4CCGX

Structure of an e2-e3 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
b'EKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 T
publication title Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 10
structure length 75
sequence length 75
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11793 FANCL_C FANCL C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ccgX00
2HDPA 5LKTA 1LDJB 2XEUA 1WEEA 4WZ3B 2Y43A 3C5KA 1X4JA 4QF2A 4YATA 3ZVZB 1VD4A 2KIZA 2M1RA 2M3HA 3N9NA 3PUQA 2IDAA 1X4IA 4W4UA 2LGKA 2LV9A 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 2RI7A 2VPGA 3NG2A 2JMDA 3LRQA 2MIQA 3LQJA 1RMDA 4V3KC 3DQVR 2LDRA 2OXQC 3ZVYA 2KWNA 3SHBA 1G25A 2XB1A 5C11A 2YW8A 3KNVA 2F6JA 3M99A 2VJFA 3O35A 4NN2A 2YUCA 1E4UA 4FO9A 3O36A 4I7CA 5FEYA 2MD7B 4V3LC 2K16A 2LGGA 2LXPC 2ECIA 2KWKA 1JOCA 5LKUA 4FJCA 1WEOA 4A4BA 3ZTGA 4AP4A 4BHWA 3SOWA 2G43A 4CA1A 3M63A 3HTKC 2KGGA 2E6SA 2BAYA 5B75A 2E6RA 2KGIA 1CHCA 4A49A 1WEVA 2MA5A 2MD8C 4BBQA 2KWJA 1VFYA 4TKPB 5G05B 3ZPVE 2YHNA 2YT5A 3V43A 4LLBA 2LQ6A 1HYJA 3ZYQA 4YBMA 2KWOA 2ECNA 1Z2QA 4UI9B 3O70A 4LJNA 2YREA 3RPGB 1XWHA 2K17A 4ZQLA 5KH9A 2H0DB 4N3WA 2MNZA 3KV6A 5TDWA 1JM7B 4GNEA 3T6RA 3U5NA 5B76A 3O34A 4YABA 5FERA 3L11A 4GB0A 4MVTA 2VJEB 1FP0A 4LKAA 4F52B 3T7LA 2G6QA 3PURA 5DKAA 1WIMA 1WFKA 5FB0A 5B77A 2ECTA 2MT5A 4YADA 4YC9A 5EYAF 2FSAA 2YQMA 3PHDA 2H0DA 4IC2A 1WEUA 2CSYA 2LGVA 3RTRB 1DVPA 2YU4A 3U5MA 2G45A 3ZPV1 2L5UA 2CSZA 1IYMA 2KFTA 2JMIA 2RSDA 4A0CD 3N9QA 4I7BA 2MA6A 3M62A 3MHHA 5B78A 2ECVA 4S3OB 4XI1A 3L1XA 1V87A 2UZGA 2CT2A 2EA6A 3GV4A 4AUQB 3U5OA 2YYRA 4GNDA 2K1JA 2L80A 5TABA 2M6MA 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 4GNGA 3O37A 5D1LB 5JG6A 2Y1MA 5D1KB 1X4UA 1WENA 5TDRA 2LGLA 4Q6FA 4WZ0A 1VYXA 1F62A 2KR4A 1K2FA 2LXHC 4UP5A 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4PTBA 2C2LA 2NAAA 3ASLA 1LDKC 3QZVA 5FB1A 2JRJA 4I7DA 4LADB 5AIUA 4YAXA 5LCWB 1WEWA 2LN0A 4L7XA 3N9PA 4MSXA 2L43A 3HCUA 5C13A 2MNYA 4WA6A 2F42A 5LKZA 2PUYA 3O33A 1BORA 3ZNIA 2ECWA 4B86C 2D8SA 2KYUA 2DX8A 2VPBA 4UP0A 5I3LA 1Z60A 2KREA 1WEQA 4GNFA 5KH3A 2YURA 3IHPA 4FIPA 1WILA 2YQLA 3SOXA 2VPEA 2M85A 2ECGA 3DPLR 5KH7A 1JM7A 1WE9A 4S3OC 2AN6A 4N4FA 1ZBDB 4WZ2A 1FBVA 4ZUXU 4LK9A 4AYCB 2VJEA 5D1MB 2KE1A 3HCSA 3LQIA 4O64A 3KV5A 4YBSA 5B79A 3N9OA 1WEMA 2C2VS 2EODA 2QJ0A 2QIZA 1N87A 1WEPA 1U6GB 5G04B 2Y1NA 4QF3A 3O7AA 4C9ZA 3EB5A 2QICA 4FK5A 2L0BA 1MM3A 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 4X3GA 2PNXA 4AYCA 3N9LA 2VPDA 4YBTA 2YSMA 4P5OB 5G0FA 1WESA 3EB6A 4PPEA 3GL6A 2CKLB 2VP7A 2KU3A 2ZETC 5H1TA 3RPGC 3C6WA 5AITA 1T1HA 5H1UA 2EGPA 5TRBA 4B7YC 3U5PA 2F6NA 2HYED 2FUUA 3L1ZB 4IC3A 2L75A 5H1VA 5TBNA 2YSJA 5B8DA 3MHSA 1Z6UA 4R8PK 2ECJA 3I2DA 5LKXA 2CKLA 5DINA 5H9MA 4R7EA 4AVXA
