topology
1FBVA 2LRIC 3FL2A 1VFYA 5D1LB 3RPGC 3N9NA 5FERA 3ZNIA 4QF3A 5G05B 2ECWA 2MUMA 4WZ2A 2HDPA 2D8SA 2M6MA 5LKTA 2FUUA 2CKLB 5EYAF 4LKAA 3SOUA 4UP0A 5H1TA 4B86C 1XWHA 2MA6A 1ZBDB 5DINA 2LXPC 4AYCA 2YQMA 2XEUA 3PHDA 3SOXA 3N9PA 3M62A 2YUCA 1V87A 2F6JA 3U5PA 2KGGA 3V43A 4V3KC 5FB0A 4IC3A 2MT5A 4BBQA 5B78A 2ECIA 4YBMA 1WEMA 4S3OB 3N9LA 4I7BA 4C9ZA 2ECVA 4BHWA 3MHHA 2YSJA 2JMDA 4CA1A 5FEYA 3IHPA 2YREA 4MSXA 5AIUA 5B76A 5H1VA 1WEUA 1JM7B 1Z2QA 1G25A 3NG2A 2F6NA 4YADA 2BAYA 5G0FA 2M1RA 5TDWA 2YSMA 2E6RA 2YHNA 2C2LA 4F52B 5D1MB 1MM2A 2KYUA 4P5OB 2ECGA 2VPGA 2CT2A 3T6RA 3KNVA 3ZVYA 4B7YC 4GNEA 3ZPVE 2KR4A 2QIZA 2L5UA 2YHOA 2LGVA 1Z60A 2KIZA 4S3OC 5FB1A 2JMJA 1WFKA 2L80A 4LADB 4I7DA 2MNYA 2K16A 3PURA 4ZDTA 4PTBA 1LDKC 2FUIA 3N9OA 1WEOA 4N4FA 5H1UA 5KH7A 4YC9A 3LQHA 4TKPB 5C13A 5C11A 4QF2A 5AITA 4LK9A 4PPEA 2VJFA 5D1KB 1WENA 2Y1MA 4I7CA 5KH3A 2LV9A 1X4UA 2G6QA 3ZPV1 4N3WA 1U6GB 2VPEA 2YQLA 3N9MA 3SHBA 4W4UA 2Y1NA 3M63A 2I50A 4V3LC 1VYXA 3GV4A 2VP7A 1X4IA 4FK5A 2OXQC 1LDJB 4Q6FA 4A0CD 3T7LA 4R2YA 2K17A 5B75A 5B77A 4UI9B 2NAAA 1BORA 3EB6A 2UZGA 2VJFB 2VPBA 4FO9A 2KFTA 3QZVA 1WIMA 1DVPA 2QICA 3O7AA 2RI7A 3O35A 2FSAA 1VD4A 4GNGA 1T1HA 2PUYA 4A4BA 3ASLA 4AYCB 1WESA 2K1JA 2VNFA 2XB1A 4AVXA 2KU3A 5LCWB 4ZUXU 1N87A 2VJEA 4FIPA 1Z6UA 3O33A 4NN2A 3ZVZB 5TABA 4WZ0A 3N9QA 3U5MA 4A4CA 4A49A 4YBSA 3L11A 3O70A 3LQJA 3L1XA 4UP5A 1WEEA 4GNDA 2EGPA 2LDRA 5LKZA 2ECTA 2L43A 4L58A 4L7XA 2IDAA 2JMIA 5KH9A 1RMDA 2PNXA 2F42A 2LXHC 2JRJA 5H9MA 2LGGA 3RTRB 5TBNA 1WILA 1WGMA 2KREA 5TDRA 2L75A 2MA5A 1MM3A 3LQIA 3DQVR 4YATA 2VJEB 3L1ZB 5G04B 3KV5A 4R7EA 2EA6A 1F62A 4LJNA 4R8PK 2E6SA 3O37A 3HTKC 3ZYQA 2YURA 4AP4A 2G43A 5LKUA 3EB5A 3HCSA 1WE9A 3MHSA 2KWOA 2M3HA 3C6WA 1JOCA 2ECJA 2KWJA 5TRBA 2CSYA 1HYIA 1JM7A 5J3XA 4ZQLA 2C2VS 3O34A 2QJ0A 3VK6A 3LRQA 3U5OA 2MD7B 2YT5A 2MD8C 5JG6A 3I2DA 5LKXA 2LGKA 5I3LA 2EODA 2KWKA 2LGLA 4XI1A 4LLBA 1WEQA 1IYMA 1FP0A 2LN0A 3SOWA 1WEWA 3C5KA 