2L75A

Solution structure of chd4-phd2 in complex with h3k9me3
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
DHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromodomain-helicase-DNA-binding protein 4
publication title Plant Homeodomain (PHD) Fingers of CHD4 Are Histone H3-binding Modules with Preference for Unmodified H3K4 and Methylated H3K9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/nuclear protein
total genus 8
structure length 56
sequence length 56
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2l75A00
2YW8A 2G6QA 3LRQA 4N4FA 3PHDA 4R2YA 3SOUA 2CT2A 2VNFA 3EB6A 1X4IA 2KR4A 2F6NA 1E4UA 2VJFB 1WEPA 2RI7A 1X4UA 1V87A 2KWOA 4F52B 2LN0A 4BHWA 3C6WA 2JMDA 5H1TA 4QF3A 4NN2A 3LQIA 4BBQA 3O33A 2FUIA 3KV5A 4YADA 3U5PA 3V43A 3ASLA 1WESA 1Z6UA 4LJNA 2LGKA 3O34A 2KIZA 2QIZA 5FB0A 2C2VS 3T6RA 5B75A 3QZVA 4XI1A 3C5KA 2VPBA 2MA6A 4S3OC 2MNZA 4QF2A 4UI9B 5KH9A 4GB0A 5D1KB 2G43A 2E6SA 2MNYA 1WEUA 2QJ0A 2LGVA 1Z60A 3U5OA 5D1MB 4WZ2A 2HDPA 4UP5A 1WE9A 4MSXA 3RPGB 5TRBA 2YSJA 2KYUA 2L43A 1HYIA 1IYMA 4FJCA 1JOCA 2YT5A 2ECIA 2HYED 4MVTA 2EODA 2F6JA 3U5MA 4GNGA 2IDAA 2M6MA 5H1VA 5B79A 5B77A 5TABA 1HYJA 4I7DA 2PUYA 4I7CA 2K4DA 3M63A 3EB5A 5TBNA 3M99A 2YU4A 3LQHA 1MM2A 1BORA 2CKLA 3O70A 1RMDA 3O36A 4YATA 5B78A 3HTKC 4L58A 5KH7A 5B76A 5LKTA 3I2DA 1VD4A 5DKAA 4ZDTA 5B8DA 4LK9A 4YAXA 2L0BA 4S3OB 2YURA 1WEMA 3MHSA 2Y1MA 3MHHA 1G25A 5KH3A 2MT5A 2CKLB 4B7YC 5FEYA 2L5UA 5LKZA 5LCWB 1JM7A 4R8PK 4ZQLA 2M3HA 2MD8C 4ZUXU 1WGMA 4WZ0A 3M62A 1DVPA 2ECWA 2PNXA 2KWKA 3T7LA 3NG2A 3L1ZB 1WILA 4Q6FA 2DX8A 1X4JA 2VPEA 2VP7A 4I7BA 1WEOA 4LADB 1JM7B 1WEVA 1T1HA 1WIMA 2KE1A 3PURA 2AN6A 2ECJA 3KQIA 2YREA 3DPLR 3RTRB 4GNFA 1WEWA 5D1LB 2YQMA 2XEUA 2MIQA 2ECTA 3ZNIA 2EGPA 2LGGA 2VPDA 3KV6A 4L7XA 1Z2QA 1MM3A 2BAYA 5C13A 5C11A 2EA6A 1WENA 4AP4A 1N87A 5EYAF 5LKXA 2KWJA 3U5NA 3ZPVE 2XB1A 2YSMA 5FERA 2K1JA 2ECGA 2K17A 4FIPA 3KNVA 2YHOA 4AVXA 5AITA 2CSYA 1WEEA 3O35A 3ZTGA 1WFKA 2FSAA 3DQVR 2K16A 2E6RA 3IHPA 2KFTA 2KU3A 1LDJB 3N9MA 2L80A 3RPGC 3ZVZB 5G0FA 4YBMA 1U6GB 4TKPB 4LKAA 1FBVA 5AIUA 3ZPV1 1CHCA 2D8SA 3SOWA 4FK5A 5FB1A 1VYXA 3L1XA 3N9OA 2YQLA 4IC2A 2KGGA 2UZGA 4AYCA 4N3WA 3HCTA 2LXHC 3N9QA 2ECVA 4V3LC 3HCUA 1LDKC 3GV4A 4A0CD 4A4BA 3GL6A 3FL2A 4YC9A 2I50A 4PPEA 2YYRA 3L11A 2C2LA 5G05B 4CCGX 4CA1A 4A4CA 4IC3A 3O7AA 2JMIA 4AYCB 2Y1NA 4R7EA 5J3XA 2CSZA 1WEQA 2F42A 5LKUA 2H0DA 2KWNA 1K2FA 4O64A 2M85A 