1Z60A

Solution structure of the carboxy-terminal domain of human tfiih p44 subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
LDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TFIIH basal transcription factor complex p44 subunit
publication title Solution structure of the C-terminal domain of TFIIH P44 subunit reveals a novel type of C4C4 ring domain involved in protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z60A00
1N87A 1WENA 1ZBDB 2YURA 4O64A 5B77A 1XWHA 3O70A 1HYJA 5H1VA 4AVXA 4YBMA 3O7AA 3GL6A 3U5PA 2EODA 1X4UA 1X4JA 2PNXA 3O35A 1U6GB 2VPBA 2MNZA 4ZQLA 1WEPA 4Q6FA 4NN2A 2YSJA 4WA6A 3FL2A 5KH7A 5B76A 2MNYA 3N9MA 4C9ZA 2L43A 2KE1A 2LXHC 3V43A 2C2VS 2H0DA 3M99A 2OXQC 5D1LB 4YBTA 1RMDA 2JMIA 4WZ3B 2LXPC 2M3HA 4YBSA 2G45A 2LGLA 3N9QA 4MSXA 5LKTA 2ECVA 4I7DA 3HCUA 2VJFB 1CHCA 3DQVR 1DVPA 3U5OA 3ZNIA 3LQIA 3L11A 1F62A 1MM3A 1WEUA 2KWJA 5B79A 4W4UA 4MVTA 5FERA 1Z60A 2KIZA 2K1JA 4A0CD 3ZPV1 3HTKC 2CKLA 2YHNA 2YQMA 4R8PK 2I50A 2L75A 4I7CA 2M6MA 1FP0A 5LCWB 2K16A 1BORA 4LADB 3IHPA 2LQ6A 3O33A 1WEVA 2CSZA 3C6WA 4AP4A 3LQHA 4R7EA 3HCSA 3O34A 4N4FA 4GNFA 1K2FA 4A4BA 4QF2A 2HDPA 4CCGX 4CA1A 2FUUA 3ASLA 2KU3A 5KH3A 4GNEA 3ZPVE 3RPGB 1WEQA 2KR4A 3M62A 2MD8C 2KREA 5G04B 2RI7A 5B78A 2YW8A 4S3OB 3M63A 2L5UA 3KV6A 4UP5A 1JM7B 2L80A 4IC2A 3KNVA 5TDWA 2LV9A 2JRJA 1E4UA 3VK6A 2Y43A 3EB6A 5H1TA 2NAAA 5TBNA 2VPEA 3ZVYA 2ECIA 4WZ0A 1Z6UA 3O36A 4AYCA 2VJEA 5LKUA 5D1KB 5J3XA 4V3KC 1WESA 2E6RA 4FJCA 2KYUA 2YREA 1WFKA 2ZETC 4GB0A 2UZGA 4FO9A 1T1HA 1G25A 2HYED 2ECNA 5FEYA 4YATA 2C2LA 2F6JA 2YU4A 2FSAA 3T7LA 4AUQB 2MT5A 4A4CA 2JMJA 1VFYA 5DKAA 4QF3A 2H0DB 4TKPB 3RTRB 4FK5A 1WEOA 5C11A 1WIMA 2PUYA 4YAXA 3NG2A 1X4IA 2YT5A 3MHSA 4XI1A 2VPGA 5LKZA 2L0BA 2LGGA 4UP0A 1JM7A 3SOXA 2KFTA 3SOUA 2KWNA 5DINA 2KWOA 4N3WA 2LRIC 3LRQA 2BAYA 3I2DA 1WE9A 4YC9A 1WEEA 2G6QA 1WEMA 5KH9A 2IDAA 4ZUXU 5TABA 1WGMA 2QIZA 2ECTA 5TDRA 4LJNA 4LKAA 3SHBA 1V87A 4A49A 5C13A 2MA5A 4F52B 4P5OB 3ZYQA 2M85A 2FUIA 3QZVA 2LGVA 2QJ0A 2Y1MA 4I7BA 5JG6A 2KWKA 3N9PA 2CSYA 2MIQA 2VJFA 2YSMA 1IYMA 2Y1NA 1VD4A 2YQLA 2LN0A 1WILA 4LLBA 3ZTGA 5G0FA 1HYIA 2M1RA 1FBVA 5D1MB 4UI9B 4YADA 3N9NA 3RPGC 3ZVZB 4BBQA 2CT2A 5LKXA 4S3OC 3EB5A 1VYXA 1Z2QA 3SOWA 3C5KA 2F42A 4R2YA 2EA6A 2K17A 3KV5A 2YYRA 2JMDA 2ECJA 3N9OA 4X3GA 5I3LA 5G05B 2MD7B 1LDJB 5FB1A 2MUMA 5AITA 2ECWA 2LDRA 3PHDA 5AIUA 4B7YC 2VPDA 5FB0A 4L7XA 2RSDA 2E6SA 3U5NA 1LDKC 4L58A 4YABA 4AYCB 4IC3A 4WZ2A 2VNFA 2VJEB 4PPEA 2G43A 4FIPA 1MM2A 4GNGA 5H1UA 3T6RA 3PURA 2F6NA 5B75A 4B86C 3LQJA 2YUCA 2EGPA 3MHHA 3PUQA 4GNDA 5TRBA 4V3LC 2VP7A 2QICA 2KGIA 2ECGA 4LK9A 3HCTA 2LGKA 5B8DA 3O37A 3N9LA 2CKLB 3KQIA 5EYAF 2YHOA 4ZDTA 5H9MA 1JOCA 2KGGA 2XEUA 3U5MA 3L1XA 3DPLR 2DX8A 4BHWA 2AN6A 4PTBA 2K4DA 2MA6A 3L1ZB 2XB1A 3GV4A 2D8SA 1WEWA
chains in the Genus database with same CATH superfamily
1N87A 1WENA 1ZBDB 2YURA 4O64A 5B77A 1XWHA 3O70A 1HYJA 5H1VA 4AVXA 4YBMA 2B0OE 2DSMA 3O7AA 3GL6A 3U5PA 2EODA 1X4UA 1X4JA 2PNXA 3O35A 1U6GB 2VPBA 2MNZA 4ZQLA 1WEPA 4Q6FA 4NN2A 2YSJA 4WA6A 3FL2A 5KH7A 5B76A 2MNYA 3N9MA 4C9ZA 2L43A 2KE1A 2LXHC 3V43A 2C2VS 2H0DA 3M99A 2OXQC 5D1LB 4YBTA 1RMDA 2JMIA 4WZ3B 4QQ4A 2LXPC 2M3HA 2OWAA 4O62A 2EXUA 4YBSA 4MSXA 2G45A 2LGLA 3N9QA 5LKTA 2ECVA 4I7DA 3HCUA 2VJFB 1CHCA 3DQVR 1DVPA 3FANA 3FJUB 3U5OA 3ZNIA 3LQIA 3L11A 1F62A 1MM3A 1WEUA 2KWJA 5B79A 4W4UA 4MVTA 5FERA 1Z60A 2KIZA 2K1JA 4A0CD 3ZPV1 3HTKC 2CKLA 2YHNA 2YQMA 4Z0RA 4R8PK 2I50A 2L75A 4I7CA 2KKYA 2M6MA 1FP0A 3O47A 5LCWB 2K16A 1BORA 4LADB 3IHPA 2LQ6A 3O33A 2FD4A 1WEVA 2CSZA 3C6WA 4AP4A 3LQHA 4R7EA 3HCSA 3O34A 4N4FA 4GNFA 1K2FA 4A4BA 4QF2A 2HDPA 4CCGX 4CA1A 2FUUA 3ASLA 2KU3A 5KH3A 4GNEA 3LJUX 3ZPVE 3RPGB 1WEQA 2KR4A 3M62A 2MD8C 2KREA 5G04B 2RI7A 5B78A 2YW8A 4S3OB 3M63A 2L5UA 3KV6A 4UP5A 1JM7B 2L80A 4IC2A 3KNVA 5TDWA 4Z0OA 3DWDA 3LVRE 2LV9A 2JRJA 1E4UA 2E61A 2CRWA 3VK6A 3PLWA 2Y43A 3E2DA 3EB6A 5H1TA 2NAAA 5TBNA 2VPEA 3ZVYA 2ECIA 4WZ0A 1Z6UA 3O36A 4AYCA 2VJEA 3LVQE 5LKUA 5D1KB 5J3XA 2MKEA 4V3KC 1WESA 2IQJA 2E6RA 4H9DA 4FJCA 2KYUA 2YREA 1WFKA 5SVIB 2ZETC 4GB0A 2UZGA 4FO9A 1T1HA 2XOZA 1G25A 2HYED 2ECNA 5FEYA 3M7KA 4YATA 3FEHA 2C2LA 2F6JA 2YU4A 2FSAA 3T7LA 4AUQB 2MT5A 2XP0A 4A4CA 2JMJA 2M13A 1VFYA 5DKAA 3JUEA 4QF3A 2H0DB 4TKPB 3RTRB 3FAOA 4FK5A 1WEOA 2LAUA 1WIMA 2FFWA 5C11A 2PUYA 4YAXA 3NG2A 1X4IA 2YT5A 2D8UA 3MHSA 4XI1A 2VPGA 5LKZA 2L0BA 2LGGA 1DCQA 3SUBA 4UP0A 1JM7A 5SVXA 3SOXA 2KFTA 3SOUA 2KWNA 5DINA 2KWOA 4N3WA 2LRIC 3LRQA 2BAYA 3I2DA 1WE9A 4YC9A 1WEEA 2G6QA 1WEMA 5KH9A 2IDAA 4ZUXU 5TABA 1WGMA 2QIZA 2ECTA 5TDRA 4LJNA 4LKAA 3SHBA 1V87A 4A49A 2DJAA 5C13A 2MA5A 2CONA 2XOCA 4F52B 4P5OB 3ZYQA 2M85A 2FUIA 2YVRA 3QZVA 2LGVA 2QJ0A 2Y1MA 2L7PA 4I7BA 3FM8C 5JG6A 4OGCA 2KWKA 3N9PA 4OGEA 5SVIA 2CSYA 2MIQA 2VJFA 2YSMA 2P57A 3KDEC 1IYMA 2Y1NA 2KKXA 1VD4A 2YQLA 2LN0A 1WILA 4LLBA 1MBMA 5G0FA 