4CCGX

Structure of an e2-e3 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
EKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 T
publication title Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 75
sequence length 75
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11793 FANCL_C FANCL C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ccgX00
3U5NA 4WZ2A 2KIZA 2L80A 2LXHC 2BAYA 2LGVA 4L7XA 2K17A 1VFYA 3LQJA 2LGLA 3U5MA 4S3OC 3HCUA 4ZDTA 4NN2A 1LDJB 1VD4A 4O64A 1Z60A 3T7LA 4GNDA 2VJEB 3VK6A 2CKLA 2MNYA 2PNXA 3ZPV1 5H1TA 2MD7B 2XB1A 3GL6A 5B78A 2AN6A 1U6GB 4WA6A 2L5UA 2YW8A 2FUIA 4AP4A 5D1KB 3KQIA 3N9QA 4YBMA 2NAAA 5H1VA 3N9LA 2E6RA 1MM2A 5KH7A 2VJFB 1X4IA 1N87A 2OXQC 4ZUXU 5D1LB 5D1MB 2LGGA 3KV6A 2CSYA 2KYUA 3L11A 2G43A 3RTRB 2ECIA 4W4UA 1FP0A 2YQMA 2KR4A 5TABA 3SOWA 4R7EA 1X4UA 3C5KA 5KH9A 2QJ0A 2QIZA 3NG2A 1IYMA 3ZNIA 4YBSA 5DINA 1RMDA 2JRJA 4I7DA 3O7AA 3MHHA 2LRIC 3ZYQA 5LKTA 4LKAA 4AUQB 1X4JA 2M6MA 4B7YC 5FB0A 4S3OB 1BORA 3O34A 2VJEA 4R2YA 5B75A 4A49A 1HYIA 2MIQA 2MNZA 5G04B 3O70A 4XI1A 4I7CA 3V43A 2YQLA 4UP0A 3U5PA 2L0BA 4L58A 3N9PA 2JMDA 2EGPA 2KE1A 5B76A 1JM7A 4MSXA 2VPBA 4WZ3B 2DX8A 4FK5A 2YREA 3SHBA 2ECNA 4V3KC 2VJFA 3RPGC 3ZVYA 4GNFA 2KWOA 3PURA 1FBVA 2MA6A 3FL2A 4GB0A 4AYCB 3SOUA 2ECJA 2L75A 2YHNA 3QZVA 4N3WA 2MD8C 4YBTA 3ZPVE 5LKZA 5DKAA 4A0CD 2L43A 2PUYA 1V87A 4QF3A 2IDAA 5G05B 5TBNA 2ECGA 5TRBA 2ZETC 4PPEA 2ECTA 5C13A 2K1JA 4Q6FA 2C2VS 1JM7B 4V3LC 2LDRA 2LXPC 4C9ZA 5LKUA 2H0DB 5LCWB 2ECVA 2F6NA 2KWKA 5FEYA 3O35A 3N9OA 1WEOA 4LK9A 2YSJA 4A4BA 2HDPA 1JOCA 4MVTA 4QF2A 3I2DA 2VPEA 1WEPA 5C11A 2YHOA 4BBQA 1XWHA 2CT2A 2ECWA 1G25A 3MHSA 3M62A 4B86C 3ZTGA 4AYCA 3KV5A 2UZGA 4I7BA 3RPGB 1WE9A 2K16A 2KGGA 4GNEA 2KU3A 2M1RA 2RSDA 5G0FA 3O33A 2D8SA 3L1ZB 4LADB 3PHDA 5LKXA 2G45A 2XEUA 4ZQLA 1E4UA 4CA1A 2MA5A 2LGKA 5B77A 2YYRA 4WZ0A 1CHCA 2HYED 3LQIA 4AVXA 2YU4A 3M99A 2VPGA 2H0DA 5B79A 4UP5A 5KH3A 5TDWA 2JMJA 1WEWA 4CCGX 5JG6A 1WEMA 4YATA 3U5OA 5H1UA 3ZVZB 4UI9B 2LN0A 1WGMA 4FIPA 3EB5A 5FERA 3HCTA 3KNVA 3LQHA 2Y1MA 4X3GA 3IHPA 2Y1NA 2MT5A 4LJNA 2KGIA 5J3XA 2E6SA 4LLBA 4R8PK 4N4FA 2EODA 3DQVR 1Z2QA 2M85A 4FO9A 2K4DA 1WEEA 4BHWA 5B8DA 2F42A 5I3LA 1WFKA 4PTBA 1WENA 3EB6A 2YT5A 2G6QA 1WESA 1Z6UA 4YC9A 1MM3A 4P5OB 2KREA 3N9MA 2YSMA 2FSAA 3M63A 4TKPB 2YURA 5H9MA 2I50A 3GV4A 4FJCA 2M3HA 4YAXA 4YABA 4GNGA 2JMIA 2EA6A 2RI7A 2F6JA 1WILA 1DVPA 2C2LA 1WEUA 1VYXA 3ASLA 1WEQA 4IC3A 1F62A 3L1XA 5FB1A 3C6WA 3PUQA 5AITA 2FUUA 3DPLR 1K2FA 2YUCA 3LRQA 5EYAF 4A4CA 3T6RA 1WEVA 3O37A 2MUMA 2CKLB 2VPDA 3N9NA 5TDRA 4IC2A 2KWJA 2KFTA 4YADA 2LV9A 4F52B 2Y43A 1ZBDB 3O36A 1WIMA 3SOXA 2LQ6A 3HCSA 2VP7A 2CSZA 3HTKC 1LDKC 2QICA 5AIUA 2VNFA 2KWNA 1HYJA 1T1HA