5I3LA 5H9MA 2MD7B 2JMJA 2LDRA 3O37A 2LRIC 5DINA 3HCSA 4WZ3B 4GNDA 5G04B 2L75A 2NAAA 2ZETC 4YBTA 4WA6A 2KREA 3VK6A 4YABA 2FUUA 3PUQA 5TDWA 3ZYQA 2KGIA 2LV9A 2QICA 2RSDA 3ZVYA 4X3GA 1ZBDB 2VJEA 3LQJA 2H0DB 3N9PA 1VFYA 4W4UA 3SHBA 4AUQB 5H1UA 3N9LA 2MA5A 2LXPC 2M1RA 2G45A 4PTBA 2LGLA 4LLBA 1XWHA 5JG6A 2LQ6A 5TDRA 2JRJA 4YBSA 2MUMA 2YHNA 3SOXA 2ECNA 2YUCA 2VJFA 2Y43A 1F62A 4C9ZA 4B86C 4V3KC 2OXQC 4P5OB 2VPGA 4FO9A 1FP0A 2VJEB 4UP0A 4GNEA 3N9NA 4A49A
chains in the Genus database with same CATH superfamily
2YW8A 2G6QA 3LRQA 4N4FA 3PHDA 4R2YA 3SOUA 2CT2A 2VNFA 3EB6A 1X4IA 2KR4A 4QQ4A 2DSMA 2F6NA 1E4UA 2VJFB 2CONA 1WEPA 2RI7A 1X4UA 1V87A 2KWOA 3DWDA 2JM3A 4F52B 2LN0A 4BHWA 3C6WA 2CRRA 2XP0A 2JMDA 5H1TA 4QF3A 4NN2A 3LQIA 4BBQA 3O33A 2FUIA 3KV5A 4YADA 3U5PA 3V43A 3ASLA 1WESA 1Z6UA 4LJNA 4H9DA 2LGKA 3O34A 2KIZA 2QIZA 5FB0A 2C2VS 3T6RA 5B75A 3QZVA 4XI1A 3C5KA 2LAUA 2VPBA 2MA6A 4S3OC 2MNZA 4QF2A 4UI9B 5KH9A 4GB0A 5D1KB 2G43A 3E2DA 2E6SA 2KKXA 2MNYA 1WEUA 2QJ0A 2LGVA 1Z60A 3U5OA 5D1MB 4WZ2A 4F1PA 2HDPA 4UP5A 3MDBC 1WE9A 3FAOA 4MSXA 3RPGB 5TRBA 2YSJA 2KYUA 2L43A 1HYIA 1IYMA 4FJCA 1JOCA 2YT5A 2ECIA 2HYED 4MVTA 2EODA 2F6JA 3U5MA 4GNGA 2B0OE 2IDAA 2M6MA 3LVQE 5H1VA 5B79A 5B77A 5TABA 1HYJA 4I7DA 2PUYA 4I7CA 2K4DA 3M63A 3EB5A 5TBNA 3M99A 2YU4A 3LQHA 1MM2A 3FEHA 1BORA 2CKLA 3LJUX 3O70A 1RMDA 3O36A 4YATA 4Z0OA 5B78A 3HTKC 2KKYA 4L58A 5KH7A 5B76A 5LKTA 3I2DA 1VD4A 3PLWA 5DKAA 4ZDTA 5B8DA 4LK9A 4YAXA 2L0BA 4S3OB 2YURA 1WEMA 3MHSA 2Y1MA 3MHHA 2CRWA 3JUEA 1G25A 5KH3A 2MT5A 3O47A 2CKLB 4B7YC 5FEYA 2L5UA 5LKZA 5LCWB 1JM7A 4R8PK 4ZQLA 2M3HA 2MD8C 4ZUXU 2RR4A 1WGMA 4WZ0A 3M62A 2P57A 1DVPA 2ECWA 2PNXA 2KWKA 4OGEA 3T7LA 3NG2A 3L1ZB 1WILA 2MKEA 4Q6FA 2DX8A 3LDYA 1X4JA 2VPEA 3Q1DA 2VP7A 4I7BA 1WEOA 4LADB 3M7KA 1JM7B 1WEVA 1T1HA 1WIMA 2KE1A 4O62A 2DJAA 2EGMA 3PURA 2AN6A 2ECJA 3KQIA 2YREA 3DPLR 3RTRB 4GNFA 1WEWA 5D1LB 2YQMA 2XEUA 2MIQA 2ECTA 3ZNIA 2EGPA 2LGGA 2VPDA 3KV6A 2IQJA 4L7XA 1Z2QA 1MM3A 2BAYA 2XOCA 5C13A 5C11A 2FFWA 2EA6A 1WENA 4AP4A 1N87A 5EYAF 5LKXA 3FANA 2KWJA 3U5NA 2E61A 3ZPVE 2M13A 2XB1A 2YSMA 5FERA 2K1JA 2ECGA 2K17A 4FIPA 3KNVA 2YHOA 4AVXA 5AITA 2CSYA 1DCQA 1WEEA 3T9KA 2YVRA 3FM8C 3O35A 5K3QA 3ZTGA 3DDTA 1WFKA 2FSAA 3DQVR 2XOZA 2K16A 2E6RA 3KDEC 3IHPA 2KFTA 5SVXA 2KU3A 1LDJB 3N9MA 2L80A 5SVIA 3RPGC 3ZVZB 3H7HA 5G0FA 4YBMA 1U6GB 4TKPB 4LKAA 1FBVA 2EXUA 5AIUA 3ZPV1 5SVYA 1CHCA 2D8SA 2JUNA 3SOWA 4FK5A 5FB1A 