1Z60A

Solution structure of the carboxy-terminal domain of human tfiih p44 subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
LDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords TFIIH basal transcription factor complex p44 subunit
publication title Solution structure of the C-terminal domain of TFIIH P44 subunit reveals a novel type of C4C4 ring domain involved in protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z60A00
5JG6A 4L7XA 4CCGX 4AVXA 5B78A 2OXQC 2KWNA 2VJFA 5D1KB 3ZPVE 1V87A 1Z60A 2IDAA 4N4FA 4L58A 3U5NA 3PURA 2D8SA 2LDRA 4ZUXU 1WEOA 1XWHA 5TRBA 5G0FA 3ZYQA 3U5MA 2KGGA 3HCUA 2ECWA 5TDRA 2MNZA 5LKXA 1K2FA 2KE1A 2F42A 2YHNA 2ECGA 3V43A 3RTRB 5DKAA 4IC3A 2H0DA 2LXHC 2E6RA 2CKLB 3I2DA 4R2YA 4R8PK 2MD8C 2YU4A 2YW8A 5G04B 4WA6A 2M6MA 5LCWB 5D1LB 2JRJA 2K16A 2YSMA 1WEEA 1E4UA 4MVTA 2LRIC 3C6WA 4CA1A 4B86C 3FL2A 4YADA 3MHSA 4ZDTA 5C13A 5B8DA 2EGPA 3SOXA 1ZBDB 2VNFA 4NN2A 2LV9A 5I3LA 4MSXA 2CT2A 2LGVA 5LKTA 2YSJA 3DQVR 3KV6A 5KH3A 2CKLA 1JM7B 4LJNA 2F6NA 1LDKC 2RSDA 5FB0A 3QZVA 3N9PA 3GL6A 1X4UA 2DX8A 4V3LC 2MIQA 2XEUA 2CSZA 3KNVA 4B7YC 3N9NA 1WILA 2LGGA 4UI9B 5C11A 4PPEA 2E6SA 4FK5A 5H1TA 1FBVA 2Y1MA 2VPGA 3L1XA 4A4CA 2VPBA 4UP0A 1VYXA 2M1RA 2G6QA 2CSYA 2MA5A 4I7CA 1Z2QA 4FIPA 1WEVA 1N87A 3M62A 4LKAA 2VPDA 5B76A 2KFTA 5KH7A 2UZGA 4YABA 3KV5A 1WE9A 2KGIA 5TDWA 2M85A 2NAAA 2EODA 3NG2A 5D1MB 3LQJA 2KR4A 4FO9A 1T1HA 5B77A 3EB6A 1WEMA 2G45A 4F52B 3T7LA 2L75A 4GNDA 5AITA 3SOWA 2XB1A 3N9LA 5EYAF 3LRQA 2VJEB 1WEPA 3O70A 2LGKA 2ECIA 1WIMA 3VK6A 2ZETC 2BAYA 2L5UA 1U6GB 2MD7B 4AP4A 2KWOA 2HDPA 1WEWA 3N9QA 2MNYA 4YBSA 2L43A 3O35A 4Q6FA 5H1VA 2QJ0A 2ECNA 5H9MA 1WENA 4N3WA 1BORA 1RMDA 2PNXA 4YC9A 4GNGA 5TBNA 4YAXA 2KWKA 4ZQLA 2YREA 4UP5A 1HYIA 3IHPA 3SOUA 3MHHA 3L1ZB 3ZPV1 1G25A 3GV4A 4P5OB 2YURA 2YQLA 5B75A 2JMIA 1F62A 5FERA 2VJFB 2F6JA 2KIZA 3ASLA 3O37A 3RPGC 2FUUA 3LQIA 2MA6A 5DINA 2MUMA 4LLBA 2VPEA 1X4JA 2ECTA 2KREA 1JOCA 5J3XA 2LQ6A 1LDJB 2Y43A 1VFYA 4WZ0A 2VP7A 4C9ZA 3HCTA 3PHDA 5B79A 1JM7A 1WEUA 4GNFA 1MM3A 2HYED 2ECJA 3RPGB 1WESA 5G05B 2Y1NA 5LKUA 2H0DB 2YUCA 5LKZA 3SHBA 5AIUA 1WFKA 2FUIA 2AN6A 1VD4A 4W4UA 4A49A 2L80A 4BBQA 3HCSA 2L0BA 4BHWA 4A4BA 4QF2A 3M63A 4AYCB 4WZ2A 2YHOA 3T6RA 5H1UA 5FB1A 5TABA 2K17A 3PUQA 2C2LA 4QF3A 4I7BA 2KYUA 3N9OA 4LK9A 2QICA 2LXPC 1X4IA 3HTKC 3O34A 3KQIA 3U5PA 1FP0A 2JMJA 3DPLR 2I50A 3ZNIA 2EA6A 2YQMA 2KU3A 3O33A 2KWJA 