5DKAA 2H0DA 2M85A 3KV6A 4WA6A 2Y43A 2K4DA 4FJCA 2KGIA 3KQIA 4YABA 2DX8A 4X3GA 2ECNA 2YW8A 2RSDA 4YAXA 2AN6A 1E4UA 3RPGB 4WZ3B 3M99A 2MNZA 4YBTA 4MVTA 2LQ6A 5B79A 5B8DA 1CHCA 2CSZA 2YU4A 3ZTGA 4GNFA 1WEVA 2KE1A 2HYED 2YYRA 1K2FA 4GB0A 1WEPA 2L0BA 2H0DB 1X4JA 2G45A 2VPDA 2CKLA 3PUQA 4CCGX 3U5NA 3HCUA 4O64A 2KWNA 4IC2A 2MIQA 3GL6A 3O36A 1HYJA 3DPLR 3HCTA 4AUQB 2ZETC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  2LRI C;  3FL2 A;  1VFY A;  5D1L B;  3RPG C;  3N9N A;  5FER A;  3ZNI A;  4QF3 A;  5G05 B;  2ECW A;  2MUM A;  4WZ2 A;  2HDP A;  2D8S A;  2M6M A;  5LKT A;  2FUU A;  2CKL B;  5EYA F;  4LKA A;  3SOU A;  4UP0 A;  5H1T A;  4B86 C;  1XWH A;  2MA6 A;  1ZBD B;  5DIN A;  2LXP C;  4AYC A;  2YQM A;  2XEU A;  3PHD A;  3SOX A;  3N9P A;  3M62 A;  2YUC A;  1V87 A;  2F6J A;  3U5P A;  2KGG A;  3V43 A;  4V3K C;  5FB0 A;  4IC3 A;  2MT5 A;  4BBQ A;  5B78 A;  2ECI A;  4YBM A;  1WEM A;  4S3O B;  3N9L A;  4I7B A;  4C9Z A;  2ECV A;  4BHW A;  3MHH A;  2YSJ A;  2JMD A;  4CA1 A;  5FEY A;  3IHP A;  2YRE A;  4MSX A;  5AIU A;  5B76 A;  5H1V A;  1WEU A;  1JM7 B;  1Z2Q A;  1G25 A;  3NG2 A;  2F6N A;  4YAD A;  2BAY A;  5G0F A;  2M1R A;  5TDW A;  2YSM A;  2E6R A;  2YHN A;  2C2L A;  4F52 B;  5D1M B;  1MM2 A;  2KYU A;  4P5O B;  2ECG A;  2VPG A;  2CT2 A;  3T6R A;  3KNV A;  3ZVY A;  4B7Y C;  4GNE A;  3ZPV E;  2KR4 A;  2QIZ A;  2L5U A;  2YHO A;  2LGV A;  1Z60 A;  2KIZ A;  4S3O C;  5FB1 A;  2JMJ A;  1WFK A;  2L80 A;  4LAD B;  4I7D A;  2MNY A;  2K16 A;  3PUR A;  4ZDT A;  4PTB A;  1LDK C;  2FUI A;  3N9O A;  1WEO A;  4N4F A;  5H1U A;  5KH7 A;  4YC9 A;  3LQH A;  4TKP B;  5C13 A;  5C11 A;  4QF2 A;  5AIT A;  4LK9 A;  4PPE A;  2VJF A;  5D1K B;  1WEN A;  2Y1M A;  4I7C A;  5KH3 A;  2LV9 A;  1X4U A;  2G6Q A;  3ZPV 1;  4N3W A;  1U6G B;  2VPE A;  2YQL A;  3N9M A;  3SHB A;  4W4U A;  2Y1N A;  3M63 A;  2I50 A;  4V3L C;  1VYX A;  3GV4 A;  2VP7 A;  1X4I A;  4FK5 A;  2OXQ C;  1LDJ B;  4Q6F A;  4A0C D;  3T7L A;  4R2Y A;  2K17 A;  5B75 A;  5B77 A;  4UI9 B;  2NAA A;  1BOR A;  3EB6 A;  2UZG A;  2VJF B;  2VPB A;  4FO9 A;  2KFT A;  3QZV A;  1WIM A;  1DVP A;  2QIC A;  3O7A A;  2RI7 A;  3O35 A;  2FSA A;  1VD4 A;  4GNG A;  1T1H A;  2PUY A;  4A4B A;  3ASL A;  4AYC B;  1WES A;  2K1J A;  2VNF A;  2XB1 A;  4AVX A;  2KU3 A;  5LCW B;  4ZUX U;  1N87 A;  2VJE A;  4FIP A;  1Z6U A;  3O33 A;  4NN2 A;  3ZVZ B;  5TAB A;  4WZ0 A;  3N9Q A;  3U5M A;  4A4C A;  4A49 A;  4YBS A;  3L11 A;  3O70 A;  3LQJ A;  3L1X A;  4UP5 A;  1WEE A;  4GND A;  2EGP A;  2LDR A;  5LKZ A;  2ECT A;  2L43 A;  4L58 A;  4L7X A;  2IDA A;  2JMI A;  5KH9 A;  1RMD A;  2PNX A;  2F42 A;  2LXH C;  2JRJ A;  5H9M A;  2LGG A;  3RTR B;  5TBN A;  1WIL A;  1WGM A;  2KRE A;  5TDR A;  2L75 A;  2MA5 A;  1MM3 A;  3LQI A;  3DQV R;  4YAT A;  2VJE B;  3L1Z B;  5G04 B;  3KV5 A;  4R7E A;  2EA6 A;  1F62 A;  4LJN A;  4R8P K;  2E6S A;  3O37 A;  3HTK C;  3ZYQ A;  2YUR A;  4AP4 A;  2G43 A;  5LKU A;  3EB5 A;  3HCS A;  1WE9 A;  3MHS A;  2KWO A;  2M3H A;  3C6W A;  1JOC A;  2ECJ A;  2KWJ A;  5TRB A;  2CSY A;  1HYI A;  1JM7 A;  5J3X A;  4ZQL A;  2C2V S;  3O34 A;  2QJ0 A;  3VK6 A;  3LRQ A;  3U5O A;  2MD7 B;  2YT5 A;  2MD8 C;  5JG6 A;  3I2D A;  5LKX A;  2LGK A;  5I3L A;  2EOD A;  2KWK A;  2LGL A;  4XI1 A;  4LLB A;  1WEQ A;  1IYM A;  1FP0 A;  2LN0 A;  3SOW A;  1WEW A;  3C5K A;  5DKA A;  2H0D A;  2M85 A;  3KV6 A;  4WA6 A;  2Y43 A;  2K4D A;  4FJC A;  2KGI A;  3KQI A;  4YAB A;  2DX8 A;  4X3G A;  2ECN A;  2YW8 A;  2RSD A;  4YAX A;  2AN6 A;  1E4U A;  3RPG B;  4WZ3 B;  3M99 A;  2MNZ A;  4YBT A;  4MVT A;  2LQ6 A;  5B79 A;  5B8D A;  1CHC A;  2CSZ A;  2YU4 A;  3ZTG A;  4GNF A;  1WEV A;  2KE1 A;  2HYE D;  2YYR A;  1K2F A;  4GB0 A;  1WEP A;  2L0B A;  2H0D B;  1X4J A;  2G45 A;  2VPD A;  2CKL A;  3PUQ A;  4CCG X;  3U5N A;  3HCU A;  4O64 A;  2KWN A;  4IC2 A;  2MIQ A;  3GL6 A;  3O36 A;  1HYJ A;  3DPL R;  3HCT A;  4AUQ B;  2ZET C; 