3SUBA 1VYXA 3L1XA 3N9OA 2OWAA 2YQLA 4IC2A 2KGGA 2UZGA 4AYCA 4N3WA 3HCTA 2LXHC 3N9QA 2ECVA 4V3LC 5SVIB 3HCUA 2XOYA 1LDKC 3GV4A 4A0CD 4A4BA 3GL6A 3FL2A 4YC9A 2I50A 4PPEA 2YYRA 3L11A 2C2LA 5G05B 4CCGX 4CA1A 4A4CA 4IC3A 3O7AA 2JMIA 4AYCB 2Y1NA 4R7EA 5J3XA 2CSZA 1WEQA 2F42A 5LKUA 2H0DA 2KWNA 1K2FA 4O64A 2M85A 5I3LA 2MD7B 2JMJA 2LDRA 5H9MA 2L7PA 3O37A 2LRIC 5DINA 3HCSA 4WZ3B 4GNDA 5G04B 2L75A 2NAAA 2ZETC 4YBTA 4WA6A 2KREA 3VK6A 4YABA 2FUUA 3PUQA 4OGCA 5TDWA 3ZYQA 2KGIA 2LV9A 2QICA 2RSDA 3ZVYA 4X3GA 1ZBDB 2VJEA 3LQJA 2H0DB 3N9PA 1VFYA 4W4UA 2CSVA 3SHBA 4AUQB 5H1UA 3N9LA 2MA5A 3LVRE 2LXPC 2M1RA 4Z0RA 2G45A 2FD4A 2D8UA 4PTBA 2LGLA 4LLBA 1XWHA 5JG6A 2LQ6A 5TDRA 2JRJA 4YBSA 2MUMA 2YHNA 3SOXA 2ECNA 2YUCA 2VJFA 2Y43A 1F62A 4C9ZA 4B86C 4V3KC 2OXQC 1MBMA 2VPGA 4P5OB 4FO9A 1FP0A 2VJEB 3FJUB 4UP0A 4GNEA 3N9NA 4A49A
chains in the Genus database with same CATH topology
2YW8A 2G6QA 3LRQA 4N4FA 3PHDA 4R2YA 3SOUA 2CT2A 2VNFA 3EB6A 1X4IA 2KR4A 2F6NA 1E4UA 2VJFB 1WEPA 2RI7A 1X4UA 1V87A 2KWOA 4F52B 2LN0A 4BHWA 3C6WA 2JMDA 5H1TA 4QF3A 4NN2A 3LQIA 4BBQA 3O33A 2FUIA 3KV5A 4YADA 3U5PA 3V43A 3ASLA 1WESA 1Z6UA 4LJNA 2LGKA 3O34A 2KIZA 2QIZA 5FB0A 2C2VS 3T6RA 5B75A 3QZVA 4XI1A 3C5KA 2VPBA 2MA6A 4S3OC 2MNZA 4QF2A 4UI9B 5KH9A 4GB0A 5D1KB 2G43A 2E6SA 2MNYA 1WEUA 2QJ0A 2LGVA 1Z60A 3U5OA 5D1MB 4WZ2A 2HDPA 4UP5A 1WE9A 4MSXA 3RPGB 5TRBA 2YSJA 2KYUA 2L43A 1HYIA 1IYMA 4FJCA 1JOCA 2YT5A 2ECIA 2HYED 4MVTA 2EODA 2F6JA 3U5MA 4GNGA 2IDAA 2M6MA 5H1VA 5B79A 5B77A 5TABA 1HYJA 4I7DA 2PUYA 4I7CA 2K4DA 3M63A 3EB5A 5TBNA 3M99A 2YU4A 3LQHA 1MM2A 1BORA 2CKLA 3O70A 1RMDA 3O36A 4YATA 5B78A 3HTKC 4L58A 5KH7A 5B76A 5LKTA 3I2DA 1VD4A 5DKAA 4ZDTA 5B8DA 4LK9A 4YAXA 2L0BA 4S3OB 2YURA 1WEMA 3MHSA 2Y1MA 3MHHA 1G25A 5KH3A 2MT5A 2CKLB 4B7YC 5FEYA 2L5UA 5LKZA 5LCWB 1JM7A 4R8PK 4ZQLA 2M3HA 2MD8C 4ZUXU 1WGMA 4WZ0A 3M62A 1DVPA 2ECWA 2PNXA 2KWKA 3T7LA 3NG2A 3L1ZB 1WILA 4Q6FA 2DX8A 1X4JA 2VPEA 2VP7A 4I7BA 1WEOA 4LADB 1JM7B 1WEVA 1T1HA 1WIMA 2KE1A 3PURA 2AN6A 2ECJA 3KQIA 2YREA 3DPLR 3RTRB 4GNFA 1WEWA 5D1LB 2YQMA 2XEUA 2MIQA 2ECTA 3ZNIA 2EGPA 2LGGA 2VPDA 3KV6A 4L7XA 1Z2QA 1MM3A 2BAYA 5C13A 5C11A 2EA6A 1WENA 4AP4A 1N87A 5EYAF 5LKXA 2KWJA 3U5NA 3ZPVE 2XB1A 2YSMA 5FERA 2K1JA 2ECGA 2K17A 4FIPA 3KNVA 2YHOA 4AVXA 5AITA 2CSYA 1WEEA 3O35A 3ZTGA 1WFKA 2FSAA 3DQVR 2K16A 2E6RA 3IHPA 2KFTA 2KU3A 1LDJB 3N9MA 2L80A 3RPGC 3ZVZB 5G0FA 4YBMA 1U6GB 4TKPB 4LKAA 1FBVA 