chains in the Genus database with same CATH superfamily
3U5NA 4WZ2A 2KIZA 2L80A 2LXHC 2BAYA 2CSVA 1DCQA 2LGVA 4L7XA 2K17A 1VFYA 3LQJA 2LGLA 3U5MA 4S3OC 3HCUA 4ZDTA 4NN2A 1LDJB 1VD4A 4O64A 5SVIA 1Z60A 2XOCA 3T7LA 4F1PA 4GNDA 2VJEB 2DSMA 3VK6A 2CKLA 2MNYA 2PNXA 3ZPV1 5H1TA 2MD7B 2XB1A 3GL6A 4OGEA 5B78A 2AN6A 1U6GB 4WA6A 2L5UA 2XP0A 2YW8A 2FUIA 3FM8C 4AP4A 5D1KB 2CONA 3KQIA 3N9QA 4YBMA 2NAAA 5H1VA 3N9LA 2E6RA 1MM2A 5KH7A 2VJFB 1X4IA 1N87A 3T9KA 2OXQC 2RR4A 3DWDA 3LJUX 4ZUXU 5D1LB 5D1MB 2LGGA 3KV6A 2CSYA 2KYUA 3L11A 2G43A 3RTRB 2ECIA 4W4UA 1FP0A 2YQMA 2KR4A 5TABA 3SOWA 4R7EA 1X4UA 3C5KA 5KH9A 2QJ0A 2QIZA 3NG2A 1IYMA 3ZNIA 4YBSA 5DINA 1RMDA 2EGMA 2JRJA 4I7DA 3O7AA 3MHHA 2LRIC 3SUBA 3PLWA 3ZYQA 4LKAA 5LKTA 2XOYA 4AUQB 1X4JA 2M6MA 4B7YC 5FB0A 4S3OB 1BORA 3O34A 2B0OE 2VJEA 4R2YA 5B75A 4A49A 1HYIA 2MIQA 2MNZA 5G04B 3O70A 4XI1A 4I7CA 4Z0RA 3V43A 2YQLA 4UP0A 3U5PA 2M13A 2L0BA 4L58A 3MDBC 3N9PA 2JMDA 2EGPA 2KE1A 5B76A 1JM7A 4MSXA 2VPBA 4WZ3B 2KKXA 2DX8A 4FK5A 2YREA 3SHBA 2ECNA 4QQ4A 1MBMA 4V3KC 2VJFA 3E2DA 3RPGC 3ZVYA 4GNFA 2KWOA 3PURA 1FBVA 2MA6A 3FL2A 2CRRA 4GB0A 4AYCB 3SOUA 2ECJA 2OWAA 2L75A 2YHNA 3QZVA 4N3WA 2MD8C 4YBTA 3ZPVE 5LKZA 5DKAA 4A0CD 2L43A 2PUYA 1V87A 4QF3A 2IDAA 5G05B 5TBNA 2ECGA 5TRBA 3FAOA 2ZETC 4PPEA 2ECTA 5SVYA 5C13A 2K1JA 2XOZA 4Q6FA 2C2VS 1JM7B 4V3LC 2LDRA 2LXPC 3FEHA 4C9ZA 5LKUA 2H0DB 5LCWB 2ECVA 2F6NA 2KWKA 5FEYA 3O35A 3N9OA 1WEOA 4LK9A 2YSJA 4A4BA 2HDPA 1JOCA 4MVTA 4QF2A 3I2DA 2VPEA 1WEPA 5C11A 2YHOA 4BBQA 1XWHA 2CT2A 2ECWA 1G25A 3MHSA 2DJAA 3M62A 2EXUA 4B86C 3ZTGA 4AYCA 3KV5A 2UZGA 3FJUB 2P57A 4I7BA 3RPGB 1WE9A 2K16A 2KGGA 4GNEA 3KDEC 2KU3A 2M1RA 2RSDA 3DDTA 3O33A 5G0FA 2D8SA 3L1ZB 4LADB 3PHDA 5LKXA 3FANA 2KKYA 2G45A 2JM3A 2XEUA 4ZQLA 1E4UA 4CA1A 2MA5A 3Q1DA 2LGKA 5B77A 2YYRA 4WZ0A 1CHCA 2HYED 3LQIA 4AVXA 2YU4A 3M99A 2VPGA 2H0DA 5B79A 5SVXA 2L7PA 4UP5A 3M7KA 5KH3A 5TDWA 2JMJA 1WEWA 4CCGX 5JG6A 1WEMA 4YATA 2FD4A 3U5OA 3JUEA 5H1UA 3ZVZB 4UI9B 2LN0A 1WGMA 4FIPA 3EB5A 5FERA 3HCTA 3H7HA 3KNVA 3LQHA 2Y1MA 4X3GA 3IHPA 2Y1NA 2MT5A 4LJNA 2KGIA 5J3XA 2E6SA 4LLBA 