#chains in the Genus database with same CATH topology
 1FBV A;  2LRI C;  3FL2 A;  1VFY A;  5D1L B;  3RPG C;  2CON A;  3N9N A;  5FER A;  3FJU B;  3ZNI A;  4QF3 A;  5G05 B;  2ECW A;  2MUM A;  4WZ2 A;  2HDP A;  2D8S A;  2M6M A;  5LKT A;  2FUU A;  2CKL B;  2CRR A;  5EYA F;  4LKA A;  3SOU A;  4UP0 A;  5H1T A;  4B86 C;  1XWH A;  2MA6 A;  1ZBD B;  5DIN A;  2LXP C;  4AYC A;  2YQM A;  2XEU A;  3PHD A;  3SOX A;  3N9P A;  3M62 A;  2YUC A;  1V87 A;  2F6J A;  3U5P A;  2KGG A;  2DJA A;  3PLW A;  3V43 A;  4V3K C;  5FB0 A;  4IC3 A;  2MT5 A;  4BBQ A;  3MDB C;  5B78 A;  2ECI A;  3FAN A;  4YBM A;  1WEM A;  4S3O B;  3N9L A;  4I7B A;  4C9Z A;  2ECV A;  4BHW A;  3MHH A;  2YSJ A;  2JMD A;  4CA1 A;  5FEY A;  3IHP A;  2YRE A;  4MSX A;  5AIU A;  5B76 A;  5H1V A;  2IQJ A;  4OGE A;  1WEU A;  1JM7 B;  1Z2Q A;  1G25 A;  4Z0O A;  3NG2 A;  2F6N A;  4YAD A;  2XP0 A;  3T9K A;  2BAY A;  4O62 A;  5G0F A;  2M1R A;  5TDW A;  3DWD A;  2YSM A;  2E6R A;  2YHN A;  2C2L A;  4F52 B;  2JM3 A;  5D1M B;  1MM2 A;  2KYU A;  4P5O B;  2ECG A;  2VPG A;  2CT2 A;  4F1P A;  3T6R A;  3KNV A;  3ZVY A;  4B7Y C;  4GNE A;  3ZPV E;  2FFW A;  2KR4 A;  2QIZ A;  2L5U A;  2YHO A;  2LGV A;  3FAO A;  1Z60 A;  2KIZ A;  4S3O C;  5FB1 A;  5SVI A;  2JMJ A;  1WFK A;  2L80 A;  4LAD B;  4I7D A;  2MNY A;  2K16 A;  1MBM A;  3M7K A;  3PUR A;  4ZDT A;  4QQ4 A;  4PTB A;  1LDK C;  2FUI A;  3N9O A;  1WEO A;  4N4F A;  5H1U A;  5KH7 A;  4YC9 A;  3LQH A;  4TKP B;  5C13 A;  5C11 A;  2P57 A;  4QF2 A;  5AIT A;  4LK9 A;  2XOY A;  4PPE A;  2VJF A;  5D1K B;  1WEN A;  2Y1M A;  4I7C A;  5KH3 A;  2LV9 A;  3LVQ E;  1X4U A;  2G6Q A;  3ZPV 1;  4N3W A;  1U6G B;  2VPE A;  3JUE A;  5SVI B;  2YQL A;  3N9M A;  3SHB A;  4W4U A;  2Y1N A;  3M63 A;  2I50 A;  4V3L C;  2JUN A;  1VYX A;  3GV4 A;  2VP7 A;  1X4I A;  2RR4 A;  4FK5 A;  2OXQ C;  1LDJ B;  2YVR A;  4Q6F A;  3SUB A;  4A0C D;  2EXU A;  3T7L A;  4H9D A;  4R2Y A;  