1Z60A

Solution structure of the carboxy-terminal domain of human tfiih p44 subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
b'LDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHSCPGCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TFIIH basal transcription factor complex p44 subunit
publication title Solution structure of the C-terminal domain of TFIIH P44 subunit reveals a novel type of C4C4 ring domain involved in protein-protein interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 7
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1z60A00
1FBVA 5DINA 2VJFB 3HTKC 2L80A 3O37A 3IHPA 2G45A 2YURA 5KH9A 3N9NA 2VPEA 2LRIC 2VPDA 5B77A 4GNDA 2EA6A 1WEMA 2EODA 2ECGA 2C2LA 4PTBA 1HYIA 3N9LA 4O64A 1WEVA 1WIMA 3M63A 2HDPA 2YT5A 4AP4A 5B75A 3RPGB 3ZYQA 1WEOA 4I7DA 2KGIA 4IC2A 4GB0A 3PUQA 5TRBA 4GNFA 3HCSA 1JOCA 3KV5A 4LLBA 4AUQB 5JG6A 3U5MA 1WFKA 2HYED 2RSDA 4UP0A 1VYXA 2YREA 2C2VS 2M85A 1Z2QA 5B76A 4LADB 1Z6UA 5B79A 5I3LA 5H1UA 1X4UA 1BORA 5FEYA 2DX8A 2F42A 1E4UA 5DKAA 1U6GB 2F6JA 5C11A 2LGLA 3PURA 2PUYA 2IDAA 4FJCA 2KGGA 3U5NA 4A49A 3T6RA 3EB5A 3O7AA 1F62A 2K17A 4L7XA 4N4FA 2YQMA 1V87A 2KE1A 5D1LB 2VJEA 2E6RA 3N9OA 3FL2A 1CHCA 2KYUA 5FERA 2JMJA 1Z60A 2KIZA 2NAAA 3M99A 5EYAF 5LKUA 3C6WA 4YBMA 4AYCB 4S3OB 3KNVA 5C13A 3T7LA 4F52B 2YQLA 2VPBA 3SHBA 2MA6A 4GNEA 2LQ6A 2YU4A 3O70A 2YUCA 4WA6A 2KR4A 3PHDA 5TDRA 4A0CD 2ECWA 5LKTA 4UP5A 1JM7A 2CKLB 2PNXA 2K16A 2ECVA 2M6MA 4UI9B 2QJ0A 2L43A 5LKXA 3LQJA 2JRJA 2FUUA 2D8SA 2YHOA 3KQIA 4W4UA 2ZETC 2YW8A 1IYMA 2RI7A 4XI1A 5TBNA 3ZNIA 1WEPA 3LQHA 3O34A 2LN0A 2H0DA 1WESA 2K1JA 5B8DA 1WEUA 4Q6FA 2G43A 2LDRA 1G25A 2QICA 2MIQA 3NG2A 5H1TA 3V43A 1N87A 4NN2A 2M3HA 3M62A 4GNGA 1VD4A 3HCUA 1FP0A 4S3OC 5FB0A 3O36A 5G04B 2UZGA 5B78A 2Y1MA 4LK9A 1HYJA 4R7EA 4BHWA 3C5KA 4YAXA 1WE9A 2Y43A 2F6NA 2E6SA 2FUIA 3ASLA 4WZ3B 4BBQA 2K4DA 4IC3A 4WZ2A 1DVPA 4AVXA 2MD8C 3ZTGA 4ZQLA 3DPLR 5H9MA 2YSJA 2MA5A 3RPGC 4YBTA 5LKZA 4N3WA 4MVTA 4LJNA 3L1ZB 4QF3A 2L75A 3QZVA 5G0FA 4A4BA 2CT2A 4V3LC 2LGVA 2VJEB 1ZBDB 2XEUA 1LDKC 4A4CA 3U5PA 1LDJB 5AIUA 2VJFA 4TKPB 5J3XA 3L11A 5D1KB 2JMIA 5H1VA 3MHSA 2ECIA 1K2FA 1MM3A 4B86C 4V3KC 2YHNA 2G6QA 2M1RA 2KFTA 3LQIA 1WEEA 5G05B 3KV6A 2MT5A 2ECTA 2AN6A 4QF2A 5FB1A 3ZVYA 2MNZA 2KWKA 4MSXA 1JM7B 3LRQA 1WEWA 1X4JA 2MUMA 2KREA 4YADA 4FO9A 1WENA 2VP7A 3MHHA 2LV9A 4YABA 3N9PA 2LGGA 1XWHA 5AITA 1X4IA 2BAYA 2ECJA 5LCWB 3ZVZB 2MD7B 2H0DB 2MNYA 1WEQA 1WGMA 4I7CA 4CCGX 3SOUA 1RMDA 3N9QA 5KH3A 2Y1NA 3O33A 1T1HA 5TDWA 1VFYA 3L1XA 4PPEA 4R8PK 3O35A 2OXQC 2QIZA 4I7BA 2CSYA 4X3GA 2CSZA 2KU3A 3HCTA 3GL6A 5D1MB 3DQVR 3U5OA 2ECNA 3SOWA 2I50A 2KWJA 5KH7A 2KWOA 2YYRA 2YSMA 2LGKA 1MM2A 3RTRB 2LXHC 4P5OB 4L58A 4C9ZA 5TABA 3VK6A 2VPGA 4CA1A 3EB6A 4B7YC 3N9MA 2FSAA 4YBSA 4ZDTA 2L5UA 4ZUXU 2XB1A 3SOXA 4FIPA 4WZ0A 2JMDA 3ZPVE 4R2YA 4AYCA 4LKAA 2KWNA 3GV4A 4YC9A 4FK5A 1WILA 2EGPA 2LXPC 2L0BA 4YATA 3I2DA 3ZPV1 2VNFA 2CKLA