4R8PK 2YVRA 4Z0OA 4N4FA 2EODA 3DQVR 1Z2QA 2M85A 4FO9A 2K4DA 1WEEA 4BHWA 5B8DA 2F42A 5I3LA 1WFKA 4PTBA 1WENA 3EB6A 2YT5A 3O47A 2G6QA 1WESA 1Z6UA 4YC9A 1MM3A 4P5OB 2KREA 3N9MA 2YSMA 2FSAA 3M63A 4TKPB 2YURA 5H9MA 2I50A 3GV4A 4FJCA 2M3HA 4YAXA 4YABA 4GNGA 2MKEA 2JMIA 2EA6A 3LVQE 2RI7A 2F6JA 2LAUA 1WILA 1DVPA 2C2LA 2IQJA 1WEUA 1VYXA 3ASLA 1WEQA 4IC3A 3LVRE 1F62A 3L1XA 5FB1A 3C6WA 2CRWA 2D8UA 3PUQA 5AITA 2FUUA 3DPLR 1K2FA 5SVIB 2YUCA 3LRQA 5EYAF 4A4CA 3T6RA 1WEVA 3O37A 2MUMA 2CKLB 2VPDA 3N9NA 5TDRA 3LDYA 4IC2A 2KWJA 5K3QA 2KFTA 4YADA 2LV9A 4F52B 2Y43A 1ZBDB 3O36A 4H9DA 1WIMA 3SOXA 2LQ6A 2JUNA 4O62A 3HCSA 2VP7A 2CSZA 3HTKC 1LDKC 2E61A 2QICA 5AIUA 2VNFA 4OGCA 2KWNA 1HYJA 2FFWA 1T1HA
chains in the Genus database with same CATH topology
3U5NA 4WZ2A 2KIZA 2L80A 2LXHC 2BAYA 2LGVA 4L7XA 2K17A 1VFYA 3LQJA 2LGLA 3U5MA 4S3OC 3HCUA 4ZDTA 4NN2A 1LDJB 1VD4A 4O64A 1Z60A 3T7LA 4GNDA 2VJEB 3VK6A 2CKLA 2MNYA 2PNXA 3ZPV1 5H1TA 2MD7B 2XB1A 3GL6A 5B78A 2AN6A 1U6GB 4WA6A 2L5UA 2YW8A 2FUIA 4AP4A 5D1KB 3KQIA 3N9QA 4YBMA 2NAAA 5H1VA 3N9LA 2E6RA 1MM2A 5KH7A 2VJFB 1X4IA 1N87A 2OXQC 4ZUXU 5D1LB 5D1MB 2LGGA 3KV6A 2CSYA 2KYUA 3L11A 2G43A 3RTRB 2ECIA 4W4UA 1FP0A 2YQMA 2KR4A 5TABA 3SOWA 4R7EA 1X4UA 3C5KA 5KH9A 2QJ0A 2QIZA 3NG2A 1IYMA 3ZNIA 4YBSA 5DINA 1RMDA 2JRJA 4I7DA 3O7AA 3MHHA 2LRIC 3ZYQA 5LKTA 4LKAA 4AUQB 1X4JA 2M6MA 4B7YC 5FB0A 4S3OB 1BORA 3O34A 2VJEA 4R2YA 5B75A 4A49A 1HYIA 2MIQA 2MNZA 5G04B 3O70A 4XI1A 4I7CA 3V43A 2YQLA 4UP0A 3U5PA 2L0BA 4L58A 3N9PA 2JMDA 2EGPA 2KE1A 5B76A 1JM7A 4MSXA 2VPBA 4WZ3B 2DX8A 4FK5A 2YREA 3SHBA 2ECNA 4V3KC 2VJFA 3RPGC 3ZVYA 4GNFA 2KWOA 3PURA 1FBVA 2MA6A 3FL2A 4GB0A 4AYCB 3SOUA 2ECJA 2L75A 2YHNA 3QZVA 4N3WA 2MD8C 4YBTA 3ZPVE 5LKZA 5DKAA 4A0CD 2L43A 2PUYA 1V87A 4QF3A 2IDAA 5G05B 5TBNA 2ECGA 5TRBA 2ZETC 4PPEA 2ECTA 5C13A 2K1JA 4Q6FA 2C2VS 1JM7B 4V3LC 2LDRA 2LXPC 4C9ZA 5LKUA 2H0DB 5LCWB 2ECVA 2F6NA 2KWKA 5FEYA 3O35A 3N9OA 1WEOA 4LK9A 2YSJA 4A4BA 2HDPA 1JOCA 4MVTA 4QF2A 3I2DA 2VPEA 1WEPA 5C11A 2YHOA 4BBQA 1XWHA 2CT2A 2ECWA 1G25A 3MHSA 3M62A 4B86C 3ZTGA 4AYCA 3KV5A 2UZGA 4I7BA 3RPGB 1WE9A 2K16A 2KGGA 4GNEA 2KU3A 2M1RA 2RSDA 5G0FA 3O33A 2D8SA 3L1ZB 4LADB 3PHDA 5LKXA 2G45A 2XEUA 4ZQLA 1E4UA 4CA1A 2MA5A 2LGKA 5B77A 2YYRA 4WZ0A 1CHCA 2HYED 3LQIA 4AVXA 2YU4A 3M99A 2VPGA 2H0DA 5B79A 4UP5A 5KH3A 5TDWA 2JMJA 1WEWA 4CCGX 5JG6A 1WEMA 4YATA 3U5OA 5H1UA 3ZVZB 4UI9B 2LN0A 1WGMA 4FIPA 