5AIUA 3ZPV1 1CHCA 2D8SA 3SOWA 4FK5A 5FB1A 1VYXA 3L1XA 3N9OA 2YQLA 4IC2A 2KGGA 2UZGA 4AYCA 4N3WA 3HCTA 2LXHC 3N9QA 2ECVA 4V3LC 3HCUA 1LDKC 3GV4A 4A0CD 4A4BA 3GL6A 3FL2A 4YC9A 2I50A 4PPEA 2YYRA 3L11A 2C2LA 5G05B 4CCGX 4CA1A 4A4CA 4IC3A 3O7AA 2JMIA 4AYCB 2Y1NA 4R7EA 5J3XA 2CSZA 1WEQA 2F42A 5LKUA 2H0DA 2KWNA 1K2FA 4O64A 2M85A 5I3LA 5H9MA 2MD7B 2JMJA 2LDRA 3O37A 2LRIC 5DINA 3HCSA 4WZ3B 4GNDA 5G04B 2L75A 2NAAA 2ZETC 4YBTA 4WA6A 2KREA 3VK6A 4YABA 2FUUA 3PUQA 5TDWA 3ZYQA 2KGIA 2LV9A 2QICA 2RSDA 3ZVYA 4X3GA 1ZBDB 2VJEA 3LQJA 2H0DB 3N9PA 1VFYA 4W4UA 3SHBA 4AUQB 5H1UA 3N9LA 2MA5A 2LXPC 2M1RA 2G45A 4PTBA 2LGLA 4LLBA 1XWHA 5JG6A 2LQ6A 5TDRA 2JRJA 4YBSA 2MUMA 2YHNA 3SOXA 2ECNA 2YUCA 2VJFA 2Y43A 1F62A 4C9ZA 4B86C 4V3KC 2OXQC 4P5OB 2VPGA 4FO9A 1FP0A 2VJEB 4UP0A 4GNEA 3N9NA 4A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YW8 A;  2G6Q A;  3LRQ A;  4N4F A;  3PHD A;  4R2Y A;  3SOU A;  2CT2 A;  2VNF A;  3EB6 A;  1X4I A;  2KR4 A;  2F6N A;  1E4U A;  2VJF B;  1WEP A;  2RI7 A;  1X4U A;  1V87 A;  2KWO A;  4F52 B;  2LN0 A;  4BHW A;  3C6W A;  2JMD A;  5H1T A;  4QF3 A;  4NN2 A;  3LQI A;  4BBQ A;  3O33 A;  2FUI A;  3KV5 A;  4YAD A;  3U5P A;  3V43 A;  3ASL A;  1WES A;  1Z6U A;  4LJN A;  2LGK A;  3O34 A;  2KIZ A;  2QIZ A;  5FB0 A;  2C2V S;  3T6R A;  5B75 A;  3QZV A;  4XI1 A;  3C5K A;  2VPB A;  2MA6 A;  4S3O C;  2MNZ A;  4QF2 A;  4UI9 B;  5KH9 A;  4GB0 A;  5D1K B;  2G43 A;  2E6S A;  2MNY A;  1WEU A;  2QJ0 A;  2LGV A;  1Z60 A;  3U5O A;  5D1M B;  4WZ2 A;  2HDP A;  4UP5 A;  1WE9 A;  4MSX A;  3RPG B;  5TRB A;  2YSJ A;  2KYU A;  2L43 A;  1HYI A;  1IYM A;  4FJC A;  1JOC A;  2YT5 A;  2ECI A;  2HYE D;  4MVT A;  2EOD A;  2F6J A;  3U5M A;  4GNG A;  2IDA A;  2M6M A;  5H1V A;  5B79 A;  5B77 A;  5TAB A;  1HYJ A;  4I7D A;  2PUY A;  4I7C A;  2K4D A;  3M63 A;  3EB5 A;  5TBN A;  3M99 A;  2YU4 A;  3LQH A;  1MM2 A;  1BOR A;  2CKL A;  3O70 A;  1RMD A;  3O36 A;  4YAT A;  5B78 A;  3HTK C;  4L58 A;  5KH7 A;  5B76 A;  5LKT A;  3I2D A;  1VD4 A;  5DKA A;  4ZDT A;  5B8D A;  4LK9 A;  4YAX A;  2L0B A;  4S3O B;  2YUR A;  1WEM A;  3MHS A;  2Y1M A;  3MHH A;  1G25 A;  5KH3 A;  2MT5 A;  2CKL B;  4B7Y C;  5FEY A;  2L5U A;  5LKZ A;  5LCW B;  1JM7 A;  4R8P K;  4ZQL A;  2M3H A;  2MD8 C;  4ZUX U;  1WGM A;  4WZ0 A;  3M62 A;  1DVP A;  2ECW A;  2PNX A;  2KWK A;  3T7L A;  3NG2 A;  3L1Z B;  1WIL A;  4Q6F A;  2DX8 A;  1X4J A;  2VPE A;  2VP7 A;  4I7B