1WGMA 4YBTA 2ECVA 3M99A 4O64A 3ZTGA 4YATA 2VJEA 4I7DA 2K4DA 4AYCA 1Z6UA 4V3KC 2LN0A 4PTBA 4R7EA 4S3OC 2RI7A 3EB5A 5FEYA 4FJCA 4GB0A 2YT5A 3O7AA 1WEQA 4X3GA 1CHCA 2LGLA 3C5KA 3L11A 2QIZA 3ZVZB 4WZ3B 3ZVYA 4XI1A 2M3HA 3U5OA 4YBMA 3LQHA 3O36A 4IC2A 2YYRA 1DVPA 4AUQB 2K1JA 2G43A 3N9MA 4LADB 1HYJA 1MM2A 4TKPB 1IYMA 4S3OB 2PUYA 4A0CD 2MT5A 5KH9A 2C2VS 2JMDA 4GNEA 2FSAA
chains in the Genus database with same CATH superfamily
3KDEC 2XOYA 5JG6A 4L7XA 4CCGX 4AVXA 5B78A 2OXQC 2KWNA 2L7PA 2VJFA 5D1KB 3ZPVE 5SVXA 1V87A 1Z60A 2IDAA 4N4FA 4L58A 3U5NA 3PURA 2D8SA 2LDRA 4ZUXU 1WEOA 1XWHA 2MKEA 5TRBA 5G0FA 3FANA 3ZYQA 3U5MA 2KGGA 2XP0A 3HCUA 2ECWA 5TDRA 3LDYA 2MNZA 5LKXA 1K2FA 2KE1A 2F42A 2YHNA 2ECGA 3V43A 3RTRB 5DKAA 4IC3A 2E61A 2CONA 2H0DA 2LXHC 2E6RA 2CKLB 3I2DA 3PLWA 4R2YA 4R8PK 2MD8C 4Z0RA 2YU4A 2YW8A 5G04B 4WA6A 2M6MA 5LCWB 5D1LB 2JRJA 2K16A 2YSMA 1WEEA 1E4UA 2EGMA 4F1PA 4MVTA 5SVIA 2LRIC 3C6WA 2JUNA 4CA1A 4B86C 3FL2A 4YADA 3MHSA 4ZDTA 5C13A 5B8DA 2KKXA 2EGPA 3SOXA 3LVQE 1ZBDB 2VNFA 4NN2A 2LV9A 5I3LA 4MSXA 2CT2A 2LGVA 5LKTA 2YSJA 3DQVR 3KV6A 5KH3A 2CKLA 1JM7B 4LJNA 2F6NA 1LDKC 2RSDA 5FB0A 3QZVA 3N9PA 4OGEA 3GL6A 1X4UA 2DX8A 4V3LC 2MIQA 2XEUA 2CSZA 3KNVA 2XOZA 4QQ4A 4B7YC 3LJUX 3N9NA 1WILA 2LGGA 4UI9B 5C11A 4PPEA 2E6SA 4FK5A 5H1TA 1DCQA 1FBVA 2Y1MA 2VPGA 3L1XA 2RR4A 4A4CA 2VPBA 4UP0A 1VYXA 2M1RA 2G6QA 2CSYA 2MA5A 4I7CA 1Z2QA 4FIPA 1WEVA 1N87A 3M62A 4LKAA 1MBMA 2VPDA 5B76A 2KFTA 5KH7A 2UZGA 2JM3A 4YABA 3KV5A 1WE9A 2KGIA 5TDWA 2M85A 2NAAA 2EODA 3NG2A 5D1MB 3LQJA 2KR4A 4FO9A 1T1HA 5B77A 3EB6A 1WEMA 2D8UA 2G45A 4F52B 3T7LA 2L75A 4GNDA 5AITA 3SOWA 2XB1A 3N9LA 5EYAF 3LRQA 2VJEB 2FD4A 1WEPA 4Z0OA 2CRRA 5SVYA 3O70A 2LGKA 2ECIA 1WIMA 3VK6A 3MDBC 2ZETC 2BAYA 2L5UA 1U6GB 2MD7B 4AP4A 2KWOA 2HDPA 1WEWA 3N9QA 2MNYA 3LVRE 4YBSA 2L43A 3O35A 4Q6FA 5H1VA 2QJ0A 2ECNA 5H9MA 1WENA 4N3WA 1BORA 1RMDA 2PNXA 4YC9A 4GNGA 5TBNA 4YAXA 2KWKA 2B0OE 4ZQLA 2YREA 4UP5A 1HYIA 3IHPA 3SOUA 2YVRA 3MHHA 3L1ZB 3ZPV1 1G25A 3GV4A 4P5OB 2YURA 2YQLA 5B75A 2JMIA 5K3QA 1F62A 5FERA 2VJFB 2F6JA 2KIZA 3ASLA 3O37A 3RPGC 2FUUA 3LQIA 2MA6A 3SUBA 5DINA 2MUMA 4LLBA 2VPEA 1X4JA 2ECTA 2KREA 1JOCA 5J3XA 2LQ6A 1LDJB 2Y43A 1VFYA 4WZ0A 2VP7A 4C9ZA 3HCTA 3PHDA 5B79A 1JM7A 1WEUA 4GNFA 3H7HA 1MM3A 2HYED 2ECJA 2EXUA 3RPGB 4OGCA 1WESA 5G05B 2Y1NA 5LKUA 2H0DB 2YUCA 5LKZA 3M7KA 3SHBA 5AIUA 1WFKA 2FUIA 2AN6A 1VD4A 4W4UA 4A49A 3DDTA 2L80A 4BBQA 3HCSA 