chains in the Genus database with same CATH superfamily
2DJAA 2HDPA 4Z0OA 5LKTA 3MDBC 1LDJB 2XEUA 1WEEA 4WZ3B 2Y43A 3C5KA 1X4JA 4QF2A 4YATA 3T9KA 3ZVZB 4OGCA 1VD4A 2KIZA 2M1RA 2M3HA 2OWAA 3N9NA 2IDAA 1X4IA 3PUQA 4W4UA 2LGKA 2LV9A 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 2RI7A 2VPGA 3NG2A 2JMDA 3LRQA 2MIQA 3LQJA 1RMDA 4V3KC 3DQVR 2LDRA 2OXQC 3LJUX 3ZVYA 5K3QA 2KWNA 3SHBA 1G25A 2XB1A 5C11A 2YW8A 3KNVA 2F6JA 3M99A 2VJFA 3E2DA 3O35A 4NN2A 2FD4A 2YUCA 1E4UA 4FO9A 3O36A 4I7CA 3FAOA 5FEYA 2MD7B 4V3LC 2XP0A 2K16A 2LGGA 4Z0RA 2LXPC 2ECIA 2KWKA 2P57A 1JOCA 5LKUA 4FJCA 1WEOA 2CSVA 5SVIB 4A4BA 2CRRA 3ZTGA 4AP4A 3PLWA 4BHWA 2B0OE 3SOWA 2G43A 2EXUA 4CA1A 3M63A 3HTKC 3LVQE 2KGGA 2DSMA 2E6SA 2BAYA 3O47A 3H7HA 5B75A 2E6RA 4OGEA 2KGIA 1CHCA 4A49A 1WEVA 2MA5A 3SUBA 2MD8C 4BBQA 3M7KA 4O62A 2KWJA 3Q1DA 1VFYA 4TKPB 5G05B 3ZPVE 3FEHA 5SVIA 2YHNA 2YT5A 3V43A 4LLBA 2LQ6A 1HYJA 3ZYQA 4YBMA 2KWOA 2ECNA 1Z2QA 4UI9B 3O70A 4LJNA 2YREA 3RPGB 1XWHA 2K17A 4ZQLA 5KH9A 2CONA 2H0DB 2XOZA 4N3WA 2MNZA 3KV6A 5TDWA 1MBMA 1JM7B 4GNEA 3T6RA 3U5NA 5B76A 3O34A 4YABA 5FERA 3L11A 4GB0A 4MVTA 2VJEB 1FP0A 4LKAA 4F52B 3T7LA 3DDTA 2G6QA 3PURA 5DKAA 1WIMA 1WFKA 5FB0A 5B77A 2ECTA 2MT5A 4YADA 4YC9A 5EYAF 2FSAA 2YQMA 3PHDA 2H0DA 4IC2A 1WEUA 2CSYA 2LGVA 3RTRB 1DVPA 2YU4A 3U5MA 4F1PA 2G45A 3ZPV1 2L5UA 2CSZA 1IYMA 2KFTA 2JMIA 2RSDA 4A0CD 1DCQA 3N9QA 4I7BA 2MA6A 3M62A 3MHHA 5B78A 2ECVA 4S3OB 4XI1A 3L1XA 2XOYA 1V87A 2UZGA 2CT2A 2EA6A 3GV4A 4AUQB 3U5OA 2YYRA 4GNDA 2K1JA 2L80A 5TABA 2M6MA 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 4GNGA 3O37A 5D1LB 3JUEA 5JG6A 2Y1MA 5D1KB 3DWDA 1X4UA 1WENA 2LAUA 5TDRA 2LGLA 4Q6FA 4WZ0A 1VYXA 1F62A 2KR4A 1K2FA 2LXHC 2JM3A 4UP5A 3FJUB 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4PTBA 2C2LA 2NAAA 3ASLA 1LDKC 3QZVA 2JRJA 4I7DA 5FB1A 4LADB 5AIUA 4YAXA 5LCWB 1WEWA 2LN0A 2D8UA 4L7XA 3N9PA 4MSXA 2L43A 3HCUA 5C13A 2MNYA 4WA6A 2F42A 2CRWA 5LKZA 2PUYA 3O33A 1BORA 2M13A 3ZNIA 2ECWA 4B86C 2D8SA 2KYUA 2DX8A 2VPBA 4UP0A 5I3LA 1Z60A 2KREA 1WEQA 4GNFA 2FFWA 5KH3A 2YURA 3IHPA 4FIPA 2L7PA 1WILA 