3ZTGA 1HYIA 2M1RA 1FBVA 5D1MB 4UI9B 2CRRA 4YADA 3LDYA 3N9NA 3RPGC 3ZVZB 4BBQA 2CT2A 5LKXA 4S3OC 3EB5A 1VYXA 1Z2QA 3SOWA 3C5KA 2F42A 4R2YA 2EA6A 2K17A 3KV5A 2YYRA 2JMDA 2ECJA 2CSVA 3N9OA 2EGMA 4X3GA 5I3LA 5G05B 2MD7B 1LDJB 5FB1A 2MUMA 5AITA 2ECWA 2LDRA 3PHDA 5AIUA 4B7YC 2VPDA 5FB0A 4L7XA 2RSDA 5SVYA 2E6SA 3U5NA 1LDKC 4L58A 4YABA 4AYCB 4IC3A 4WZ2A 2VNFA 2VJEB 4PPEA 2G43A 4FIPA 1MM2A 4GNGA 5H1UA 3DDTA 3T6RA 3PURA 2F6NA 5B75A 3Q1DA 4B86C 3LQJA 2YUCA 2EGPA 3MHHA 3PUQA 4GNDA 5TRBA 4V3LC 2VP7A 5K3QA 2QICA 2KGIA 2ECGA 4LK9A 3HCTA 2LGKA 5B8DA 2XOYA 3T9KA 2JM3A 3O37A 3N9LA 2CKLB 3KQIA 5EYAF 2YHOA 4ZDTA 3H7HA 5H9MA 3MDBC 1JOCA 2KGGA 2XEUA 3U5MA 2JUNA 3L1XA 3DPLR 2DX8A 2RR4A 4F1PA 4BHWA 2AN6A 4PTBA 2K4DA 2MA6A 3L1ZB 2XB1A 3GV4A 2D8SA 1WEWA
chains in the Genus database with same CATH topology
1N87A 1WENA 1ZBDB 2YURA 4O64A 5B77A 1XWHA 3O70A 1HYJA 5H1VA 4AVXA 4YBMA 3O7AA 3GL6A 3U5PA 2EODA 1X4UA 1X4JA 2PNXA 3O35A 1U6GB 2VPBA 2MNZA 4ZQLA 1WEPA 4Q6FA 4NN2A 2YSJA 4WA6A 3FL2A 5KH7A 5B76A 2MNYA 3N9MA 4C9ZA 2L43A 2KE1A 2LXHC 3V43A 2C2VS 2H0DA 3M99A 2OXQC 5D1LB 4YBTA 1RMDA 2JMIA 4WZ3B 2LXPC 2M3HA 4YBSA 2G45A 2LGLA 3N9QA 4MSXA 5LKTA 2ECVA 4I7DA 3HCUA 2VJFB 1CHCA 3DQVR 1DVPA 3U5OA 3ZNIA 3LQIA 3L11A 1F62A 1MM3A 1WEUA 2KWJA 5B79A 4W4UA 4MVTA 5FERA 1Z60A 2KIZA 2K1JA 4A0CD 3ZPV1 3HTKC 2CKLA 2YHNA 2YQMA 4R8PK 2I50A 2L75A 4I7CA 2M6MA 1FP0A 5LCWB 2K16A 1BORA 4LADB 3IHPA 2LQ6A 3O33A 1WEVA 2CSZA 3C6WA 4AP4A 3LQHA 4R7EA 3HCSA 3O34A 4N4FA 4GNFA 1K2FA 4A4BA 4QF2A 2HDPA 4CCGX 4CA1A 2FUUA 3ASLA 2KU3A 5KH3A 4GNEA 3ZPVE 3RPGB 1WEQA 2KR4A 3M62A 2MD8C 2KREA 5G04B 2RI7A 5B78A 2YW8A 4S3OB 3M63A 2L5UA 3KV6A 4UP5A 1JM7B 2L80A 4IC2A 3KNVA 5TDWA 2LV9A 2JRJA 1E4UA 3VK6A 2Y43A 3EB6A 5H1TA 2NAAA 5TBNA 2VPEA 3ZVYA 2ECIA 4WZ0A 1Z6UA 3O36A 4AYCA 2VJEA 5LKUA 5D1KB 5J3XA 4V3KC 1WESA 2E6RA 4FJCA 2KYUA 2YREA 1WFKA 2ZETC 4GB0A 2UZGA 4FO9A 1T1HA 1G25A 2HYED 2ECNA 5FEYA 4YATA 2C2LA 2F6JA 2YU4A 2FSAA 3T7LA 4AUQB 2MT5A 4A4CA 2JMJA 1VFYA 5DKAA 4QF3A 2H0DB 4TKPB 3RTRB 4FK5A 1WEOA 5C11A 1WIMA 2PUYA 4YAXA 3NG2A 1X4IA 2YT5A 3MHSA 4XI1A 2VPGA 5LKZA 2L0BA 2LGGA 4UP0A 1JM7A 3SOXA 2KFTA 3SOUA 2KWNA 5DINA 2KWOA 4N3WA 2LRIC 3LRQA 2BAYA 3I2DA 1WE9A 4YC9A 1WEEA 2G6QA 1WEMA 5KH9A 2IDAA 4ZUXU 5TABA 1WGMA 2QIZA 2ECTA 5TDRA 4LJNA 4LKAA 3SHBA 1V87A 4A49A 5C13A 2MA5A 4F52B 4P5OB 3ZYQA 2M85A 2FUIA 3QZVA 2LGVA 2QJ0A 2Y1MA 4I7BA 5JG6A 2KWKA 3N9PA 2CSYA 