2L0BA 4BHWA 4A4BA 4QF2A 2OWAA 3M63A 4AYCB 2XOCA 5SVIB 4WZ2A 2YHOA 3T6RA 5H1UA 5FB1A 5TABA 2LAUA 2K17A 3PUQA 3FM8C 2C2LA 4QF3A 4I7BA 3FAOA 2KYUA 3N9OA 4LK9A 2QICA 2LXPC 1X4IA 3HTKC 3O34A 3JUEA 4H9DA 3KQIA 3U5PA 1FP0A 2CRWA 2JMJA 3DPLR 2I50A 3DWDA 3ZNIA 2EA6A 2YQMA 2KU3A 2KKYA 3O33A 2KWJA 1WGMA 4YBTA 3T9KA 2ECVA 3M99A 4O64A 3ZTGA 2P57A 4YATA 2VJEA 3FJUB 4I7DA 2K4DA 4AYCA 1Z6UA 4V3KC 2LN0A 4PTBA 4R7EA 4S3OC 2RI7A 3EB5A 5FEYA 4FJCA 2DSMA 4GB0A 2YT5A 3O7AA 1WEQA 4X3GA 1CHCA 2LGLA 4O62A 2CSVA 3C5KA 3L11A 2QIZA 3ZVZB 4WZ3B 3O47A 2FFWA 3ZVYA 4XI1A 2IQJA 2M3HA 3E2DA 3U5OA 4YBMA 3LQHA 2M13A 3O36A 4IC2A 2YYRA 1DVPA 4AUQB 2K1JA 2G43A 3N9MA 4LADB 2DJAA 1HYJA 1MM2A 4TKPB 3Q1DA 1IYMA 4S3OB 2PUYA 4A0CD 3FEHA 2MT5A 5KH9A 2C2VS 2JMDA 4GNEA 2FSAA
chains in the Genus database with same CATH topology
5JG6A 4L7XA 4CCGX 4AVXA 5B78A 2OXQC 2KWNA 2VJFA 5D1KB 3ZPVE 1V87A 1Z60A 2IDAA 4N4FA 4L58A 3U5NA 3PURA 2D8SA 2LDRA 4ZUXU 1WEOA 1XWHA 5TRBA 5G0FA 3ZYQA 3U5MA 2KGGA 3HCUA 2ECWA 5TDRA 2MNZA 5LKXA 1K2FA 2KE1A 2F42A 2YHNA 2ECGA 3V43A 3RTRB 5DKAA 4IC3A 2H0DA 2LXHC 2E6RA 2CKLB 3I2DA 4R2YA 4R8PK 2MD8C 2YU4A 2YW8A 5G04B 4WA6A 2M6MA 5LCWB 5D1LB 2JRJA 2K16A 2YSMA 1WEEA 1E4UA 4MVTA 2LRIC 3C6WA 4CA1A 4B86C 3FL2A 4YADA 3MHSA 4ZDTA 5C13A 5B8DA 2EGPA 3SOXA 1ZBDB 2VNFA 4NN2A 2LV9A 5I3LA 4MSXA 2CT2A 2LGVA 5LKTA 2YSJA 3DQVR 3KV6A 5KH3A 2CKLA 1JM7B 4LJNA 2F6NA 1LDKC 2RSDA 5FB0A 3QZVA 3N9PA 3GL6A 1X4UA 2DX8A 4V3LC 2MIQA 2XEUA 2CSZA 3KNVA 4B7YC 3N9NA 1WILA 2LGGA 4UI9B 5C11A 4PPEA 2E6SA 4FK5A 5H1TA 1FBVA 2Y1MA 2VPGA 3L1XA 4A4CA 2VPBA 4UP0A 1VYXA 2M1RA 2G6QA 2CSYA 2MA5A 4I7CA 1Z2QA 4FIPA 1WEVA 1N87A 3M62A 4LKAA 2VPDA 5B76A 2KFTA 5KH7A 2UZGA 4YABA 3KV5A 1WE9A 2KGIA 5TDWA 2M85A 2NAAA 2EODA 3NG2A 5D1MB 3LQJA 2KR4A 4FO9A 1T1HA 5B77A 3EB6A 1WEMA 2G45A 4F52B 3T7LA 2L75A 4GNDA 5AITA 3SOWA 2XB1A 3N9LA 5EYAF 3LRQA 2VJEB 1WEPA 3O70A 2LGKA 2ECIA 1WIMA 3VK6A 2ZETC 2BAYA 2L5UA 1U6GB 2MD7B 4AP4A 2KWOA 2HDPA 1WEWA 3N9QA 2MNYA 4YBSA 2L43A 3O35A 4Q6FA 5H1VA 2QJ0A 2ECNA 5H9MA 1WENA 4N3WA 1BORA 1RMDA 2PNXA 4YC9A 4GNGA 5TBNA 4YAXA 2KWKA 4ZQLA 2YREA 4UP5A 1HYIA 3IHPA 3SOUA 3MHHA 3L1ZB 3ZPV1 1G25A 3GV4A 4P5OB 2YURA 2YQLA 5B75A 2JMIA 1F62A 5FERA 2VJFB 2F6JA 2KIZA 3ASLA 3O37A 3RPGC 2FUUA 3LQIA 2MA6A 5DINA 2MUMA 4LLBA 2VPEA 1X4JA 2ECTA 2KREA 1JOCA 5J3XA 2LQ6A 1LDJB 2Y43A 1VFYA 4WZ0A 2VP7A 4C9ZA 3HCTA 3PHDA 5B79A 1JM7A 1WEUA 4GNFA 1MM3A 