2YQLA 3SOXA 2RR4A 2IQJA 2VPEA 2M85A 2ECGA 3DPLR 5KH7A 1JM7A 1WE9A 4S3OC 2AN6A 4N4FA 1ZBDB 4WZ2A 3FANA 1FBVA 2KKXA 4ZUXU 4LK9A 4AYCB 3LDYA 2VJEA 5D1MB 2KE1A 3HCSA 3LQIA 4O64A 3KV5A 4YBSA 5B79A 3N9OA 1WEMA 2C2VS 2EODA 5SVXA 2QJ0A 2QIZA 2YVRA 1N87A 4QQ4A 1WEPA 1U6GB 5G04B 2Y1NA 4QF3A 2XOCA 3O7AA 4C9ZA 3EB5A 2QICA 4FK5A 2L0BA 1MM3A 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 4X3GA 2PNXA 4AYCA 3N9LA 2VPDA 4YBTA 2YSMA 4P5OB 5G0FA 1WESA 3EB6A 4PPEA 3GL6A 2CKLB 2VP7A 2KU3A 2ZETC 4H9DA 5H1TA 3RPGC 3C6WA 5AITA 2KKYA 1T1HA 5H1UA 2EGMA 2EGPA 5TRBA 4B7YC 3U5PA 2F6NA 2HYED 2FUUA 3L1ZB 2E61A 2MKEA 3KDEC 5SVYA 4IC3A 2L75A 5H1VA 5TBNA 2YSJA 5B8DA 3MHSA 1Z6UA 4R8PK 2ECJA 3I2DA 5LKXA 2CKLA 5DINA 2JUNA 3LVRE 5H9MA 3FM8C 4R7EA 4AVXA
chains in the Genus database with same CATH topology
2HDPA 5LKTA 1LDJB 2XEUA 1WEEA 4WZ3B 2Y43A 3C5KA 1X4JA 4QF2A 4YATA 3ZVZB 1VD4A 2KIZA 2M1RA 2M3HA 3N9NA 3PUQA 2IDAA 1X4IA 4W4UA 2LGKA 2LV9A 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 2RI7A 2VPGA 3NG2A 2JMDA 3LRQA 2MIQA 3LQJA 1RMDA 4V3KC 3DQVR 2LDRA 2OXQC 3ZVYA 2KWNA 3SHBA 1G25A 2XB1A 5C11A 2YW8A 3KNVA 2F6JA 3M99A 2VJFA 3O35A 4NN2A 2YUCA 1E4UA 4FO9A 3O36A 4I7CA 5FEYA 2MD7B 4V3LC 2K16A 2LGGA 2LXPC 2ECIA 2KWKA 1JOCA 5LKUA 4FJCA 1WEOA 4A4BA 3ZTGA 4AP4A 4BHWA 3SOWA 2G43A 4CA1A 3M63A 3HTKC 2KGGA 2E6SA 2BAYA 5B75A 2E6RA 2KGIA 1CHCA 4A49A 1WEVA 2MA5A 2MD8C 4BBQA 2KWJA 1VFYA 4TKPB 5G05B 3ZPVE 2YHNA 2YT5A 3V43A 4LLBA 2LQ6A 1HYJA 3ZYQA 4YBMA 2KWOA 2ECNA 1Z2QA 4UI9B 3O70A 4LJNA 2YREA 3RPGB 1XWHA 2K17A 4ZQLA 5KH9A 2H0DB 4N3WA 2MNZA 3KV6A 5TDWA 1JM7B 4GNEA 3T6RA 3U5NA 5B76A 3O34A 4YABA 5FERA 3L11A 4GB0A 4MVTA 2VJEB 1FP0A 4LKAA 4F52B 3T7LA 2G6QA 3PURA 5DKAA 1WIMA 1WFKA 5FB0A 5B77A 2ECTA 2MT5A 4YADA 4YC9A 5EYAF 2FSAA 2YQMA 3PHDA 2H0DA 4IC2A 1WEUA 2CSYA 2LGVA 3RTRB 1DVPA 2YU4A 3U5MA 2G45A 3ZPV1 2L5UA 2CSZA 1IYMA 2KFTA 2JMIA 2RSDA 4A0CD 3N9QA 4I7BA 2MA6A 3M62A 3MHHA 5B78A 2ECVA 4S3OB 4XI1A 3L1XA 1V87A 2UZGA 2CT2A 2EA6A 3GV4A 4AUQB 3U5OA 2YYRA 4GNDA 2K1JA 2L80A 5TABA 2M6MA 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 4GNGA 3O37A 5D1LB 5JG6A 2Y1MA 5D1KB 1X4UA 1WENA 5TDRA 2LGLA 4Q6FA 4WZ0A 1VYXA 1F62A 2KR4A 1K2FA 2LXHC 4UP5A 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4PTBA 2C2LA 2NAAA 3ASLA 1LDKC 3QZVA 5FB1A 2JRJA 4I7DA 4LADB 5AIUA 4YAXA 5LCWB 1WEWA 2LN0A 4L7XA 3N9PA 4MSXA 2L43A 3HCUA 5C13A 2MNYA 4WA6A 2F42A 5LKZA 2PUYA 3O33A 