3EB5A 5FERA 3HCTA 3KNVA 3LQHA 2Y1MA 4X3GA 3IHPA 2Y1NA 2MT5A 4LJNA 2KGIA 5J3XA 2E6SA 4LLBA 4R8PK 4N4FA 2EODA 3DQVR 1Z2QA 2M85A 4FO9A 2K4DA 1WEEA 4BHWA 5B8DA 2F42A 5I3LA 1WFKA 4PTBA 1WENA 3EB6A 2YT5A 2G6QA 1WESA 1Z6UA 4YC9A 1MM3A 4P5OB 2KREA 3N9MA 2YSMA 2FSAA 3M63A 4TKPB 2YURA 5H9MA 2I50A 3GV4A 4FJCA 2M3HA 4YAXA 4YABA 4GNGA 2JMIA 2EA6A 2RI7A 2F6JA 1WILA 1DVPA 2C2LA 1WEUA 1VYXA 3ASLA 1WEQA 4IC3A 1F62A 3L1XA 5FB1A 3C6WA 3PUQA 5AITA 2FUUA 3DPLR 1K2FA 2YUCA 3LRQA 5EYAF 4A4CA 3T6RA 1WEVA 3O37A 2MUMA 2CKLB 2VPDA 3N9NA 5TDRA 4IC2A 2KWJA 2KFTA 4YADA 2LV9A 4F52B 2Y43A 1ZBDB 3O36A 1WIMA 3SOXA 2LQ6A 3HCSA 2VP7A 2CSZA 3HTKC 1LDKC 2QICA 5AIUA 2VNFA 2KWNA 1HYJA 1T1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5N A;  4WZ2 A;  2KIZ A;  2L80 A;  2LXH C;  2BAY A;  2LGV A;  4L7X A;  2K17 A;  1VFY A;  3LQJ A;  2LGL A;  3U5M A;  4S3O C;  3HCU A;  4ZDT A;  4NN2 A;  1LDJ B;  1VD4 A;  4O64 A;  1Z60 A;  3T7L A;  4GND A;  2VJE B;  3VK6 A;  2CKL A;  2MNY A;  2PNX A;  3ZPV 1;  5H1T A;  2MD7 B;  2XB1 A;  3GL6 A;  5B78 A;  2AN6 A;  1U6G B;  4WA6 A;  2L5U A;  2YW8 A;  2FUI A;  4AP4 A;  5D1K B;  3KQI A;  3N9Q A;  4YBM A;  2NAA A;  5H1V A;  3N9L A;  2E6R A;  1MM2 A;  5KH7 A;  2VJF B;  1X4I A;  1N87 A;  2OXQ C;  4ZUX U;  5D1L B;  5D1M B;  2LGG A;  3KV6 A;  2CSY A;  2KYU A;  3L11 A;  2G43 A;  3RTR B;  2ECI A;  4W4U A;  1FP0 A;  2YQM A;  2KR4 A;  5TAB A;  3SOW A;  4R7E A;  1X4U A;  3C5K A;  5KH9 A;  2QJ0 A;  2QIZ A;  3NG2 A;  1IYM A;  3ZNI A;  4YBS A;  5DIN A;  1RMD A;  2JRJ A;  4I7D A;  3O7A A;  3MHH A;  2LRI C;  3ZYQ A;  5LKT A;  4LKA A;  4AUQ B;  1X4J A;  2M6M A;  4B7Y C;  5FB0 A;  4S3O B;  1BOR A;  3O34 A;  2VJE A;  4R2Y A;  5B75 A;  4A49 A;  1HYI A;  2MIQ A;  2MNZ A;  5G04 B;  3O70 A;  4XI1 A;  4I7C A;  3V43 A;  2YQL A;  4UP0 A;  3U5P A;  2L0B A;  4L58 A;  3N9P A;  2JMD A;  2EGP A;  2KE1 A;  5B76 A;  1JM7 A;  4MSX A;  2VPB A;  4WZ3 B;  2DX8 A;  4FK5 A;  2YRE A;  3SHB A;  2ECN A;  4V3K C;  2VJF A;  3RPG C;  3ZVY A;  4GNF A;  2KWO A;  3PUR A;  1FBV A;  2MA6 A;  3FL2 A;  4GB0 A;  4AYC B;  3SOU A;  2ECJ A;  2L75 A;  2YHN A;  3QZV A;  4N3W A;  2MD8 C;  4YBT A;  3ZPV E;  5LKZ A;  5DKA A;  4A0C D;  2L43 A;  2PUY A;  1V87 A;  4QF3 A;  2IDA A;  5G05 B;  5TBN A;  2ECG A;  5TRB A;  2ZET C;  4PPE A;  2ECT A;  5C13 A;  2K1J A;  4Q6F A;  2C2V S;  1JM7 B;  4V3L C;  2LDR A;  2LXP C;  4C9Z A;  5LKU