A;  1WEO A;  4LAD B;  1JM7 B;  1WEV A;  1T1H A;  1WIM A;  2KE1 A;  3PUR A;  2AN6 A;  2ECJ A;  3KQI A;  2YRE A;  3DPL R;  3RTR B;  4GNF A;  1WEW A;  5D1L B;  2YQM A;  2XEU A;  2MIQ A;  2ECT A;  3ZNI A;  2EGP A;  2LGG A;  2VPD A;  3KV6 A;  4L7X A;  1Z2Q A;  1MM3 A;  2BAY A;  5C13 A;  5C11 A;  2EA6 A;  1WEN A;  4AP4 A;  1N87 A;  5EYA F;  5LKX A;  2KWJ A;  3U5N A;  3ZPV E;  2XB1 A;  2YSM A;  5FER A;  2K1J A;  2ECG A;  2K17 A;  4FIP A;  3KNV A;  2YHO A;  4AVX A;  5AIT A;  2CSY A;  1WEE A;  3O35 A;  3ZTG A;  1WFK A;  2FSA A;  3DQV R;  2K16 A;  2E6R A;  3IHP A;  2KFT A;  2KU3 A;  1LDJ B;  3N9M A;  2L80 A;  3RPG C;  3ZVZ B;  5G0F A;  4YBM A;  1U6G B;  4TKP B;  4LKA A;  1FBV A;  5AIU A;  3ZPV 1;  1CHC A;  2D8S A;  3SOW A;  4FK5 A;  5FB1 A;  1VYX A;  3L1X A;  3N9O A;  2YQL A;  4IC2 A;  2KGG A;  2UZG A;  4AYC A;  4N3W A;  3HCT A;  2LXH C;  3N9Q A;  2ECV A;  4V3L C;  3HCU A;  1LDK C;  3GV4 A;  4A0C D;  4A4B A;  3GL6 A;  3FL2 A;  4YC9 A;  2I50 A;  4PPE A;  2YYR A;  3L11 A;  2C2L A;  5G05 B;  4CCG X;  4CA1 A;  4A4C A;  4IC3 A;  3O7A A;  2JMI A;  4AYC B;  2Y1N A;  4R7E A;  5J3X A;  2CSZ A;  1WEQ A;  2F42 A;  5LKU A;  2H0D A;  2KWN A;  1K2F A;  4O64 A;  2M85 A;  5I3L A;  5H9M A;  2MD7 B;  2JMJ A;  2LDR A;  3O37 A;  2LRI C;  5DIN A;  3HCS A;  4WZ3 B;  4GND A;  5G04 B;  2L75 A;  2NAA A;  2ZET C;  4YBT A;  4WA6 A;  2KRE A;  3VK6 A;  4YAB A;  2FUU A;  3PUQ A;  5TDW A;  3ZYQ A;  2KGI A;  2LV9 A;  2QIC A;  2RSD A;  3ZVY A;  4X3G A;  1ZBD B;  2VJE A;  3LQJ A;  2H0D B;  3N9P A;  1VFY A;  4W4U A;  3SHB A;  4AUQ B;  5H1U A;  3N9L A;  2MA5 A;  2LXP C;  2M1R A;  2G45 A;  4PTB A;  2LGL A;  4LLB A;  1XWH A;  5JG6 A;  2LQ6 A;  5TDR A;  2JRJ A;  4YBS A;  2MUM A;  2YHN A;  3SOX A;  2ECN A;  2YUC A;  2VJF A;  2Y43 A;  1F62 A;  4C9Z A;  4B86 C;  4V3K C;  2OXQ C;  4P5O B;  2VPG A;  4FO9 A;  1FP0 A;  2VJE B;  4UP0 A;  4GNE A;  3N9N A;  4A49 A; 
#chains in the Genus database with same CATH topology
 2YW8 A;  2G6Q A;  3LRQ A;  4N4F A;  3PHD A;  4R2Y A;  3SOU A;  2CT2 A;  2VNF A;  3EB6 A;  1X4I A;  2KR4 A;  4QQ4 A;  2DSM A;  2F6N A;  1E4U A;  2VJF B;  2CON A;  1WEP A;  2RI7 A;  1X4U A;  1V87 A;  2KWO A;  3DWD A;  2JM3 A;  4F52 B;  2LN0 A;  4BHW A;  3C6W A;  2CRR A;  2XP0 A;  2JMD A;  5H1T A;  4QF3 A;  4NN2 A;  3LQI A;  4BBQ A;  3O33 A;  2FUI A;  3KV5 A;  4YAD A;  3U5P A;  3V43 A;  3ASL A;  1WES A;  1Z6U A;  4LJN A;  4H9D