2HYED 2ECJA 3RPGB 1WESA 5G05B 2Y1NA 5LKUA 2H0DB 2YUCA 5LKZA 3SHBA 5AIUA 1WFKA 2FUIA 2AN6A 1VD4A 4W4UA 4A49A 2L80A 4BBQA 3HCSA 2L0BA 4BHWA 4A4BA 4QF2A 3M63A 4AYCB 4WZ2A 2YHOA 3T6RA 5H1UA 5FB1A 5TABA 2K17A 3PUQA 2C2LA 4QF3A 4I7BA 2KYUA 3N9OA 4LK9A 2QICA 2LXPC 1X4IA 3HTKC 3O34A 3KQIA 3U5PA 1FP0A 2JMJA 3DPLR 2I50A 3ZNIA 2EA6A 2YQMA 2KU3A 3O33A 2KWJA 1WGMA 4YBTA 2ECVA 3M99A 4O64A 3ZTGA 4YATA 2VJEA 4I7DA 2K4DA 4AYCA 1Z6UA 4V3KC 2LN0A 4PTBA 4R7EA 4S3OC 2RI7A 3EB5A 5FEYA 4FJCA 4GB0A 2YT5A 3O7AA 1WEQA 4X3GA 1CHCA 2LGLA 3C5KA 3L11A 2QIZA 3ZVZB 4WZ3B 3ZVYA 4XI1A 2M3HA 3U5OA 4YBMA 3LQHA 3O36A 4IC2A 2YYRA 1DVPA 4AUQB 2K1JA 2G43A 3N9MA 4LADB 1HYJA 1MM2A 4TKPB 1IYMA 4S3OB 2PUYA 4A0CD 2MT5A 5KH9A 2C2VS 2JMDA 4GNEA 2FSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JG6 A;  4L7X A;  4CCG X;  4AVX A;  5B78 A;  2OXQ C;  2KWN A;  2VJF A;  5D1K B;  3ZPV E;  1V87 A;  1Z60 A;  2IDA A;  4N4F A;  4L58 A;  3U5N A;  3PUR A;  2D8S A;  2LDR A;  4ZUX U;  1WEO A;  1XWH A;  5TRB A;  5G0F A;  3ZYQ A;  3U5M A;  2KGG A;  3HCU A;  2ECW A;  5TDR A;  2MNZ A;  5LKX A;  1K2F A;  2KE1 A;  2F42 A;  2YHN A;  2ECG A;  3V43 A;  3RTR B;  5DKA A;  4IC3 A;  2H0D A;  2LXH C;  2E6R A;  2CKL B;  3I2D A;  4R2Y A;  4R8P K;  2MD8 C;  2YU4 A;  2YW8 A;  5G04 B;  4WA6 A;  2M6M A;  5LCW B;  5D1L B;  2JRJ A;  2K16 A;  2YSM A;  1WEE A;  1E4U A;  4MVT A;  2LRI C;  3C6W A;  4CA1 A;  4B86 C;  3FL2 A;  4YAD A;  3MHS A;  4ZDT A;  5C13 A;  5B8D A;  2EGP A;  3SOX A;  1ZBD B;  2VNF A;  4NN2 A;  2LV9 A;  5I3L A;  4MSX A;  2CT2 A;  2LGV A;  5LKT A;  2YSJ A;  3DQV R;  3KV6 A;  5KH3 A;  2CKL A;  1JM7 B;  4LJN A;  2F6N A;  1LDK C;  2RSD A;  5FB0 A;  3QZV A;  3N9P A;  3GL6 A;  1X4U A;  2DX8 A;  4V3L C;  2MIQ A;  2XEU A;  2CSZ A;  3KNV A;  4B7Y C;  3N9N A;  1WIL A;  2LGG A;  4UI9 B;  5C11 A;  4PPE A;  2E6S A;  4FK5 A;  5H1T A;  1FBV A;  2Y1M A;  2VPG A;  3L1X A;  4A4C A;  2VPB A;  4UP0 A;  1VYX A;  2M1R A;  2G6Q A;  2CSY A;  2MA5 A;  4I7C A;  1Z2Q A;  4FIP A;  1WEV A;  1N87 A;  3M62 A;  4LKA A;  2VPD A;  5B76 A;  2KFT A;  5KH7 A;  2UZG A;  4YAB A;  3KV5 A;  1WE9 A;  2KGI A;  5TDW A;  2M85 A;  2NAA A;  2EOD A;  3NG2 A;  5D1M B;  3LQJ A;  2KR4 A;  4FO9 A;  1T1H A;  5B77 A;  3EB6 A;  1WEM A;  2G45 A;  4F52 B;  3T7L A;  2L75 A;  4GND A;  5AIT A;  3SOW A;  2XB1 A;  3N9L A;  5EYA F;  3LRQ A;  2VJE B;  1WEP A;  3O70 A;  2LGK A;  2ECI A;  1WIM A;  