1BORA 3ZNIA 2ECWA 4B86C 2D8SA 2KYUA 2DX8A 2VPBA 4UP0A 5I3LA 1Z60A 2KREA 1WEQA 4GNFA 5KH3A 2YURA 3IHPA 4FIPA 1WILA 2YQLA 3SOXA 2VPEA 2M85A 2ECGA 3DPLR 5KH7A 1JM7A 1WE9A 4S3OC 2AN6A 4N4FA 1ZBDB 4WZ2A 1FBVA 4ZUXU 4LK9A 4AYCB 2VJEA 5D1MB 2KE1A 3HCSA 3LQIA 4O64A 3KV5A 4YBSA 5B79A 3N9OA 1WEMA 2C2VS 2EODA 2QJ0A 2QIZA 1N87A 1WEPA 1U6GB 5G04B 2Y1NA 4QF3A 3O7AA 4C9ZA 3EB5A 2QICA 4FK5A 2L0BA 1MM3A 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 4X3GA 2PNXA 4AYCA 3N9LA 2VPDA 4YBTA 2YSMA 4P5OB 5G0FA 1WESA 3EB6A 4PPEA 3GL6A 2CKLB 2VP7A 2KU3A 2ZETC 5H1TA 3RPGC 3C6WA 5AITA 1T1HA 5H1UA 2EGPA 5TRBA 4B7YC 3U5PA 2F6NA 2HYED 2FUUA 3L1ZB 4IC3A 2L75A 5H1VA 5TBNA 2YSJA 5B8DA 3MHSA 1Z6UA 4R8PK 2ECJA 3I2DA 5LKXA 2CKLA 5DINA 5H9MA 4R7EA 4AVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  5LKT A;  1LDJ B;  2XEU A;  1WEE A;  4WZ3 B;  2Y43 A;  3C5K A;  1X4J A;  4QF2 A;  4YAT A;  3ZVZ B;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  3N9N A;  3PUQ A;  2IDA A;  1X4I A;  4W4U A;  2LGK A;  2LV9 A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  2RI7 A;  2VPG A;  3NG2 A;  2JMD A;  3LRQ A;  2MIQ A;  3LQJ A;  1RMD A;  4V3K C;  3DQV R;  2LDR A;  2OXQ C;  3ZVY A;  2KWN A;  3SHB A;  1G25 A;  2XB1 A;  5C11 A;  2YW8 A;  3KNV A;  2F6J A;  3M99 A;  2VJF A;  3O35 A;  4NN2 A;  2YUC A;  1E4U A;  4FO9 A;  3O36 A;  4I7C A;  5FEY A;  2MD7 B;  4V3L C;  2K16 A;  2LGG A;  2LXP C;  2ECI A;  2KWK A;  1JOC A;  5LKU A;  4FJC A;  1WEO A;  4A4B A;  3ZTG A;  4AP4 A;  4BHW A;  3SOW A;  2G43 A;  4CA1 A;  3M63 A;  3HTK C;  2KGG A;  2E6S A;  2BAY A;  5B75 A;  2E6R A;  2KGI A;  1CHC A;  4A49 A;  1WEV A;  2MA5 A;  2MD8 C;  4BBQ A;  2KWJ A;  1VFY A;  4TKP B;  5G05 B;  3ZPV E;  2YHN A;  2YT5 A;  3V43 A;  4LLB A;  2LQ6 A;  1HYJ A;  3ZYQ A;  4YBM A;  2KWO A;  2ECN A;  1Z2Q A;  4UI9 B;  3O70 A;  4LJN A;  2YRE A;  3RPG B;  1XWH A;  2K17 A;  4ZQL A;  5KH9 A;  2H0D B;  4N3W A;  2MNZ A;  3KV6 A;  5TDW A;  1JM7 B;  4GNE A;  3T6R A;  3U5N A;  5B76 A;  3O34 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  4MVT A;  2VJE B;  1FP0 A;  4LKA A;  4F52 B;  3T7L A;  2G6Q A;  3PUR A;  5DKA A;  1WIM A;  1WFK A;  5FB0 A;  5B77 A;  2ECT A;  2MT5 A;  4YAD A;  4YC9 A;  5EYA F;  2FSA A;  2YQM A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  2CSY A;  2LGV A;  3RTR B;  1DVP A;  2YU4 A;  3U5M A;  2G45 A;  3ZPV 1;  2L5U A;  2CSZ A;  1IYM A;  2KFT A;  2JMI A;  2RSD A;  