A;  2LGK A;  3O34 A;  2KIZ A;  2QIZ A;  5FB0 A;  2C2V S;  3T6R A;  5B75 A;  3QZV A;  4XI1 A;  3C5K A;  2LAU A;  2VPB A;  2MA6 A;  4S3O C;  2MNZ A;  4QF2 A;  4UI9 B;  5KH9 A;  4GB0 A;  5D1K B;  2G43 A;  3E2D A;  2E6S A;  2KKX A;  2MNY A;  1WEU A;  2QJ0 A;  2LGV A;  1Z60 A;  3U5O A;  5D1M B;  4WZ2 A;  4F1P A;  2HDP A;  4UP5 A;  3MDB C;  1WE9 A;  3FAO A;  4MSX A;  3RPG B;  5TRB A;  2YSJ A;  2KYU A;  2L43 A;  1HYI A;  1IYM A;  4FJC A;  1JOC A;  2YT5 A;  2ECI A;  2HYE D;  4MVT A;  2EOD A;  2F6J A;  3U5M A;  4GNG A;  2B0O E;  2IDA A;  2M6M A;  3LVQ E;  5H1V A;  5B79 A;  5B77 A;  5TAB A;  1HYJ A;  4I7D A;  2PUY A;  4I7C A;  2K4D A;  3M63 A;  3EB5 A;  5TBN A;  3M99 A;  2YU4 A;  3LQH A;  1MM2 A;  3FEH A;  1BOR A;  2CKL A;  3LJU X;  3O70 A;  1RMD A;  3O36 A;  4YAT A;  4Z0O A;  5B78 A;  3HTK C;  2KKY A;  4L58 A;  5KH7 A;  5B76 A;  5LKT A;  3I2D A;  1VD4 A;  3PLW A;  5DKA A;  4ZDT A;  5B8D A;  4LK9 A;  4YAX A;  2L0B A;  4S3O B;  2YUR A;  1WEM A;  3MHS A;  2Y1M A;  3MHH A;  2CRW A;  3JUE A;  1G25 A;  5KH3 A;  2MT5 A;  3O47 A;  2CKL B;  4B7Y C;  5FEY A;  2L5U A;  5LKZ A;  5LCW B;  1JM7 A;  4R8P K;  4ZQL A;  2M3H A;  2MD8 C;  4ZUX U;  2RR4 A;  1WGM A;  4WZ0 A;  3M62 A;  2P57 A;  1DVP A;  2ECW A;  2PNX A;  2KWK A;  4OGE A;  3T7L A;  3NG2 A;  3L1Z B;  1WIL A;  2MKE A;  4Q6F A;  2DX8 A;  3LDY A;  1X4J A;  2VPE A;  3Q1D A;  2VP7 A;  4I7B A;  1WEO A;  4LAD B;  3M7K A;  1JM7 B;  1WEV A;  1T1H A;  1WIM A;  2KE1 A;  4O62 A;  2DJA A;  2EGM A;  3PUR A;  2AN6 A;  2ECJ A;  3KQI A;  2YRE A;  3DPL R;  3RTR B;  4GNF A;  1WEW A;  5D1L B;  2YQM A;  2XEU A;  2MIQ A;  2ECT A;  3ZNI A;  2EGP A;  2LGG A;  2VPD A;  3KV6 A;  2IQJ A;  4L7X A;  1Z2Q A;  1MM3 A;  2BAY A;  2XOC A;  5C13 A;  5C11 A;  2FFW A;  2EA6 A;  1WEN A;  4AP4 A;  1N87 A;  5EYA F;  5LKX A;  3FAN A;  2KWJ A;  3U5N A;  2E61 A;  3ZPV E;  2M13 A;  2XB1 A;  2YSM A;  5FER A;  2K1J A;  2ECG A;  2K17 A;  4FIP A;  3KNV A;  2YHO A;  4AVX A;  5AIT A;  2CSY A;  1DCQ A;  1WEE A;  3T9K A;  2YVR A;  3FM8 C;  3O35 A;  5K3Q A;  3ZTG A;  3DDT A;  1WFK A;  2FSA A;  3DQV R;  2XOZ A;  2K16 A;  2E6R A;  3KDE C;  3IHP A;  2KFT A;  5SVX A;  2KU3 A;  1LDJ B;  3N9M A;  2L80 A;  5SVI A;  3RPG C;  3ZVZ B;  3H7H A;  5G0F A;  4YBM A;  1U6G B;  4TKP B;  4LKA A;  1FBV A;  2EXU A;  5AIU A;  3ZPV 1;  5SVY A;  1CHC A;  2D8S A;  2JUN A;  3SOW A;  4FK5 A;  5FB1 A;  3SUB A;  1VYX A;  