2K17 A;  5B75 A;  2LAU A;  5B77 A;  4UI9 B;  4OGC A;  2NAA A;  1BOR A;  3EB6 A;  2UZG A;  2VJF B;  2VPB A;  2MKE A;  4FO9 A;  2KFT A;  3QZV A;  1WIM A;  1DVP A;  2QIC A;  3O7A A;  2RI7 A;  2KKX A;  2DSM A;  3O35 A;  2FSA A;  1VD4 A;  4GNG A;  1T1H A;  2PUY A;  4A4B A;  3ASL A;  4AYC B;  1WES A;  2EGM A;  2K1J A;  2VNF A;  2XB1 A;  4AVX A;  2KU3 A;  5LCW B;  4ZUX U;  1N87 A;  2VJE A;  4FIP A;  1Z6U A;  3O33 A;  2CRW A;  4NN2 A;  3ZVZ B;  5TAB A;  4WZ0 A;  3N9Q A;  3U5M A;  4A4C A;  4A49 A;  4YBS A;  3L11 A;  3O70 A;  3LQJ A;  3L1X A;  4UP5 A;  1WEE A;  4GND A;  2OWA A;  2EGP A;  2CSV A;  2LDR A;  5SVY A;  5LKZ A;  2ECT A;  2L43 A;  4L58 A;  3E2D A;  4L7X A;  2IDA A;  2JMI A;  5K3Q A;  5KH9 A;  1RMD A;  2PNX A;  2F42 A;  2LXH C;  2JRJ A;  5H9M A;  2LGG A;  3Q1D A;  3RTR B;  5TBN A;  1WIL A;  1WGM A;  2KRE A;  5TDR A;  2L75 A;  3DDT A;  2MA5 A;  1MM3 A;  3LQI A;  3DQV R;  4YAT A;  2VJE B;  3L1Z B;  5G04 B;  3KV5 A;  4R7E A;  2EA6 A;  1F62 A;  4LJN A;  4R8P K;  2E6S A;  3H7H A;  3O37 A;  4Z0R A;  3HTK C;  3ZYQ A;  2YUR A;  4AP4 A;  2G43 A;  5LKU A;  3EB5 A;  3HCS A;  1WE9 A;  3MHS A;  2KWO A;  2M3H A;  3C6W A;  1JOC A;  2ECJ A;  2KWJ A;  5TRB A;  2CSY A;  1HYI A;  1JM7 A;  5J3X A;  4ZQL A;  2C2V S;  3O34 A;  2QJ0 A;  3FM8 C;  3VK6 A;  3LRQ A;  2D8U A;  3U5O A;  2MD7 B;  2YT5 A;  3LJU X;  2MD8 C;  5SVX A;  5JG6 A;  3I2D A;  5LKX A;  2LGK A;  5I3L A;  2EOD A;  2KWK A;  2LGL A;  4XI1 A;  4LLB A;  1WEQ A;  1IYM A;  1FP0 A;  2LN0 A;  3SOW A;  1WEW A;  3C5K A;  5DKA A;  2H0D A;  2M85 A;  3KV6 A;  4WA6 A;  2FD4 A;  2Y43 A;  2K4D A;  2XOZ A;  4FJC A;  2KGI A;  3KQI A;  4YAB A;  2DX8 A;  4X3G A;  2ECN A;  2YW8 A;  2RSD A;  4YAX A;  2AN6 A;  1E4U A;  2E61 A;  3RPG B;  4WZ3 B;  3M99 A;  2MNZ A;  2XOC A;  3LDY A;  4YBT A;  1DCQ A;  4MVT A;  2LQ6 A;  5B79 A;  5B8D A;  1CHC A;  2CSZ A;  2YU4 A;  3ZTG A;  4GNF A;  1WEV A;  2KE1 A;  2HYE D;  2M13 A;  2YYR