2MIQA 2VJFA 2YSMA 1IYMA 2Y1NA 1VD4A 2YQLA 2LN0A 1WILA 4LLBA 3ZTGA 5G0FA 1HYIA 2M1RA 1FBVA 5D1MB 4UI9B 4YADA 3N9NA 3RPGC 3ZVZB 4BBQA 2CT2A 5LKXA 4S3OC 3EB5A 1VYXA 1Z2QA 3SOWA 3C5KA 2F42A 4R2YA 2EA6A 2K17A 3KV5A 2YYRA 2JMDA 2ECJA 3N9OA 4X3GA 5I3LA 5G05B 2MD7B 1LDJB 5FB1A 2MUMA 5AITA 2ECWA 2LDRA 3PHDA 5AIUA 4B7YC 2VPDA 5FB0A 4L7XA 2RSDA 2E6SA 3U5NA 1LDKC 4L58A 4YABA 4AYCB 4IC3A 4WZ2A 2VNFA 2VJEB 4PPEA 2G43A 4FIPA 1MM2A 4GNGA 5H1UA 3T6RA 3PURA 2F6NA 5B75A 4B86C 3LQJA 2YUCA 2EGPA 3MHHA 3PUQA 4GNDA 5TRBA 4V3LC 2VP7A 2QICA 2KGIA 2ECGA 4LK9A 3HCTA 2LGKA 5B8DA 3O37A 3N9LA 2CKLB 3KQIA 5EYAF 2YHOA 4ZDTA 5H9MA 1JOCA 2KGGA 2XEUA 3U5MA 3L1XA 3DPLR 2DX8A 4BHWA 2AN6A 4PTBA 2K4DA 2MA6A 3L1ZB 2XB1A 3GV4A 2D8SA 1WEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N87 A;  1WEN A;  1ZBD B;  2YUR A;  4O64 A;  5B77 A;  1XWH A;  3O70 A;  1HYJ A;  5H1V A;  4AVX A;  4YBM A;  3O7A A;  3GL6 A;  3U5P A;  2EOD A;  1X4U A;  1X4J A;  2PNX A;  3O35 A;  1U6G B;  2VPB A;  2MNZ A;  4ZQL A;  1WEP A;  4Q6F A;  4NN2 A;  2YSJ A;  4WA6 A;  3FL2 A;  5KH7 A;  5B76 A;  2MNY A;  3N9M A;  4C9Z A;  2L43 A;  2KE1 A;  2LXH C;  3V43 A;  2C2V S;  2H0D A;  3M99 A;  2OXQ C;  5D1L B;  4YBT A;  1RMD A;  2JMI A;  4WZ3 B;  2LXP C;  2M3H A;  4YBS A;  2G45 A;  2LGL A;  3N9Q A;  4MSX A;  5LKT A;  2ECV A;  4I7D A;  3HCU A;  2VJF B;  1CHC A;  3DQV R;  1DVP A;  3U5O A;  3ZNI A;  3LQI A;  3L11 A;  1F62 A;  1MM3 A;  1WEU A;  2KWJ A;  5B79 A;  4W4U A;  4MVT A;  5FER A;  1Z60 A;  2KIZ A;  2K1J A;  4A0C D;  3ZPV 1;  3HTK C;  2CKL A;  2YHN A;  2YQM A;  4R8P K;  2I50 A;  2L75 A;  4I7C A;  2M6M A;  1FP0 A;  5LCW B;  2K16 A;  1BOR A;  4LAD B;  3IHP A;  2LQ6 A;  3O33 A;  1WEV A;  2CSZ A;  3C6W A;  4AP4 A;  3LQH A;  4R7E A;  3HCS A;  3O34 A;  4N4F A;  4GNF A;  1K2F A;  4A4B A;  4QF2 A;  2HDP A;  4CCG X;  4CA1 A;  2FUU A;  3ASL A;  2KU3 A;  5KH3 A;  4GNE A;  3ZPV E;  3RPG B;  1WEQ A;  2KR4 A;  3M62 A;  2MD8 C;  2KRE A;  5G04 B;  2RI7 A;  5B78 A;  2YW8 A;  4S3O B;  3M63 A;  2L5U A;  3KV6 A;  4UP5 A;  1JM7 B;  2L80 A;  4IC2 A;  3KNV A;  5TDW A;  2LV9 A;  2JRJ A;  1E4U A;  3VK6 A;  2Y43 A;  3EB6 A;  5H1T A;  2NAA A;  5TBN A;  2VPE A;  3ZVY A;  2ECI A;  4WZ0 A;  1Z6U A;  3O36 A;  4AYC A;  2VJE A;  5LKU A;  5D1K B;  5J3X A;  4V3K C;  1WES A;  2E6R A;  4FJC A;  2KYU A;  2YRE A;  1WFK A;  2ZET C;  4GB0 A;  2UZG A;  4FO9 A;  1T1H A;  1G25 A;  