3L1X A;  3N9O A;  2OWA A;  2YQL A;  4IC2 A;  2KGG A;  2UZG A;  4AYC A;  4N3W A;  3HCT A;  2LXH C;  3N9Q A;  2ECV A;  4V3L C;  5SVI B;  3HCU A;  2XOY A;  1LDK C;  3GV4 A;  4A0C D;  4A4B A;  3GL6 A;  3FL2 A;  4YC9 A;  2I50 A;  4PPE A;  2YYR A;  3L11 A;  2C2L A;  5G05 B;  4CCG X;  4CA1 A;  4A4C A;  4IC3 A;  3O7A A;  2JMI A;  4AYC B;  2Y1N A;  4R7E A;  5J3X A;  2CSZ A;  1WEQ A;  2F42 A;  5LKU A;  2H0D A;  2KWN A;  1K2F A;  4O64 A;  2M85 A;  5I3L A;  2MD7 B;  2JMJ A;  2LDR A;  5H9M A;  2L7P A;  3O37 A;  2LRI C;  5DIN A;  3HCS A;  4WZ3 B;  4GND A;  5G04 B;  2L75 A;  2NAA A;  2ZET C;  4YBT A;  4WA6 A;  2KRE A;  3VK6 A;  4YAB A;  2FUU A;  3PUQ A;  4OGC A;  5TDW A;  3ZYQ A;  2KGI A;  2LV9 A;  2QIC A;  2RSD A;  3ZVY A;  4X3G A;  1ZBD B;  2VJE A;  3LQJ A;  2H0D B;  3N9P A;  1VFY A;  4W4U A;  2CSV A;  3SHB A;  4AUQ B;  5H1U A;  3N9L A;  2MA5 A;  3LVR E;  2LXP C;  2M1R A;  4Z0R A;  2G45 A;  2FD4 A;  2D8U A;  4PTB A;  2LGL A;  4LLB A;  1XWH A;  5JG6 A;  2LQ6 A;  5TDR A;  2JRJ A;  4YBS A;  2MUM A;  2YHN A;  3SOX A;  2ECN A;  2YUC A;  2VJF A;  2Y43 A;  1F62 A;  4C9Z A;  4B86 C;  4V3K C;  2OXQ C;  1MBM A;  2VPG A;  4P5O B;  4FO9 A;  1FP0 A;  2VJE B;  3FJU B;  4UP0 A;  4GNE A;  3N9N A;  4A49 A; 
#chains in the Genus database with same CATH homology
 2YW8 A;  2G6Q A;  3LRQ A;  4N4F A;  3PHD A;  4R2Y A;  3SOU A;  2CT2 A;  2VNF A;  3EB6 A;  1X4I A;  2KR4 A;  2F6N A;  1E4U A;  2VJF B;  1WEP A;  2RI7 A;  1X4U A;  1V87 A;  2KWO A;  4F52 B;  2LN0 A;  4BHW A;  3C6W A;  2JMD A;  5H1T A;  4QF3 A;  4NN2 A;  3LQI A;  4BBQ A;  3O33 A;  2FUI A;  3KV5 A;  4YAD A;  3U5P A;  3V43 A;  3ASL A;  1WES A;  1Z6U A;  4LJN A;  2LGK A;  3O34 A;  2KIZ A;  2QIZ A;  5FB0 A;  2C2V S;  3T6R A;  5B75 A;  3QZV A;  4XI1 A;  3C5K A;  2VPB A;  2MA6 A;  4S3O C;  2MNZ A;  4QF2 A;  4UI9 B;  5KH9 A;  4GB0 A;  5D1K B;  2G43 A;  2E6S A;  2MNY A;  1WEU A;  2QJ0 A;  2LGV A;  1Z60 A;  3U5O A;  5D1M B;  4WZ2 A;  2HDP A;  4UP5 A;  1WE9 A;  4MSX A;  3RPG B;  5TRB A;  2YSJ A;  2KYU A;  2L43 A;  1HYI A;  1IYM A;  4FJC A;  1JOC A;  2YT5 A;  2ECI A;  2HYE D;  4MVT A;  2EOD A;  2F6J A;  3U5M A;  4GNG A;  2IDA A;  2M6M A;  5H1V A;  5B79 A;  5B77 A;  5TAB A;  1HYJ A;  4I7D A;  2PUY A;  4I7C A;  2K4D A;  3M63 A;  3EB5 A;  5TBN A;  3M99 A;  2YU4 A;  3LQH A;  1MM2 A;  1BOR A;  2CKL A;  3O70 A;  1RMD A;  3O36 A;  4YAT A;  5B78 A;  3HTK C;  4L58 A;  5KH7 