A;  2KKY A;  1K2F A;  2L7P A;  4GB0 A;  1WEP A;  2L0B A;  2H0D B;  1X4J A;  2G45 A;  2B0O E;  2VPD A;  2CKL A;  3PUQ A;  4CCG X;  3KDE C;  3U5N A;  3HCU A;  3FEH A;  3LVR E;  4O64 A;  2KWN A;  4IC2 A;  3O47 A;  2MIQ A;  3GL6 A;  3O36 A;  1HYJ A;  3DPL R;  3HCT A;  4AUQ B;  2ZET C; 
#chains in the Genus database with same CATH homology
 1FBV A;  2LRI C;  3FL2 A;  1VFY A;  5D1L B;  3RPG C;  3N9N A;  5FER A;  3ZNI A;  4QF3 A;  5G05 B;  2ECW A;  2MUM A;  4WZ2 A;  2HDP A;  2D8S A;  2M6M A;  5LKT A;  2FUU A;  2CKL B;  5EYA F;  4LKA A;  3SOU A;  4UP0 A;  5H1T A;  4B86 C;  1XWH A;  2MA6 A;  1ZBD B;  5DIN A;  2LXP C;  4AYC A;  2YQM A;  2XEU A;  3PHD A;  3SOX A;  3N9P A;  3M62 A;  2YUC A;  1V87 A;  2F6J A;  3U5P A;  2KGG A;  3V43 A;  4V3K C;  5FB0 A;  4IC3 A;  2MT5 A;  4BBQ A;  5B78 A;  2ECI A;  4YBM A;  1WEM A;  4S3O B;  3N9L A;  4I7B A;  4C9Z A;  2ECV A;  4BHW A;  3MHH A;  2YSJ A;  2JMD A;  4CA1 A;  5FEY A;  3IHP A;  2YRE A;  4MSX A;  5AIU A;  5B76 A;  5H1V A;  1WEU A;  1JM7 B;  1Z2Q A;  1G25 A;  3NG2 A;  2F6N A;  4YAD A;  2BAY A;  5G0F A;  2M1R A;  5TDW A;  2YSM A;  2E6R A;  2YHN A;  2C2L A;  4F52 B;  5D1M B;  1MM2 A;  2KYU A;  4P5O B;  2ECG A;  2VPG A;  2CT2 A;  3T6R A;  3KNV A;  3ZVY A;  4B7Y C;  4GNE A;  3ZPV E;  2KR4 A;  2QIZ A;  2L5U A;  2YHO A;  2LGV A;  1Z60 A;  2KIZ A;  4S3O C;  5FB1 A;  2JMJ A;  1WFK A;  2L80 A;  4LAD B;  4I7D A;  2MNY A;  2K16 A;  3PUR A;  4ZDT A;  4PTB A;  1LDK C;  2FUI A;  3N9O A;  1WEO A;  4N4F A;  5H1U A;  5KH7 A;  4YC9 A;  3LQH A;  4TKP B;  5C13 A;  5C11 A;  4QF2 A;  5AIT A;  4LK9 A;  4PPE A;  2VJF A;  5D1K B;  1WEN A;  2Y1M A;  4I7C A;  5KH3 A;  2LV9 A;  1X4U A;  2G6Q A;  3ZPV 1;  4N3W A;  1U6G B;  2VPE A;  2YQL A;  3N9M A;  3SHB A;  4W4U A;  2Y1N A;  3M63 A;  2I50 A;  4V3L C;  1VYX A;  3GV4 A;  2VP7 A;  1X4I A;  4FK5 A;  2OXQ C;  1LDJ B;  4Q6F A;  4A0C D;  3T7L A;  4R2Y A;  2K17 A;  5B75 A;  5B77 A;  4UI9 