2HYE D;  2ECN A;  5FEY A;  4YAT A;  2C2L A;  2F6J A;  2YU4 A;  2FSA A;  3T7L A;  4AUQ B;  2MT5 A;  4A4C A;  2JMJ A;  1VFY A;  5DKA A;  4QF3 A;  2H0D B;  4TKP B;  3RTR B;  4FK5 A;  1WEO A;  5C11 A;  1WIM A;  2PUY A;  4YAX A;  3NG2 A;  1X4I A;  2YT5 A;  3MHS A;  4XI1 A;  2VPG A;  5LKZ A;  2L0B A;  2LGG A;  4UP0 A;  1JM7 A;  3SOX A;  2KFT A;  3SOU A;  2KWN A;  5DIN A;  2KWO A;  4N3W A;  2LRI C;  3LRQ A;  2BAY A;  3I2D A;  1WE9 A;  4YC9 A;  1WEE A;  2G6Q A;  1WEM A;  5KH9 A;  2IDA A;  4ZUX U;  5TAB A;  1WGM A;  2QIZ A;  2ECT A;  5TDR A;  4LJN A;  4LKA A;  3SHB A;  1V87 A;  4A49 A;  5C13 A;  2MA5 A;  4F52 B;  4P5O B;  3ZYQ A;  2M85 A;  2FUI A;  3QZV A;  2LGV A;  2QJ0 A;  2Y1M A;  4I7B A;  5JG6 A;  2KWK A;  3N9P A;  2CSY A;  2MIQ A;  2VJF A;  2YSM A;  1IYM A;  2Y1N A;  1VD4 A;  2YQL A;  2LN0 A;  1WIL A;  4LLB A;  3ZTG A;  5G0F A;  1HYI A;  2M1R A;  1FBV A;  5D1M B;  4UI9 B;  4YAD A;  3N9N A;  3RPG C;  3ZVZ B;  4BBQ A;  2CT2 A;  5LKX A;  4S3O C;  3EB5 A;  1VYX A;  1Z2Q A;  3SOW A;  3C5K A;  2F42 A;  4R2Y A;  2EA6 A;  2K17 A;  3KV5 A;  2YYR A;  2JMD A;  2ECJ A;  3N9O A;  4X3G A;  5I3L A;  5G05 B;  2MD7 B;  1LDJ B;  5FB1 A;  2MUM A;  5AIT A;  2ECW A;  2LDR A;  3PHD A;  5AIU A;  4B7Y C;  2VPD A;  5FB0 A;  4L7X A;  2RSD A;  2E6S A;  3U5N A;  1LDK C;  4L58 A;  4YAB A;  4AYC B;  4IC3 A;  4WZ2 A;  2VNF A;  2VJE B;  4PPE A;  2G43 A;  4FIP A;  1MM2 A;  4GNG A;  5H1U A;  3T6R A;  3PUR A;  2F6N A;  5B75 A;  4B86 C;  3LQJ A;  2YUC A;  2EGP A;  3MHH A;  3PUQ A;  4GND A;  5TRB A;  4V3L C;  2VP7 A;  2QIC A;  2KGI A;  2ECG A;  4LK9 A;  3HCT A;  2LGK A;  5B8D A;  3O37 A;  3N9L A;  2CKL B;  3KQI A;  5EYA F;  2YHO A;  4ZDT A;  5H9M A;  1JOC A;  2KGG A;  2XEU A;  3U5M A;  3L1X A;  3DPL R;  2DX8 A;  4BHW A;  2AN6 A;  4PTB A;  2K4D A;  2MA6 A;  3L1Z B;  2XB1 A;  3GV4 A;  2D8S A;  1WEW A; 
#chains in the Genus database with same CATH topology
 1N87 A;  1WEN A;  1ZBD B;  2YUR A;  4O64 A;  5B77 A;  1XWH A;  3O70 A;  1HYJ A;  5H1V A;  4AVX A;  4YBM A;  2B0O E;  2DSM A;  3O7A A;  3GL6 A;  3U5P A;  2EOD A;  1X4U A;  1X4J A;  2PNX A;  3O35 A;  1U6G B;  2VPB A;  2MNZ A;  4ZQL A;  1WEP A;  4Q6F A;  4NN2 A;  2YSJ A;  4WA6 A;  3FL2 A;  5KH7 A;  5B76 A;  2MNY A;  3N9M A;  4C9Z A;  2L43 A;  2KE1 A;  2LXH C;  3V43 A;  2C2V S;  2H0D A;  3M99 A;  2OXQ C;  5D1L B;  4YBT A;  1RMD A;  2JMI A;  4WZ3 B;  4QQ4 A;  2LXP