4A0C D;  3N9Q A;  4I7B A;  2MA6 A;  3M62 A;  3MHH A;  5B78 A;  2ECV A;  4S3O B;  4XI1 A;  3L1X A;  1V87 A;  2UZG A;  2CT2 A;  2EA6 A;  3GV4 A;  4AUQ B;  3U5O A;  2YYR A;  4GND A;  2K1J A;  2L80 A;  5TAB A;  2M6M A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  4GNG A;  3O37 A;  5D1L B;  5JG6 A;  2Y1M A;  5D1K B;  1X4U A;  1WEN A;  5TDR A;  2LGL A;  4Q6F A;  4WZ0 A;  1VYX A;  1F62 A;  2KR4 A;  1K2F A;  2LXH C;  4UP5 A;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4PTB A;  2C2L A;  2NAA A;  3ASL A;  1LDK C;  3QZV A;  5FB1 A;  2JRJ A;  4I7D A;  4LAD B;  5AIU A;  4YAX A;  5LCW B;  1WEW A;  2LN0 A;  4L7X A;  3N9P A;  4MSX A;  2L43 A;  3HCU A;  5C13 A;  2MNY A;  4WA6 A;  2F42 A;  5LKZ A;  2PUY A;  3O33 A;  1BOR A;  3ZNI A;  2ECW A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  2VPB A;  4UP0 A;  5I3L A;  1Z60 A;  2KRE A;  1WEQ A;  4GNF A;  5KH3 A;  2YUR A;  3IHP A;  4FIP A;  1WIL A;  2YQL A;  3SOX A;  2VPE A;  2M85 A;  2ECG A;  3DPL R;  5KH7 A;  1JM7 A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  1ZBD B;  4WZ2 A;  1FBV A;  4ZUX U;  4LK9 A;  4AYC B;  2VJE A;  5D1M B;  2KE1 A;  3HCS A;  3LQI A;  4O64 A;  3KV5 A;  4YBS A;  5B79 A;  3N9O A;  1WEM A;  2C2V S;  2EOD A;  2QJ0 A;  2QIZ A;  1N87 A;  1WEP A;  1U6G B;  5G04 B;  2Y1N A;  4QF3 A;  3O7A A;  4C9Z A;  3EB5 A;  2QIC A;  4FK5 A;  2L0B A;  1MM3 A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  4X3G A;  2PNX A;  4AYC A;  3N9L A;  2VPD A;  4YBT A;  2YSM A;  4P5O B;  5G0F A;  1WES A;  3EB6 A;  4PPE A;  3GL6 A;  2CKL B;  2VP7 A;  2KU3 A;  2ZET C;  5H1T A;  3RPG C;  3C6W A;  5AIT A;  1T1H A;  5H1U A;  2EGP A;  5TRB A;  4B7Y C;  3U5P A;  2F6N A;  2HYE D;  2FUU A;  3L1Z B;  4IC3 A;  2L75 A;  5H1V A;  5TBN A;  2YSJ A;  5B8D A;  3MHS A;  1Z6U A;  4R8P K;  2ECJ A;  3I2D A;  5LKX A;  2CKL A;  5DIN A;  5H9M A;  4R7E A;  4AVX A; 
#chains in the Genus database with same CATH topology
 2DJA A;  2HDP A;  4Z0O A;  5LKT A;  3MDB C;  1LDJ B;  2XEU A;  1WEE A;  4WZ3 B;  2Y43 A;  3C5K A;  1X4J A;  4QF2 A;  4YAT A;  3T9K A;  3ZVZ B;  4OGC A;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  2OWA A;  3N9N A;  2IDA A;  1X4I A;  3PUQ A;  4W4U A;  2LGK A;  2LV9 A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  2RI7 A;  2VPG A;  3NG2 A;  2JMD A;  3LRQ A;  2MIQ A;  3LQJ A;  1RMD A;  4V3K C;  3DQV R;  2LDR A;  2OXQ C;  3LJU X;  3ZVY A;  5K3Q A;  