A;  2H0D B;  5LCW B;  2ECV A;  2F6N A;  2KWK A;  5FEY A;  3O35 A;  3N9O A;  1WEO A;  4LK9 A;  2YSJ A;  4A4B A;  2HDP A;  1JOC A;  4MVT A;  4QF2 A;  3I2D A;  2VPE A;  1WEP A;  5C11 A;  2YHO A;  4BBQ A;  1XWH A;  2CT2 A;  2ECW A;  1G25 A;  3MHS A;  3M62 A;  4B86 C;  3ZTG A;  4AYC A;  3KV5 A;  2UZG A;  4I7B A;  3RPG B;  1WE9 A;  2K16 A;  2KGG A;  4GNE A;  2KU3 A;  2M1R A;  2RSD A;  5G0F A;  3O33 A;  2D8S A;  3L1Z B;  4LAD B;  3PHD A;  5LKX A;  2G45 A;  2XEU A;  4ZQL A;  1E4U A;  4CA1 A;  2MA5 A;  2LGK A;  5B77 A;  2YYR A;  4WZ0 A;  1CHC A;  2HYE D;  3LQI A;  4AVX A;  2YU4 A;  3M99 A;  2VPG A;  2H0D A;  5B79 A;  4UP5 A;  5KH3 A;  5TDW A;  2JMJ A;  1WEW A;  4CCG X;  5JG6 A;  1WEM A;  4YAT A;  3U5O A;  5H1U A;  3ZVZ B;  4UI9 B;  2LN0 A;  1WGM A;  4FIP A;  3EB5 A;  5FER A;  3HCT A;  3KNV A;  3LQH A;  2Y1M A;  4X3G A;  3IHP A;  2Y1N A;  2MT5 A;  4LJN A;  2KGI A;  5J3X A;  2E6S A;  4LLB A;  4R8P K;  4N4F A;  2EOD A;  3DQV R;  1Z2Q A;  2M85 A;  4FO9 A;  2K4D A;  1WEE A;  4BHW A;  5B8D A;  2F42 A;  5I3L A;  1WFK A;  4PTB A;  1WEN A;  3EB6 A;  2YT5 A;  2G6Q A;  1WES A;  1Z6U A;  4YC9 A;  1MM3 A;  4P5O B;  2KRE A;  3N9M A;  2YSM A;  2FSA A;  3M63 A;  4TKP B;  2YUR A;  5H9M A;  2I50 A;  3GV4 A;  4FJC A;  2M3H A;  4YAX A;  4YAB A;  4GNG A;  2JMI A;  2EA6 A;  2RI7 A;  2F6J A;  1WIL A;  1DVP A;  2C2L A;  1WEU A;  1VYX A;  3ASL A;  1WEQ A;  4IC3 A;  1F62 A;  3L1X A;  5FB1 A;  3C6W A;  3PUQ A;  5AIT A;  2FUU A;  3DPL R;  1K2F A;  2YUC A;  3LRQ A;  5EYA F;  4A4C A;  3T6R A;  1WEV A;  3O37 A;  2MUM A;  2CKL B;  2VPD A;  3N9N A;  5TDR A;  4IC2 A;  2KWJ A;  2KFT A;  4YAD A;  2LV9 A;  4F52 B;  2Y43 A;  1ZBD B;  3O36 A;  1WIM A;  3SOX A;  2LQ6 A;  3HCS A;  2VP7 A;  2CSZ A;  3HTK C;  1LDK C;  2QIC A;  5AIU A;  2VNF A;  2KWN A;  1HYJ A;  1T1H A; 
#chains in the Genus database with same CATH topology
 3U5N A;  4WZ2 A;  2KIZ A;  2L80 A;  2LXH C;  2BAY A;  2CSV A;  1DCQ A;  2LGV A;  4L7X A;  2K17 A;  1VFY A;  3LQJ A;  2LGL A;  3U5M A;  4S3O C;  3HCU A;  4ZDT A;  4NN2 A;  1LDJ B;  1VD4 A;  4O64 A;  5SVI A;  1Z60 A;  2XOC A;  3T7L A;  4F1P A;  4GND A;  2VJE B;  2DSM A;  3VK6 A;  2CKL A;  2MNY A;  2PNX A;  3ZPV 1;  5H1T A;  2MD7 B;  2XB1 A;  3GL6 A;  4OGE A;  5B78 A;  2AN6 A;  1U6G B;  4WA6 A;  2L5U A;  2XP0 A;  2YW8 A;  2FUI A;  3FM8 C;  4AP4 A;  5D1K B;  2CON A;  3KQI A;  3N9Q A;  4YBM