C;  2M3H A;  2OWA A;  4O62 A;  2EXU A;  4YBS A;  4MSX A;  2G45 A;  2LGL A;  3N9Q A;  5LKT A;  2ECV A;  4I7D A;  3HCU A;  2VJF B;  1CHC A;  3DQV R;  1DVP A;  3FAN A;  3FJU B;  3U5O A;  3ZNI A;  3LQI A;  3L11 A;  1F62 A;  1MM3 A;  1WEU A;  2KWJ A;  5B79 A;  4W4U A;  4MVT A;  5FER A;  1Z60 A;  2KIZ A;  2K1J A;  4A0C D;  3ZPV 1;  3HTK C;  2CKL A;  2YHN A;  2YQM A;  4Z0R A;  4R8P K;  2I50 A;  2L75 A;  4I7C A;  2KKY A;  2M6M A;  1FP0 A;  3O47 A;  5LCW B;  2K16 A;  1BOR A;  4LAD B;  3IHP A;  2LQ6 A;  3O33 A;  2FD4 A;  1WEV A;  2CSZ A;  3C6W A;  4AP4 A;  3LQH A;  4R7E A;  3HCS A;  3O34 A;  4N4F A;  4GNF A;  1K2F A;  4A4B A;  4QF2 A;  2HDP A;  4CCG X;  4CA1 A;  2FUU A;  3ASL A;  2KU3 A;  5KH3 A;  4GNE A;  3LJU X;  3ZPV E;  3RPG B;  1WEQ A;  2KR4 A;  3M62 A;  2MD8 C;  2KRE A;  5G04 B;  2RI7 A;  5B78 A;  2YW8 A;  4S3O B;  3M63 A;  2L5U A;  3KV6 A;  4UP5 A;  1JM7 B;  2L80 A;  4IC2 A;  3KNV A;  5TDW A;  4Z0O A;  3DWD A;  3LVR E;  2LV9 A;  2JRJ A;  1E4U A;  2E61 A;  2CRW A;  3VK6 A;  3PLW A;  2Y43 A;  3E2D A;  3EB6 A;  5H1T A;  2NAA A;  5TBN A;  2VPE A;  3ZVY A;  2ECI A;  4WZ0 A;  1Z6U A;  3O36 A;  4AYC A;  2VJE A;  3LVQ E;  5LKU A;  5D1K B;  5J3X A;  2MKE A;  4V3K C;  1WES A;  2IQJ A;  2E6R A;  4H9D A;  4FJC A;  2KYU A;  2YRE A;  1WFK A;  5SVI B;  2ZET C;  4GB0 A;  2UZG A;  4FO9 A;  1T1H A;  2XOZ A;  1G25 A;  2HYE D;  2ECN A;  5FEY A;  3M7K A;  4YAT A;  3FEH A;  2C2L A;  2F6J A;  2YU4 A;  2FSA A;  3T7L A;  4AUQ B;  2MT5 A;  2XP0 A;  4A4C A;  2JMJ A;  2M13 A;  1VFY A;  5DKA A;  3JUE A;  4QF3 A;  2H0D B;  4TKP B;  3RTR B;  3FAO A;  4FK5 A;  1WEO A;  2LAU A;  1WIM A;  2FFW A;  5C11 A;  2PUY A;  4YAX A;  3NG2 A;  1X4I A;  2YT5 A;  2D8U A;  3MHS A;  4XI1 A;  2VPG A;  5LKZ A;  2L0B A;  2LGG A;  1DCQ A;  3SUB A;  4UP0 A;  1JM7 A;  5SVX A;  3SOX A;  2KFT A;  3SOU A;  2KWN A;  5DIN A;  2KWO A;  4N3W A;  2LRI C;  3LRQ A;  2BAY A;  3I2D A;  1WE9 A;  4YC9 A;  1WEE A;  2G6Q A;  1WEM A;  5KH9 A;  2IDA A;  4ZUX U;  5TAB A;  1WGM A;  2QIZ A;  2ECT A;  5TDR A;  4LJN A;  4LKA A;  3SHB A;  1V87 A;  4A49 A;  2DJA A;  5C13 A;  2MA5 A;  2CON A;  2XOC A;  4F52 B;  4P5O B;  3ZYQ A;  2M85 A;  2FUI A;  2YVR A;  3QZV A;  2LGV A;  2QJ0 A;  2Y1M A;  2L7P A;  4I7B A;  3FM8 C;  5JG6 A;  4OGC A;  2KWK A;  3N9P A;  4OGE A;  5SVI A;  2CSY A;  2MIQ A;  2VJF A;  2YSM A;  2P57 A;  3KDE C;  1IYM A;  2Y1N A;  2KKX A;  