2KWN A;  3SHB A;  1G25 A;  2XB1 A;  5C11 A;  2YW8 A;  3KNV A;  2F6J A;  3M99 A;  2VJF A;  3E2D A;  3O35 A;  4NN2 A;  2FD4 A;  2YUC A;  1E4U A;  4FO9 A;  3O36 A;  4I7C A;  3FAO A;  5FEY A;  2MD7 B;  4V3L C;  2XP0 A;  2K16 A;  2LGG A;  4Z0R A;  2LXP C;  2ECI A;  2KWK A;  2P57 A;  1JOC A;  5LKU A;  4FJC A;  1WEO A;  2CSV A;  5SVI B;  4A4B A;  2CRR A;  3ZTG A;  4AP4 A;  3PLW A;  4BHW A;  2B0O E;  3SOW A;  2G43 A;  2EXU A;  4CA1 A;  3M63 A;  3HTK C;  3LVQ E;  2KGG A;  2DSM A;  2E6S A;  2BAY A;  3O47 A;  3H7H A;  5B75 A;  2E6R A;  4OGE A;  2KGI A;  1CHC A;  4A49 A;  1WEV A;  2MA5 A;  3SUB A;  2MD8 C;  4BBQ A;  3M7K A;  4O62 A;  2KWJ A;  3Q1D A;  1VFY A;  4TKP B;  5G05 B;  3ZPV E;  3FEH A;  5SVI A;  2YHN A;  2YT5 A;  3V43 A;  4LLB A;  2LQ6 A;  1HYJ A;  3ZYQ A;  4YBM A;  2KWO A;  2ECN A;  1Z2Q A;  4UI9 B;  3O70 A;  4LJN A;  2YRE A;  3RPG B;  1XWH A;  2K17 A;  4ZQL A;  5KH9 A;  2CON A;  2H0D B;  2XOZ A;  4N3W A;  2MNZ A;  3KV6 A;  5TDW A;  1MBM A;  1JM7 B;  4GNE A;  3T6R A;  3U5N A;  5B76 A;  3O34 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  4MVT A;  2VJE B;  1FP0 A;  4LKA A;  4F52 B;  3T7L A;  3DDT A;  2G6Q A;  3PUR A;  5DKA A;  1WIM A;  1WFK A;  5FB0 A;  5B77 A;  2ECT A;  2MT5 A;  4YAD A;  4YC9 A;  5EYA F;  2FSA A;  2YQM A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  2CSY A;  2LGV A;  3RTR B;  1DVP A;  2YU4 A;  3U5M A;  4F1P A;  2G45 A;  3ZPV 1;  2L5U A;  2CSZ A;  1IYM A;  2KFT A;  2JMI A;  2RSD A;  4A0C D;  1DCQ A;  3N9Q A;  4I7B A;  2MA6 A;  3M62 A;  3MHH A;  5B78 A;  2ECV A;  4S3O B;  4XI1 A;  3L1X A;  2XOY A;  1V87 A;  2UZG A;  2CT2 A;  2EA6 A;  3GV4 A;  4AUQ B;  3U5O A;  2YYR A;  4GND A;  2K1J A;  2L80 A;  5TAB A;  2M6M A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  4GNG A;  3O37 A;  5D1L B;  3JUE A;  5JG6 A;  2Y1M A;  5D1K B;  3DWD A;  1X4U A;  1WEN A;  2LAU A;  5TDR A;  2LGL A;  4Q6F A;  4WZ0 A;  1VYX A;  1F62 A;  2KR4 A;  1K2F A;  2LXH C;  2JM3 A;  4UP5 A;  3FJU B;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4PTB A;  2C2L A;  2NAA A;  3ASL A;  1LDK C;  3QZV A;  2JRJ A;  4I7D A;  5FB1 A;  4LAD B;  5AIU A;  4YAX A;  5LCW B;  1WEW A;  2LN0 A;  2D8U A;  4L7X A;  3N9P A;  4MSX A;  2L43 A;  3HCU A;  5C13 A;  2MNY A;  4WA6 A;  2F42 A;  2CRW A;  5LKZ A;  2PUY A;  3O33 A;  1BOR A;  2M13 A;  3ZNI A;  2ECW A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  2VPB A;  4UP0 A;  5I3L