A;  2NAA A;  5H1V A;  3N9L A;  2E6R A;  1MM2 A;  5KH7 A;  2VJF B;  1X4I A;  1N87 A;  3T9K A;  2OXQ C;  2RR4 A;  3DWD A;  3LJU X;  4ZUX U;  5D1L B;  5D1M B;  2LGG A;  3KV6 A;  2CSY A;  2KYU A;  3L11 A;  2G43 A;  3RTR B;  2ECI A;  4W4U A;  1FP0 A;  2YQM A;  2KR4 A;  5TAB A;  3SOW A;  4R7E A;  1X4U A;  3C5K A;  5KH9 A;  2QJ0 A;  2QIZ A;  3NG2 A;  1IYM A;  3ZNI A;  4YBS A;  5DIN A;  1RMD A;  2EGM A;  2JRJ A;  4I7D A;  3O7A A;  3MHH A;  2LRI C;  3SUB A;  3PLW A;  3ZYQ A;  4LKA A;  5LKT A;  2XOY A;  4AUQ B;  1X4J A;  2M6M A;  4B7Y C;  5FB0 A;  4S3O B;  1BOR A;  3O34 A;  2B0O E;  2VJE A;  4R2Y A;  5B75 A;  4A49 A;  1HYI A;  2MIQ A;  2MNZ A;  5G04 B;  3O70 A;  4XI1 A;  4I7C A;  4Z0R A;  3V43 A;  2YQL A;  4UP0 A;  3U5P A;  2M13 A;  2L0B A;  4L58 A;  3MDB C;  3N9P A;  2JMD A;  2EGP A;  2KE1 A;  5B76 A;  1JM7 A;  4MSX A;  2VPB A;  4WZ3 B;  2KKX A;  2DX8 A;  4FK5 A;  2YRE A;  3SHB A;  2ECN A;  4QQ4 A;  1MBM A;  4V3K C;  2VJF A;  3E2D A;  3RPG C;  3ZVY A;  4GNF A;  2KWO A;  3PUR A;  1FBV A;  2MA6 A;  3FL2 A;  2CRR A;  4GB0 A;  4AYC B;  3SOU A;  2ECJ A;  2OWA A;  2L75 A;  2YHN A;  3QZV A;  4N3W A;  2MD8 C;  4YBT A;  3ZPV E;  5LKZ A;  5DKA A;  4A0C D;  2L43 A;  2PUY A;  1V87 A;  4QF3 A;  2IDA A;  5G05 B;  5TBN A;  2ECG A;  5TRB A;  3FAO A;  2ZET C;  4PPE A;  2ECT A;  5SVY A;  5C13 A;  2K1J A;  2XOZ A;  4Q6F A;  2C2V S;  1JM7 B;  4V3L C;  2LDR A;  2LXP C;  3FEH A;  4C9Z A;  5LKU A;  2H0D B;  5LCW B;  2ECV A;  2F6N A;  2KWK A;  5FEY A;  3O35 A;  3N9O A;  1WEO A;  4LK9 A;  2YSJ A;  4A4B A;  2HDP A;  1JOC A;  4MVT A;  4QF2 A;  3I2D A;  2VPE A;  1WEP A;  5C11 A;  2YHO A;  4BBQ A;  1XWH A;  2CT2 A;  2ECW A;  1G25 A;  3MHS A;  2DJA A;  3M62 A;  2EXU A;  4B86 C;  3ZTG A;  4AYC A;  3KV5 A;  2UZG A;  3FJU B;  2P57 A;  4I7B A;  3RPG B;  1WE9 A;  2K16 A;  2KGG A;  4GNE A;  3KDE C;  2KU3 A;  2M1R A;  2RSD A;  3DDT A;  3O33 A;  5G0F A;  2D8S A;  3L1Z B;  4LAD B;  3PHD A;  5LKX A;  3FAN A;  2KKY A;  2G45 A;  2JM3 A;  2XEU A;  4ZQL A;  1E4U A;  4CA1 A;  2MA5 A;  3Q1D A;  2LGK A;  5B77 A;  2YYR A;  4WZ0 A;  1CHC A;  2HYE D;  3LQI A;  4AVX A;  2YU4 A;  3M99 A;  2VPG A;  2H0D A;  5B79 A;  5SVX A;  2L7P A;  4UP5 A;  3M7K A;  5KH3 A;  5TDW A;  2JMJ A;  1WEW A;  4CCG X;  5JG6 A;  1WEM A;  4YAT A;  2FD4 A;  3U5O A;  3JUE A;  5H1U A;  3ZVZ B;  4UI9 B;  2LN0 A;  1WGM A;  4FIP A;  3EB5 A;  5FER A;  