B;  2NAA A;  1BOR A;  3EB6 A;  2UZG A;  2VJF B;  2VPB A;  4FO9 A;  2KFT A;  3QZV A;  1WIM A;  1DVP A;  2QIC A;  3O7A A;  2RI7 A;  3O35 A;  2FSA A;  1VD4 A;  4GNG A;  1T1H A;  2PUY A;  4A4B A;  3ASL A;  4AYC B;  1WES A;  2K1J A;  2VNF A;  2XB1 A;  4AVX A;  2KU3 A;  5LCW B;  4ZUX U;  1N87 A;  2VJE A;  4FIP A;  1Z6U A;  3O33 A;  4NN2 A;  3ZVZ B;  5TAB A;  4WZ0 A;  3N9Q A;  3U5M A;  4A4C A;  4A49 A;  4YBS A;  3L11 A;  3O70 A;  3LQJ A;  3L1X A;  4UP5 A;  1WEE A;  4GND A;  2EGP A;  2LDR A;  5LKZ A;  2ECT A;  2L43 A;  4L58 A;  4L7X A;  2IDA A;  2JMI A;  5KH9 A;  1RMD A;  2PNX A;  2F42 A;  2LXH C;  2JRJ A;  5H9M A;  2LGG A;  3RTR B;  5TBN A;  1WIL A;  1WGM A;  2KRE A;  5TDR A;  2L75 A;  2MA5 A;  1MM3 A;  3LQI A;  3DQV R;  4YAT A;  2VJE B;  3L1Z B;  5G04 B;  3KV5 A;  4R7E A;  2EA6 A;  1F62 A;  4LJN A;  4R8P K;  2E6S A;  3O37 A;  3HTK C;  3ZYQ A;  2YUR A;  4AP4 A;  2G43 A;  5LKU A;  3EB5 A;  3HCS A;  1WE9 A;  3MHS A;  2KWO A;  2M3H A;  3C6W A;  1JOC A;  2ECJ A;  2KWJ A;  5TRB A;  2CSY A;  1HYI A;  1JM7 A;  5J3X A;  4ZQL A;  2C2V S;  3O34 A;  2QJ0 A;  3VK6 A;  3LRQ A;  3U5O A;  2MD7 B;  2YT5 A;  2MD8 C;  5JG6 A;  3I2D A;  5LKX A;  2LGK A;  5I3L A;  2EOD A;  2KWK A;  2LGL A;  4XI1 A;  4LLB A;  1WEQ A;  1IYM A;  1FP0 A;  2LN0 A;  3SOW A;  1WEW A;  3C5K A;  5DKA A;  2H0D A;  2M85 A;  3KV6 A;  4WA6 A;  2Y43 A;  2K4D A;  4FJC A;  2KGI A;  3KQI A;  4YAB A;  2DX8 A;  4X3G A;  2ECN A;  2YW8 A;  2RSD A;  4YAX A;  2AN6 A;  1E4U A;  3RPG B;  4WZ3 B;  3M99 A;  2MNZ A;  4YBT A;  4MVT A;  2LQ6 A;  5B79 A;  5B8D A;  1CHC A;  2CSZ A;  2YU4 A;  3ZTG A;  4GNF A;  1WEV A;  2KE1 A;  2HYE D;  2YYR A;  1K2F A;  4GB0 A;  1WEP A;  2L0B A;  2H0D B;  1X4J A;  2G45 A;  2VPD A;  2CKL A;  3PUQ A;  4CCG X;  3U5N A;  3HCU A;  4O64 A;  2KWN A;  4IC2 A;  2MIQ A;  3GL6 A;  3O36 A;  1HYJ A;  3DPL R;  3HCT A;  4AUQ B;  2ZET C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...