A;  1Z60 A;  2KRE A;  1WEQ A;  4GNF A;  2FFW A;  5KH3 A;  2YUR A;  3IHP A;  4FIP A;  2L7P A;  1WIL A;  2YQL A;  3SOX A;  2RR4 A;  2IQJ A;  2VPE A;  2M85 A;  2ECG A;  3DPL R;  5KH7 A;  1JM7 A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  1ZBD B;  4WZ2 A;  3FAN A;  1FBV A;  2KKX A;  4ZUX U;  4LK9 A;  4AYC B;  3LDY A;  2VJE A;  5D1M B;  2KE1 A;  3HCS A;  3LQI A;  4O64 A;  3KV5 A;  4YBS A;  5B79 A;  3N9O A;  1WEM A;  2C2V S;  2EOD A;  5SVX A;  2QJ0 A;  2QIZ A;  2YVR A;  1N87 A;  4QQ4 A;  1WEP A;  1U6G B;  5G04 B;  2Y1N A;  4QF3 A;  2XOC A;  3O7A A;  4C9Z A;  3EB5 A;  2QIC A;  4FK5 A;  2L0B A;  1MM3 A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  4X3G A;  2PNX A;  4AYC A;  3N9L A;  2VPD A;  4YBT A;  2YSM A;  4P5O B;  5G0F A;  1WES A;  3EB6 A;  4PPE A;  3GL6 A;  2CKL B;  2VP7 A;  2KU3 A;  2ZET C;  4H9D A;  5H1T A;  3RPG C;  3C6W A;  5AIT A;  2KKY A;  1T1H A;  5H1U A;  2EGM A;  2EGP A;  5TRB A;  4B7Y C;  3U5P A;  2F6N A;  2HYE D;  2FUU A;  3L1Z B;  2E61 A;  2MKE A;  3KDE C;  5SVY A;  4IC3 A;  2L75 A;  5H1V A;  5TBN A;  2YSJ A;  5B8D A;  3MHS A;  1Z6U A;  4R8P K;  2ECJ A;  3I2D A;  5LKX A;  2CKL A;  5DIN A;  2JUN A;  3LVR E;  5H9M A;  3FM8 C;  4R7E A;  4AVX A; 
#chains in the Genus database with same CATH homology
 2HDP A;  5LKT A;  1LDJ B;  2XEU A;  1WEE A;  4WZ3 B;  2Y43 A;  3C5K A;  1X4J A;  4QF2 A;  4YAT A;  3ZVZ B;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  3N9N A;  3PUQ A;  2IDA A;  1X4I A;  4W4U A;  2LGK A;  2LV9 A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  2RI7 A;  2VPG A;  3NG2 A;  2JMD A;  3LRQ A;  2MIQ A;  3LQJ A;  1RMD A;  4V3K C;  3DQV R;  2LDR A;  2OXQ C;  3ZVY A;  2KWN A;  3SHB A;  1G25 A;  2XB1 A;  5C11 A;  2YW8 A;  3KNV A;  2F6J A;  3M99 A;  2VJF A;  3O35 A;  4NN2 A;  2YUC A;  1E4U A;  4FO9 A;  3O36 A;  4I7C A;  5FEY A;  2MD7 B;  4V3L C;  2K16 A;  2LGG A;  2LXP C;  2ECI A;  2KWK A;  1JOC A;  5LKU A;  4FJC A;  1WEO A;  4A4B A;  3ZTG A;  4AP4 A;  4BHW A;  3SOW A;  2G43 A;  4CA1 A;  3M63 A;  3HTK C;  2KGG A;  2E6S A;  2BAY A;  5B75 A;  2E6R A;  2KGI A;  1CHC A;  4A49 A;  1WEV A;  2MA5 A;  2MD8 C;  4BBQ A;  2KWJ A;  1VFY A;  4TKP B;  5G05 B;  3ZPV E;  2YHN A;  2YT5 A;  3V43 A;  4LLB A;  2LQ6 A;  1HYJ A;  3ZYQ A;  4YBM A;  2KWO A;  2ECN A;  1Z2Q A;  4UI9 B;  3O70 A;  4LJN A;  2YRE A;  3RPG B;  1XWH A;  2K17 A;  4ZQL A;  5KH9 A;  2H0D B;  4N3W A;  2MNZ A;  3KV6 A;  