3HCT A;  3H7H A;  3KNV A;  3LQH A;  2Y1M A;  4X3G A;  3IHP A;  2Y1N A;  2MT5 A;  4LJN A;  2KGI A;  5J3X A;  2E6S A;  4LLB A;  4R8P K;  2YVR A;  4Z0O A;  4N4F A;  2EOD A;  3DQV R;  1Z2Q A;  2M85 A;  4FO9 A;  2K4D A;  1WEE A;  4BHW A;  5B8D A;  2F42 A;  5I3L A;  1WFK A;  4PTB A;  1WEN A;  3EB6 A;  2YT5 A;  3O47 A;  2G6Q A;  1WES A;  1Z6U A;  4YC9 A;  1MM3 A;  4P5O B;  2KRE A;  3N9M A;  2YSM A;  2FSA A;  3M63 A;  4TKP B;  2YUR A;  5H9M A;  2I50 A;  3GV4 A;  4FJC A;  2M3H A;  4YAX A;  4YAB A;  4GNG A;  2MKE A;  2JMI A;  2EA6 A;  3LVQ E;  2RI7 A;  2F6J A;  2LAU A;  1WIL A;  1DVP A;  2C2L A;  2IQJ A;  1WEU A;  1VYX A;  3ASL A;  1WEQ A;  4IC3 A;  3LVR E;  1F62 A;  3L1X A;  5FB1 A;  3C6W A;  2CRW A;  2D8U A;  3PUQ A;  5AIT A;  2FUU A;  3DPL R;  1K2F A;  5SVI B;  2YUC A;  3LRQ A;  5EYA F;  4A4C A;  3T6R A;  1WEV A;  3O37 A;  2MUM A;  2CKL B;  2VPD A;  3N9N A;  5TDR A;  3LDY A;  4IC2 A;  2KWJ A;  5K3Q A;  2KFT A;  4YAD A;  2LV9 A;  4F52 B;  2Y43 A;  1ZBD B;  3O36 A;  4H9D A;  1WIM A;  3SOX A;  2LQ6 A;  2JUN A;  4O62 A;  3HCS A;  2VP7 A;  2CSZ A;  3HTK C;  1LDK C;  2E61 A;  2QIC A;  5AIU A;  2VNF A;  4OGC A;  2KWN A;  1HYJ A;  2FFW A;  1T1H A; 
#chains in the Genus database with same CATH homology
 3U5N A;  4WZ2 A;  2KIZ A;  2L80 A;  2LXH C;  2BAY A;  2LGV A;  4L7X A;  2K17 A;  1VFY A;  3LQJ A;  2LGL A;  3U5M A;  4S3O C;  3HCU A;  4ZDT A;  4NN2 A;  1LDJ B;  1VD4 A;  4O64 A;  1Z60 A;  3T7L A;  4GND A;  2VJE B;  3VK6 A;  2CKL A;  2MNY A;  2PNX A;  3ZPV 1;  5H1T A;  2MD7 B;  2XB1 A;  3GL6 A;  5B78 A;  2AN6 A;  1U6G B;  4WA6 A;  2L5U A;  2YW8 A;  2FUI A;  4AP4 A;  5D1K B;  3KQI A;  3N9Q A;  4YBM A;  2NAA A;  5H1V A;  3N9L A;  2E6R A;  1MM2 A;  5KH7 A;  2VJF B;  1X4I A;  1N87 A;  2OXQ C;  4ZUX U;  5D1L B;  5D1M B;  2LGG A;  3KV6 A;  2CSY A;  2KYU A;  3L11 A;  2G43 A;  3RTR B;  2ECI A;  4W4U A;  1FP0 A;  2YQM A;  2KR4 A;  5TAB A;  3SOW A;  4R7E A;  1X4U A;  3C5K A;  5KH9 A;  2QJ0 A;  2QIZ A;  3NG2 A;  1IYM A;  3ZNI A;  4YBS A;  5DIN A;  1RMD A;  2JRJ A;  4I7D A;  3O7A A;  3MHH A;  2LRI C;  3ZYQ A;  5LKT A;  4LKA A;  4AUQ B;  1X4J A;  2M6M A;  4B7Y C;  5FB0 A;  4S3O B;  1BOR A;  3O34 A;  2VJE A;  4R2Y A;  5B75 A;  4A49 A;  1HYI A;  2MIQ A;  2MNZ A;  5G04 B;  3O70 A;  4XI1 A;  4I7C A;  3V43 A;  2YQL A;  4UP0 A;  3U5P A;  2L0B A;  4L58 A;  3N9P A;  2JMD A;  2EGP A;  2KE1 A;  