3VK6 A;  2ZET C;  2BAY A;  2L5U A;  1U6G B;  2MD7 B;  4AP4 A;  2KWO A;  2HDP A;  1WEW A;  3N9Q A;  2MNY A;  4YBS A;  2L43 A;  3O35 A;  4Q6F A;  5H1V A;  2QJ0 A;  2ECN A;  5H9M A;  1WEN A;  4N3W A;  1BOR A;  1RMD A;  2PNX A;  4YC9 A;  4GNG A;  5TBN A;  4YAX A;  2KWK A;  4ZQL A;  2YRE A;  4UP5 A;  1HYI A;  3IHP A;  3SOU A;  3MHH A;  3L1Z B;  3ZPV 1;  1G25 A;  3GV4 A;  4P5O B;  2YUR A;  2YQL A;  5B75 A;  2JMI A;  1F62 A;  5FER A;  2VJF B;  2F6J A;  2KIZ A;  3ASL A;  3O37 A;  3RPG C;  2FUU A;  3LQI A;  2MA6 A;  5DIN A;  2MUM A;  4LLB A;  2VPE A;  1X4J A;  2ECT A;  2KRE A;  1JOC A;  5J3X A;  2LQ6 A;  1LDJ B;  2Y43 A;  1VFY A;  4WZ0 A;  2VP7 A;  4C9Z A;  3HCT A;  3PHD A;  5B79 A;  1JM7 A;  1WEU A;  4GNF A;  1MM3 A;  2HYE D;  2ECJ A;  3RPG B;  1WES A;  5G05 B;  2Y1N A;  5LKU A;  2H0D B;  2YUC A;  5LKZ A;  3SHB A;  5AIU A;  1WFK A;  2FUI A;  2AN6 A;  1VD4 A;  4W4U A;  4A49 A;  2L80 A;  4BBQ A;  3HCS A;  2L0B A;  4BHW A;  4A4B A;  4QF2 A;  3M63 A;  4AYC B;  4WZ2 A;  2YHO A;  3T6R A;  5H1U A;  5FB1 A;  5TAB A;  2K17 A;  3PUQ A;  2C2L A;  4QF3 A;  4I7B A;  2KYU A;  3N9O A;  4LK9 A;  2QIC A;  2LXP C;  1X4I A;  3HTK C;  3O34 A;  3KQI A;  3U5P A;  1FP0 A;  2JMJ A;  3DPL R;  2I50 A;  3ZNI A;  2EA6 A;  2YQM A;  2KU3 A;  3O33 A;  2KWJ A;  1WGM A;  4YBT A;  2ECV A;  3M99 A;  4O64 A;  3ZTG A;  4YAT A;  2VJE A;  4I7D A;  2K4D A;  4AYC A;  1Z6U A;  4V3K C;  2LN0 A;  4PTB A;  4R7E A;  4S3O C;  2RI7 A;  3EB5 A;  5FEY A;  4FJC A;  4GB0 A;  2YT5 A;  3O7A A;  1WEQ A;  4X3G A;  1CHC A;  2LGL A;  3C5K A;  3L11 A;  2QIZ A;  3ZVZ B;  4WZ3 B;  3ZVY A;  4XI1 A;  2M3H A;  3U5O A;  4YBM A;  3LQH A;  3O36 A;  4IC2 A;  2YYR A;  1DVP A;  4AUQ B;  2K1J A;  2G43 A;  3N9M A;  4LAD B;  1HYJ A;  1MM2 A;  4TKP B;  1IYM A;  4S3O B;  2PUY A;  4A0C D;  2MT5 A;  5KH9 A;  2C2V S;  2JMD A;  4GNE A;  2FSA A; 
#chains in the Genus database with same CATH topology
 3KDE C;  2XOY A;  5JG6 A;  4L7X A;  4CCG X;  4AVX A;  5B78 A;  2OXQ C;  2KWN A;  2L7P A;  2VJF A;  5D1K B;  3ZPV E;  5SVX A;  1V87 A;  1Z60 A;  2IDA A;  4N4F A;  4L58 A;  3U5N A;  3PUR A;  2D8S A;  2LDR A;  4ZUX U;  1WEO A;  1XWH A;  2MKE A;  5TRB A;  5G0F A;  3FAN A;  3ZYQ A;  3U5M A;  2KGG A;  2XP0 A;  3HCU A;  2ECW A;  5TDR A;  3LDY A;  2MNZ A;  5LKX A;  1K2F A;  2KE1 A;  2F42 A;  2YHN A;  2ECG A;  3V43 A;  3RTR B;  5DKA A;  4IC3 A;  2E61 A;  2CON A;  2H0D