1VD4 A;  2YQL A;  2LN0 A;  1WIL A;  4LLB A;  1MBM A;  5G0F A;  3ZTG A;  1HYI A;  2M1R A;  1FBV A;  5D1M B;  4UI9 B;  2CRR A;  4YAD A;  3LDY A;  3N9N A;  3RPG C;  3ZVZ B;  4BBQ A;  2CT2 A;  5LKX A;  4S3O C;  3EB5 A;  1VYX A;  1Z2Q A;  3SOW A;  3C5K A;  2F42 A;  4R2Y A;  2EA6 A;  2K17 A;  3KV5 A;  2YYR A;  2JMD A;  2ECJ A;  2CSV A;  3N9O A;  2EGM A;  4X3G A;  5I3L A;  5G05 B;  2MD7 B;  1LDJ B;  5FB1 A;  2MUM A;  5AIT A;  2ECW A;  2LDR A;  3PHD A;  5AIU A;  4B7Y C;  2VPD A;  5FB0 A;  4L7X A;  2RSD A;  5SVY A;  2E6S A;  3U5N A;  1LDK C;  4L58 A;  4YAB A;  4AYC B;  4IC3 A;  4WZ2 A;  2VNF A;  2VJE B;  4PPE A;  2G43 A;  4FIP A;  1MM2 A;  4GNG A;  5H1U A;  3DDT A;  3T6R A;  3PUR A;  2F6N A;  5B75 A;  3Q1D A;  4B86 C;  3LQJ A;  2YUC A;  2EGP A;  3MHH A;  3PUQ A;  4GND A;  5TRB A;  4V3L C;  2VP7 A;  5K3Q A;  2QIC A;  2KGI A;  2ECG A;  4LK9 A;  3HCT A;  2LGK A;  5B8D A;  2XOY A;  3T9K A;  2JM3 A;  3O37 A;  3N9L A;  2CKL B;  3KQI A;  5EYA F;  2YHO A;  4ZDT A;  3H7H A;  5H9M A;  3MDB C;  1JOC A;  2KGG A;  2XEU A;  3U5M A;  2JUN A;  3L1X A;  3DPL R;  2DX8 A;  2RR4 A;  4F1P A;  4BHW A;  2AN6 A;  4PTB A;  2K4D A;  2MA6 A;  3L1Z B;  2XB1 A;  3GV4 A;  2D8S A;  1WEW A; 
#chains in the Genus database with same CATH homology
 1N87 A;  1WEN A;  1ZBD B;  2YUR A;  4O64 A;  5B77 A;  1XWH A;  3O70 A;  1HYJ A;  5H1V A;  4AVX A;  4YBM A;  3O7A A;  3GL6 A;  3U5P A;  2EOD A;  1X4U A;  1X4J A;  2PNX A;  3O35 A;  1U6G B;  2VPB A;  2MNZ A;  4ZQL A;  1WEP A;  4Q6F A;  4NN2 A;  2YSJ A;  4WA6 A;  3FL2 A;  5KH7 A;  5B76 A;  2MNY A;  3N9M A;  4C9Z A;  2L43 A;  2KE1 A;  2LXH C;  3V43 A;  2C2V S;  2H0D A;  3M99 A;  2OXQ C;  5D1L B;  4YBT A;  1RMD A;  2JMI A;  4WZ3 B;  2LXP C;  2M3H A;  4YBS A;  2G45 A;  2LGL A;  3N9Q A;  4MSX A;  5LKT A;  2ECV A;  4I7D A;  3HCU A;  2VJF B;  1CHC A;  3DQV R;  1DVP A;  3U5O A;  3ZNI A;  3LQI A;  3L11 A;  1F62 A;  1MM3 A;  1WEU A;  2KWJ A;  5B79 A;  4W4U A;  4MVT A;  5FER A;  1Z60 A;  2KIZ A;  2K1J A;  4A0C D;  3ZPV 1;  3HTK C;  2CKL A;  2YHN A;  2YQM A;  4R8P K;  2I50 A;  2L75 A;  4I7C A;  2M6M A;  1FP0 A;  5LCW B;  2K16 A;  1BOR A;  4LAD B;  3IHP A;  2LQ6 A;  3O33 A;  1WEV A;  2CSZ A;  3C6W A;  4AP4 A;  3LQH A;  4R7E A;  3HCS A;  3O34 A;  4N4F A;  4GNF A;  1K2F A;  4A4B A;  4QF2 A;  2HDP A;  4CCG X;  4CA1 A;  2FUU A;  3ASL A;  2KU3 A;  5KH3 A;  4GNE A;  3ZPV E;  3RPG B;  