5TDW A;  1JM7 B;  4GNE A;  3T6R A;  3U5N A;  5B76 A;  3O34 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  4MVT A;  2VJE B;  1FP0 A;  4LKA A;  4F52 B;  3T7L A;  2G6Q A;  3PUR A;  5DKA A;  1WIM A;  1WFK A;  5FB0 A;  5B77 A;  2ECT A;  2MT5 A;  4YAD A;  4YC9 A;  5EYA F;  2FSA A;  2YQM A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  2CSY A;  2LGV A;  3RTR B;  1DVP A;  2YU4 A;  3U5M A;  2G45 A;  3ZPV 1;  2L5U A;  2CSZ A;  1IYM A;  2KFT A;  2JMI A;  2RSD A;  4A0C D;  3N9Q A;  4I7B A;  2MA6 A;  3M62 A;  3MHH A;  5B78 A;  2ECV A;  4S3O B;  4XI1 A;  3L1X A;  1V87 A;  2UZG A;  2CT2 A;  2EA6 A;  3GV4 A;  4AUQ B;  3U5O A;  2YYR A;  4GND A;  2K1J A;  2L80 A;  5TAB A;  2M6M A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  4GNG A;  3O37 A;  5D1L B;  5JG6 A;  2Y1M A;  5D1K B;  1X4U A;  1WEN A;  5TDR A;  2LGL A;  4Q6F A;  4WZ0 A;  1VYX A;  1F62 A;  2KR4 A;  1K2F A;  2LXH C;  4UP5 A;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4PTB A;  2C2L A;  2NAA A;  3ASL A;  1LDK C;  3QZV A;  5FB1 A;  2JRJ A;  4I7D A;  4LAD B;  5AIU A;  4YAX A;  5LCW B;  1WEW A;  2LN0 A;  4L7X A;  3N9P A;  4MSX A;  2L43 A;  3HCU A;  5C13 A;  2MNY A;  4WA6 A;  2F42 A;  5LKZ A;  2PUY A;  3O33 A;  1BOR A;  3ZNI A;  2ECW A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  2VPB A;  4UP0 A;  5I3L A;  1Z60 A;  2KRE A;  1WEQ A;  4GNF A;  5KH3 A;  2YUR A;  3IHP A;  4FIP A;  1WIL A;  2YQL A;  3SOX A;  2VPE A;  2M85 A;  2ECG A;  3DPL R;  5KH7 A;  1JM7 A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  1ZBD B;  4WZ2 A;  1FBV A;  4ZUX U;  4LK9 A;  4AYC B;  2VJE A;  5D1M B;  2KE1 A;  3HCS A;  3LQI A;  4O64 A;  3KV5 A;  4YBS A;  5B79 A;  3N9O A;  1WEM A;  2C2V S;  2EOD A;  2QJ0 A;  2QIZ A;  1N87 A;  1WEP A;  1U6G B;  5G04 B;  2Y1N A;  4QF3 A;  3O7A A;  4C9Z A;  3EB5 A;  2QIC A;  4FK5 A;  2L0B A;  1MM3 A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  4X3G A;  2PNX A;  4AYC A;  3N9L A;  2VPD A;  4YBT A;  2YSM A;  4P5O B;  5G0F A;  1WES A;  3EB6 A;  4PPE A;  3GL6 A;  2CKL B;  2VP7 A;  2KU3 A;  2ZET C;  5H1T A;  3RPG C;  3C6W A;  5AIT A;  1T1H A;  5H1U A;  2EGP A;  5TRB A;  4B7Y C;  3U5P A;  2F6N A;  2HYE D;  2FUU A;  3L1Z B;  4IC3 A;  2L75 A;  5H1V A;  5TBN A;  2YSJ A;  5B8D A;  3MHS A;  1Z6U A;  4R8P K;  2ECJ A;  3I2D A;  5LKX A;  2CKL A;  5DIN A;  5H9M A;  4R7E A;  4AVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...