A;  2LXH C;  2E6R A;  2CKL B;  3I2D A;  3PLW A;  4R2Y A;  4R8P K;  2MD8 C;  4Z0R A;  2YU4 A;  2YW8 A;  5G04 B;  4WA6 A;  2M6M A;  5LCW B;  5D1L B;  2JRJ A;  2K16 A;  2YSM A;  1WEE A;  1E4U A;  2EGM A;  4F1P A;  4MVT A;  5SVI A;  2LRI C;  3C6W A;  2JUN A;  4CA1 A;  4B86 C;  3FL2 A;  4YAD A;  3MHS A;  4ZDT A;  5C13 A;  5B8D A;  2KKX A;  2EGP A;  3SOX A;  3LVQ E;  1ZBD B;  2VNF A;  4NN2 A;  2LV9 A;  5I3L A;  4MSX A;  2CT2 A;  2LGV A;  5LKT A;  2YSJ A;  3DQV R;  3KV6 A;  5KH3 A;  2CKL A;  1JM7 B;  4LJN A;  2F6N A;  1LDK C;  2RSD A;  5FB0 A;  3QZV A;  3N9P A;  4OGE A;  3GL6 A;  1X4U A;  2DX8 A;  4V3L C;  2MIQ A;  2XEU A;  2CSZ A;  3KNV A;  2XOZ A;  4QQ4 A;  4B7Y C;  3LJU X;  3N9N A;  1WIL A;  2LGG A;  4UI9 B;  5C11 A;  4PPE A;  2E6S A;  4FK5 A;  5H1T A;  1DCQ A;  1FBV A;  2Y1M A;  2VPG A;  3L1X A;  2RR4 A;  4A4C A;  2VPB A;  4UP0 A;  1VYX A;  2M1R A;  2G6Q A;  2CSY A;  2MA5 A;  4I7C A;  1Z2Q A;  4FIP A;  1WEV A;  1N87 A;  3M62 A;  4LKA A;  1MBM A;  2VPD A;  5B76 A;  2KFT A;  5KH7 A;  2UZG A;  2JM3 A;  4YAB A;  3KV5 A;  1WE9 A;  2KGI A;  5TDW A;  2M85 A;  2NAA A;  2EOD A;  3NG2 A;  5D1M B;  3LQJ A;  2KR4 A;  4FO9 A;  1T1H A;  5B77 A;  3EB6 A;  1WEM A;  2D8U A;  2G45 A;  4F52 B;  3T7L A;  2L75 A;  4GND A;  5AIT A;  3SOW A;  2XB1 A;  3N9L A;  5EYA F;  3LRQ A;  2VJE B;  2FD4 A;  1WEP A;  4Z0O A;  2CRR A;  5SVY A;  3O70 A;  2LGK A;  2ECI A;  1WIM A;  3VK6 A;  3MDB C;  2ZET C;  2BAY A;  2L5U A;  1U6G B;  2MD7 B;  4AP4 A;  2KWO A;  2HDP A;  1WEW A;  3N9Q A;  2MNY A;  3LVR E;  4YBS A;  2L43 A;  3O35 A;  4Q6F A;  5H1V A;  2QJ0 A;  2ECN A;  5H9M A;  1WEN A;  4N3W A;  1BOR A;  1RMD A;  2PNX A;  4YC9 A;  4GNG A;  5TBN A;  4YAX A;  2KWK A;  2B0O E;  4ZQL A;  2YRE A;  4UP5 A;  1HYI A;  3IHP A;  3SOU A;  2YVR A;  3MHH A;  3L1Z B;  3ZPV 1;  1G25 A;  3GV4 A;  4P5O B;  2YUR A;  2YQL A;  5B75 A;  2JMI A;  5K3Q A;  1F62 A;  5FER A;  2VJF B;  2F6J A;  2KIZ A;  3ASL A;  3O37 A;  3RPG C;  2FUU A;  3LQI A;  2MA6 A;  3SUB A;  5DIN A;  2MUM A;  4LLB A;  2VPE A;  1X4J A;  2ECT A;  2KRE A;  1JOC A;  5J3X A;  2LQ6 A;  1LDJ B;  2Y43 A;  1VFY A;  4WZ0 A;  2VP7 A;  4C9Z A;  3HCT A;  3PHD A;  5B79 A;  1JM7 A;  1WEU A;  4GNF A;  3H7H A;  1MM3 A;  2HYE D;  2ECJ A;  2EXU A;  3RPG B;  4OGC A;  1WES A;  5G05 B;  2Y1N A;  5LKU A;  2H0D B;  2YUC A;  5LKZ A;  3M7K A;  3SHB A;  5AIU A;  1WFK A;  2FUI A;  2AN6 