A;  5B76 A;  5LKT A;  3I2D A;  1VD4 A;  5DKA A;  4ZDT A;  5B8D A;  4LK9 A;  4YAX A;  2L0B A;  4S3O B;  2YUR A;  1WEM A;  3MHS A;  2Y1M A;  3MHH A;  1G25 A;  5KH3 A;  2MT5 A;  2CKL B;  4B7Y C;  5FEY A;  2L5U A;  5LKZ A;  5LCW B;  1JM7 A;  4R8P K;  4ZQL A;  2M3H A;  2MD8 C;  4ZUX U;  1WGM A;  4WZ0 A;  3M62 A;  1DVP A;  2ECW A;  2PNX A;  2KWK A;  3T7L A;  3NG2 A;  3L1Z B;  1WIL A;  4Q6F A;  2DX8 A;  1X4J A;  2VPE A;  2VP7 A;  4I7B A;  1WEO A;  4LAD B;  1JM7 B;  1WEV A;  1T1H A;  1WIM A;  2KE1 A;  3PUR A;  2AN6 A;  2ECJ A;  3KQI A;  2YRE A;  3DPL R;  3RTR B;  4GNF A;  1WEW A;  5D1L B;  2YQM A;  2XEU A;  2MIQ A;  2ECT A;  3ZNI A;  2EGP A;  2LGG A;  2VPD A;  3KV6 A;  4L7X A;  1Z2Q A;  1MM3 A;  2BAY A;  5C13 A;  5C11 A;  2EA6 A;  1WEN A;  4AP4 A;  1N87 A;  5EYA F;  5LKX A;  2KWJ A;  3U5N A;  3ZPV E;  2XB1 A;  2YSM A;  5FER A;  2K1J A;  2ECG A;  2K17 A;  4FIP A;  3KNV A;  2YHO A;  4AVX A;  5AIT A;  2CSY A;  1WEE A;  3O35 A;  3ZTG A;  1WFK A;  2FSA A;  3DQV R;  2K16 A;  2E6R A;  3IHP A;  2KFT A;  2KU3 A;  1LDJ B;  3N9M A;  2L80 A;  3RPG C;  3ZVZ B;  5G0F A;  4YBM A;  1U6G B;  4TKP B;  4LKA A;  1FBV A;  5AIU A;  3ZPV 1;  1CHC A;  2D8S A;  3SOW A;  4FK5 A;  5FB1 A;  1VYX A;  3L1X A;  3N9O A;  2YQL A;  4IC2 A;  2KGG A;  2UZG A;  4AYC A;  4N3W A;  3HCT A;  2LXH C;  3N9Q A;  2ECV A;  4V3L C;  3HCU A;  1LDK C;  3GV4 A;  4A0C D;  4A4B A;  3GL6 A;  3FL2 A;  4YC9 A;  2I50 A;  4PPE A;  2YYR A;  3L11 A;  2C2L A;  5G05 B;  4CCG X;  4CA1 A;  4A4C A;  4IC3 A;  3O7A A;  2JMI A;  4AYC B;  2Y1N A;  4R7E A;  5J3X A;  2CSZ A;  1WEQ A;  2F42 A;  5LKU A;  2H0D A;  2KWN A;  1K2F A;  4O64 A;  2M85 A;  5I3L A;  5H9M A;  2MD7 B;  2JMJ A;  2LDR A;  3O37 A;  2LRI C;  5DIN A;  3HCS A;  4WZ3 B;  4GND A;  5G04 B;  2L75 A;  2NAA A;  2ZET C;  4YBT A;  4WA6 A;  2KRE A;  3VK6 A;  4YAB A;  2FUU A;  3PUQ A;  5TDW A;  3ZYQ A;  2KGI A;  2LV9 A;  2QIC A;  2RSD A;  3ZVY A;  4X3G A;  1ZBD B;  2VJE A;  3LQJ A;  2H0D B;  3N9P A;  1VFY A;  4W4U A;  3SHB A;  4AUQ B;  5H1U A;  3N9L A;  2MA5 A;  2LXP C;  2M1R A;  2G45 A;  4PTB A;  2LGL A;  4LLB A;  1XWH A;  5JG6 A;  2LQ6 A;  5TDR A;  2JRJ A;  4YBS A;  2MUM A;  2YHN A;  3SOX A;  2ECN A;  2YUC A;  2VJF A;  2Y43 A;  1F62 A;  4C9Z A;  4B86 C;  4V3K C;  2OXQ C;  4P5O B;  2VPG A;  4FO9 A;  1FP0 A;  2VJE B;  4UP0 A;  4GNE A;  3N9N A;  4A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...