1WEQ A;  2KR4 A;  3M62 A;  2MD8 C;  2KRE A;  5G04 B;  2RI7 A;  5B78 A;  2YW8 A;  4S3O B;  3M63 A;  2L5U A;  3KV6 A;  4UP5 A;  1JM7 B;  2L80 A;  4IC2 A;  3KNV A;  5TDW A;  2LV9 A;  2JRJ A;  1E4U A;  3VK6 A;  2Y43 A;  3EB6 A;  5H1T A;  2NAA A;  5TBN A;  2VPE A;  3ZVY A;  2ECI A;  4WZ0 A;  1Z6U A;  3O36 A;  4AYC A;  2VJE A;  5LKU A;  5D1K B;  5J3X A;  4V3K C;  1WES A;  2E6R A;  4FJC A;  2KYU A;  2YRE A;  1WFK A;  2ZET C;  4GB0 A;  2UZG A;  4FO9 A;  1T1H A;  1G25 A;  2HYE D;  2ECN A;  5FEY A;  4YAT A;  2C2L A;  2F6J A;  2YU4 A;  2FSA A;  3T7L A;  4AUQ B;  2MT5 A;  4A4C A;  2JMJ A;  1VFY A;  5DKA A;  4QF3 A;  2H0D B;  4TKP B;  3RTR B;  4FK5 A;  1WEO A;  5C11 A;  1WIM A;  2PUY A;  4YAX A;  3NG2 A;  1X4I A;  2YT5 A;  3MHS A;  4XI1 A;  2VPG A;  5LKZ A;  2L0B A;  2LGG A;  4UP0 A;  1JM7 A;  3SOX A;  2KFT A;  3SOU A;  2KWN A;  5DIN A;  2KWO A;  4N3W A;  2LRI C;  3LRQ A;  2BAY A;  3I2D A;  1WE9 A;  4YC9 A;  1WEE A;  2G6Q A;  1WEM A;  5KH9 A;  2IDA A;  4ZUX U;  5TAB A;  1WGM A;  2QIZ A;  2ECT A;  5TDR A;  4LJN A;  4LKA A;  3SHB A;  1V87 A;  4A49 A;  5C13 A;  2MA5 A;  4F52 B;  4P5O B;  3ZYQ A;  2M85 A;  2FUI A;  3QZV A;  2LGV A;  2QJ0 A;  2Y1M A;  4I7B A;  5JG6 A;  2KWK A;  3N9P A;  2CSY A;  2MIQ A;  2VJF A;  2YSM A;  1IYM A;  2Y1N A;  1VD4 A;  2YQL A;  2LN0 A;  1WIL A;  4LLB A;  3ZTG A;  5G0F A;  1HYI A;  2M1R A;  1FBV A;  5D1M B;  4UI9 B;  4YAD A;  3N9N A;  3RPG C;  3ZVZ B;  4BBQ A;  2CT2 A;  5LKX A;  4S3O C;  3EB5 A;  1VYX A;  1Z2Q A;  3SOW A;  3C5K A;  2F42 A;  4R2Y A;  2EA6 A;  2K17 A;  3KV5 A;  2YYR A;  2JMD A;  2ECJ A;  3N9O A;  4X3G A;  5I3L A;  5G05 B;  2MD7 B;  1LDJ B;  5FB1 A;  2MUM A;  5AIT A;  2ECW A;  2LDR A;  3PHD A;  5AIU A;  4B7Y C;  2VPD A;  5FB0 A;  4L7X A;  2RSD A;  2E6S A;  3U5N A;  1LDK C;  4L58 A;  4YAB A;  4AYC B;  4IC3 A;  4WZ2 A;  2VNF A;  2VJE B;  4PPE A;  2G43 A;  4FIP A;  1MM2 A;  4GNG A;  5H1U A;  3T6R A;  3PUR A;  2F6N A;  5B75 A;  4B86 C;  3LQJ A;  2YUC A;  2EGP A;  3MHH A;  3PUQ A;  4GND A;  5TRB A;  4V3L C;  2VP7 A;  2QIC A;  2KGI A;  2ECG A;  4LK9 A;  3HCT A;  2LGK A;  5B8D A;  3O37 A;  3N9L A;  2CKL B;  3KQI A;  5EYA F;  2YHO A;  4ZDT A;  5H9M A;  1JOC A;  2KGG A;  2XEU A;  3U5M A;  3L1X A;  3DPL R;  2DX8 A;  4BHW A;  2AN6 A;  4PTB A;  2K4D A;  2MA6 A;  3L1Z B;  2XB1 A;  3GV4 A;  2D8S A;  1WEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...