A;  1VD4 A;  4W4U A;  4A49 A;  3DDT A;  2L80 A;  4BBQ A;  3HCS A;  2L0B A;  4BHW A;  4A4B A;  4QF2 A;  2OWA A;  3M63 A;  4AYC B;  2XOC A;  5SVI B;  4WZ2 A;  2YHO A;  3T6R A;  5H1U A;  5FB1 A;  5TAB A;  2LAU A;  2K17 A;  3PUQ A;  3FM8 C;  2C2L A;  4QF3 A;  4I7B A;  3FAO A;  2KYU A;  3N9O A;  4LK9 A;  2QIC A;  2LXP C;  1X4I A;  3HTK C;  3O34 A;  3JUE A;  4H9D A;  3KQI A;  3U5P A;  1FP0 A;  2CRW A;  2JMJ A;  3DPL R;  2I50 A;  3DWD A;  3ZNI A;  2EA6 A;  2YQM A;  2KU3 A;  2KKY A;  3O33 A;  2KWJ A;  1WGM A;  4YBT A;  3T9K A;  2ECV A;  3M99 A;  4O64 A;  3ZTG A;  2P57 A;  4YAT A;  2VJE A;  3FJU B;  4I7D A;  2K4D A;  4AYC A;  1Z6U A;  4V3K C;  2LN0 A;  4PTB A;  4R7E A;  4S3O C;  2RI7 A;  3EB5 A;  5FEY A;  4FJC A;  2DSM A;  4GB0 A;  2YT5 A;  3O7A A;  1WEQ A;  4X3G A;  1CHC A;  2LGL A;  4O62 A;  2CSV A;  3C5K A;  3L11 A;  2QIZ A;  3ZVZ B;  4WZ3 B;  3O47 A;  2FFW A;  3ZVY A;  4XI1 A;  2IQJ A;  2M3H A;  3E2D A;  3U5O A;  4YBM A;  3LQH A;  2M13 A;  3O36 A;  4IC2 A;  2YYR A;  1DVP A;  4AUQ B;  2K1J A;  2G43 A;  3N9M A;  4LAD B;  2DJA A;  1HYJ A;  1MM2 A;  4TKP B;  3Q1D A;  1IYM A;  4S3O B;  2PUY A;  4A0C D;  3FEH A;  2MT5 A;  5KH9 A;  2C2V S;  2JMD A;  4GNE A;  2FSA A; 
#chains in the Genus database with same CATH homology
 5JG6 A;  4L7X A;  4CCG X;  4AVX A;  5B78 A;  2OXQ C;  2KWN A;  2VJF A;  5D1K B;  3ZPV E;  1V87 A;  1Z60 A;  2IDA A;  4N4F A;  4L58 A;  3U5N A;  3PUR A;  2D8S A;  2LDR A;  4ZUX U;  1WEO A;  1XWH A;  5TRB A;  5G0F A;  3ZYQ A;  3U5M A;  2KGG A;  3HCU A;  2ECW A;  5TDR A;  2MNZ A;  5LKX A;  1K2F A;  2KE1 A;  2F42 A;  2YHN A;  2ECG A;  3V43 A;  3RTR B;  5DKA A;  4IC3 A;  2H0D A;  2LXH C;  2E6R A;  2CKL B;  3I2D A;  4R2Y A;  4R8P K;  2MD8 C;  2YU4 A;  2YW8 A;  5G04 B;  4WA6 A;  2M6M A;  5LCW B;  5D1L B;  2JRJ A;  2K16 A;  2YSM A;  1WEE A;  1E4U A;  4MVT A;  2LRI C;  3C6W A;  4CA1 A;  4B86 C;  3FL2 A;  4YAD A;  3MHS A;  4ZDT A;  5C13 A;  5B8D A;  2EGP A;  3SOX A;  1ZBD B;  2VNF A;  4NN2 A;  2LV9 A;  5I3L A;  4MSX A;  2CT2 A;  2LGV A;  5LKT A;  2YSJ A;  3DQV R;  3KV6 A;  5KH3 A;  2CKL A;  1JM7 B;  4LJN A;  2F6N A;  1LDK C;  2RSD A;  5FB0 A;  3QZV A;  3N9P A;  3GL6 A;  1X4U A;  2DX8 A;  4V3L C;  2MIQ A;  2XEU A;  2CSZ A;  3KNV A;  4B7Y C;  3N9N A;  1WIL A;  2LGG A;  4UI9 B;  5C11 A;  4PPE A;  2E6S A;  4FK5 A;  5H1T A;  1FBV A;  2Y1M A;  2VPG A;  3L1X A;  4A4C A;  2VPB A;  