5B76 A;  1JM7 A;  4MSX A;  2VPB A;  4WZ3 B;  2DX8 A;  4FK5 A;  2YRE A;  3SHB A;  2ECN A;  4V3K C;  2VJF A;  3RPG C;  3ZVY A;  4GNF A;  2KWO A;  3PUR A;  1FBV A;  2MA6 A;  3FL2 A;  4GB0 A;  4AYC B;  3SOU A;  2ECJ A;  2L75 A;  2YHN A;  3QZV A;  4N3W A;  2MD8 C;  4YBT A;  3ZPV E;  5LKZ A;  5DKA A;  4A0C D;  2L43 A;  2PUY A;  1V87 A;  4QF3 A;  2IDA A;  5G05 B;  5TBN A;  2ECG A;  5TRB A;  2ZET C;  4PPE A;  2ECT A;  5C13 A;  2K1J A;  4Q6F A;  2C2V S;  1JM7 B;  4V3L C;  2LDR A;  2LXP C;  4C9Z A;  5LKU A;  2H0D B;  5LCW B;  2ECV A;  2F6N A;  2KWK A;  5FEY A;  3O35 A;  3N9O A;  1WEO A;  4LK9 A;  2YSJ A;  4A4B A;  2HDP A;  1JOC A;  4MVT A;  4QF2 A;  3I2D A;  2VPE A;  1WEP A;  5C11 A;  2YHO A;  4BBQ A;  1XWH A;  2CT2 A;  2ECW A;  1G25 A;  3MHS A;  3M62 A;  4B86 C;  3ZTG A;  4AYC A;  3KV5 A;  2UZG A;  4I7B A;  3RPG B;  1WE9 A;  2K16 A;  2KGG A;  4GNE A;  2KU3 A;  2M1R A;  2RSD A;  5G0F A;  3O33 A;  2D8S A;  3L1Z B;  4LAD B;  3PHD A;  5LKX A;  2G45 A;  2XEU A;  4ZQL A;  1E4U A;  4CA1 A;  2MA5 A;  2LGK A;  5B77 A;  2YYR A;  4WZ0 A;  1CHC A;  2HYE D;  3LQI A;  4AVX A;  2YU4 A;  3M99 A;  2VPG A;  2H0D A;  5B79 A;  4UP5 A;  5KH3 A;  5TDW A;  2JMJ A;  1WEW A;  4CCG X;  5JG6 A;  1WEM A;  4YAT A;  3U5O A;  5H1U A;  3ZVZ B;  4UI9 B;  2LN0 A;  1WGM A;  4FIP A;  3EB5 A;  5FER A;  3HCT A;  3KNV A;  3LQH A;  2Y1M A;  4X3G A;  3IHP A;  2Y1N A;  2MT5 A;  4LJN A;  2KGI A;  5J3X A;  2E6S A;  4LLB A;  4R8P K;  4N4F A;  2EOD A;  3DQV R;  1Z2Q A;  2M85 A;  4FO9 A;  2K4D A;  1WEE A;  4BHW A;  5B8D A;  2F42 A;  5I3L A;  1WFK A;  4PTB A;  1WEN A;  3EB6 A;  2YT5 A;  2G6Q A;  1WES A;  1Z6U A;  4YC9 A;  1MM3 A;  4P5O B;  2KRE A;  3N9M A;  2YSM A;  2FSA A;  3M63 A;  4TKP B;  2YUR A;  5H9M A;  2I50 A;  3GV4 A;  4FJC A;  2M3H A;  4YAX A;  4YAB A;  4GNG A;  2JMI A;  2EA6 A;  2RI7 A;  2F6J A;  1WIL A;  1DVP A;  2C2L A;  1WEU A;  1VYX A;  3ASL A;  1WEQ A;  4IC3 A;  1F62 A;  3L1X A;  5FB1 A;  3C6W A;  3PUQ A;  5AIT A;  2FUU A;  3DPL R;  1K2F A;  2YUC A;  3LRQ A;  5EYA F;  4A4C A;  3T6R A;  1WEV A;  3O37 A;  2MUM A;  2CKL B;  2VPD A;  3N9N A;  5TDR A;  4IC2 A;  2KWJ A;  2KFT A;  4YAD A;  2LV9 A;  4F52 B;  2Y43 A;  1ZBD B;  3O36 A;  1WIM A;  3SOX A;  2LQ6 A;  3HCS A;  2VP7 A;  2CSZ A;  3HTK C;  1LDK C;  2QIC A;  5AIU A;  2VNF A;  2KWN A;  1HYJ A;  1T1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...