4UP0 A;  1VYX A;  2M1R A;  2G6Q A;  2CSY A;  2MA5 A;  4I7C A;  1Z2Q A;  4FIP A;  1WEV A;  1N87 A;  3M62 A;  4LKA A;  2VPD A;  5B76 A;  2KFT A;  5KH7 A;  2UZG A;  4YAB A;  3KV5 A;  1WE9 A;  2KGI A;  5TDW A;  2M85 A;  2NAA A;  2EOD A;  3NG2 A;  5D1M B;  3LQJ A;  2KR4 A;  4FO9 A;  1T1H A;  5B77 A;  3EB6 A;  1WEM A;  2G45 A;  4F52 B;  3T7L A;  2L75 A;  4GND A;  5AIT A;  3SOW A;  2XB1 A;  3N9L A;  5EYA F;  3LRQ A;  2VJE B;  1WEP A;  3O70 A;  2LGK A;  2ECI A;  1WIM A;  3VK6 A;  2ZET C;  2BAY A;  2L5U A;  1U6G B;  2MD7 B;  4AP4 A;  2KWO A;  2HDP A;  1WEW A;  3N9Q A;  2MNY A;  4YBS A;  2L43 A;  3O35 A;  4Q6F A;  5H1V A;  2QJ0 A;  2ECN A;  5H9M A;  1WEN A;  4N3W A;  1BOR A;  1RMD A;  2PNX A;  4YC9 A;  4GNG A;  5TBN A;  4YAX A;  2KWK A;  4ZQL A;  2YRE A;  4UP5 A;  1HYI A;  3IHP A;  3SOU A;  3MHH A;  3L1Z B;  3ZPV 1;  1G25 A;  3GV4 A;  4P5O B;  2YUR A;  2YQL A;  5B75 A;  2JMI A;  1F62 A;  5FER A;  2VJF B;  2F6J A;  2KIZ A;  3ASL A;  3O37 A;  3RPG C;  2FUU A;  3LQI A;  2MA6 A;  5DIN A;  2MUM A;  4LLB A;  2VPE A;  1X4J A;  2ECT A;  2KRE A;  1JOC A;  5J3X A;  2LQ6 A;  1LDJ B;  2Y43 A;  1VFY A;  4WZ0 A;  2VP7 A;  4C9Z A;  3HCT A;  3PHD A;  5B79 A;  1JM7 A;  1WEU A;  4GNF A;  1MM3 A;  2HYE D;  2ECJ A;  3RPG B;  1WES A;  5G05 B;  2Y1N A;  5LKU A;  2H0D B;  2YUC A;  5LKZ A;  3SHB A;  5AIU A;  1WFK A;  2FUI A;  2AN6 A;  1VD4 A;  4W4U A;  4A49 A;  2L80 A;  4BBQ A;  3HCS A;  2L0B A;  4BHW A;  4A4B A;  4QF2 A;  3M63 A;  4AYC B;  4WZ2 A;  2YHO A;  3T6R A;  5H1U A;  5FB1 A;  5TAB A;  2K17 A;  3PUQ A;  2C2L A;  4QF3 A;  4I7B A;  2KYU A;  3N9O A;  4LK9 A;  2QIC A;  2LXP C;  1X4I A;  3HTK C;  3O34 A;  3KQI A;  3U5P A;  1FP0 A;  2JMJ A;  3DPL R;  2I50 A;  3ZNI A;  2EA6 A;  2YQM A;  2KU3 A;  3O33 A;  2KWJ A;  1WGM A;  4YBT A;  2ECV A;  3M99 A;  4O64 A;  3ZTG A;  4YAT A;  2VJE A;  4I7D A;  2K4D A;  4AYC A;  1Z6U A;  4V3K C;  2LN0 A;  4PTB A;  4R7E A;  4S3O C;  2RI7 A;  3EB5 A;  5FEY A;  4FJC A;  4GB0 A;  2YT5 A;  3O7A A;  1WEQ A;  4X3G A;  1CHC A;  2LGL A;  3C5K A;  3L11 A;  2QIZ A;  3ZVZ B;  4WZ3 B;  3ZVY A;  4XI1 A;  2M3H A;  3U5O A;  4YBM A;  3LQH A;  3O36 A;  4IC2 A;  2YYR A;  1DVP A;  4AUQ B;  2K1J A;  2G43 A;  3N9M A;  4LAD B;  1HYJ A;  1MM2 A;  4TKP B;  1IYM A;  4S3O B;  2PUY A;  4A0C D;  2MT5 A;  5KH9 A;  2C2V S;  2JMD A;  4GNE A;  2FSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...