chains in the Genus database with same CATH superfamily
1FBVA 2D8UA 5DINA 2VJFB 3HTKC 2XOCA 2L80A 3O37A 3IHPA 2E61A 2G45A 2YURA 5KH9A 3N9NA 5SVIB 2VPEA 2LRIC 2VPDA 5B77A 4GNDA 2EA6A 1WEMA 2EODA 2ECGA 2C2LA 4PTBA 1HYIA 3LJUX 3N9LA 5SVXA 4O64A 1WEVA 1WIMA 3M63A 2HDPA 2YT5A 2CONA 4AP4A 5B75A 3RPGB 3ZYQA 1WEOA 4I7DA 2KGIA 4IC2A 4GB0A 3PUQA 5TRBA 2RR4A 4GNFA 3HCSA 1JOCA 3KV5A 4LLBA 4AUQB 3LVQE 5JG6A 3U5MA 1WFKA 2HYED 2RSDA 4UP0A 1VYXA 2YREA 2C2VS 2M85A 1Z2QA 5B76A 4Z0OA 4LADB 1Z6UA 2OWAA 5B79A 5I3LA 5H1UA 1X4UA 1BORA 2P57A 5FEYA 2DX8A 2F42A 3FANA 1E4UA 5DKAA 1U6GB 2F6JA 5C11A 2LGLA 3PURA 2PUYA 2IDAA 4FJCA 2JUNA 2KGGA 3U5NA 4A49A 3T6RA 3Q1DA 3EB5A 3O7AA 2DSMA 1F62A 2K17A 4L7XA 4N4FA 2YQMA 1V87A 1MBMA 2CSVA 2KE1A 5D1LB 2VJEA 2E6RA 3N9OA 3FL2A 2L7PA 1CHCA 2KYUA 5FERA 2JMJA 4QQ4A 1Z60A 2KIZA 2NAAA 3M99A 5EYAF 5LKUA 3C6WA 4YBMA 2XOYA 3LDYA 4AYCB 4S3OB 3KNVA 5C13A 3T7LA 4F52B 2YQLA 2VPBA 3SHBA 2MA6A 4GNEA 2LQ6A 2YU4A 2JM3A 3T9KA 3O70A 2YUCA 4WA6A 2EGMA 2KR4A 3PHDA 5TDRA 4A0CD 2ECWA 5LKTA 4UP5A 1JM7A 2FD4A 2CRWA 2CKLB 2PNXA 2K16A 2ECVA 2M6MA 4UI9B 2QJ0A 2L43A 5LKXA 3LQJA 2JRJA 2FUUA 2D8SA 2YHOA 3KQIA 4W4UA 2ZETC 2YW8A 1IYMA 2RI7A 4XI1A 5TBNA 3ZNIA 1WEPA 3LQHA 3O34A 2LN0A 2H0DA 1WESA 2K1JA 5B8DA 1WEUA 4Q6FA 2G43A 2LDRA 1G25A 2QICA 3DWDA 2MIQA 3NG2A 5H1TA 2XOZA 3V43A 1N87A 4NN2A 2M3HA 1DCQA 3M62A 3FJUB 4GNGA 1VD4A 3HCUA 1FP0A 4S3OC 5FB0A 3FEHA 3O36A 5G04B 2LAUA 2UZGA 5B78A 2Y1MA 4LK9A 1HYJA 4R7EA 4BHWA 3C5KA 4YAXA 1WE9A 2Y43A 3H7HA 2F6NA 2E6SA 2FUIA 4OGCA 3ASLA 4WZ3B 4BBQA 2K4DA 4IC3A 4OGEA 4WZ2A 1DVPA 4AVXA 2MD8C 3ZTGA 4ZQLA 3DPLR 5H9MA 2YSJA 2KKYA 2MA5A 3SUBA 3RPGC 4YBTA 5SVYA 5LKZA 4N3WA 2FFWA 4MVTA 4LJNA 3L1ZB 4QF3A 3KDEC 2L75A 3QZVA 4H9DA 5G0FA 4A4BA 2CT2A 2KKXA 4V3LC 2LGVA 2VJEB 1ZBDB 2XEUA 1LDKC 4A4CA 3U5PA 1LDJB 5AIUA 2VJFA 4O62A 4TKPB 5J3XA 3L11A 5D1KB 3FM8C 2JMIA 5H1VA 3MHSA 5SVIA 2ECIA 2DJAA 1K2FA 1MM3A 4B86C 4V3KC 2YHNA 2G6QA 2M1RA 2KFTA 3LQIA 1WEEA 5G05B 3FAOA 3KV6A 2MT5A 2ECTA 3DDTA 2AN6A 4QF2A 5FB1A 3ZVYA 4F1PA 2MNZA 2KWKA 4MSXA 1JM7B 3LRQA 4Z0RA 1WEWA 2MKEA 1X4JA 2MUMA 2KREA 4YADA 4FO9A 1WENA 2VP7A 3MHHA 2LV9A 4YABA 3N9PA 2LGGA 1XWHA 5AITA 1X4IA 2BAYA 2ECJA 2IQJA 5LCWB 3ZVZB 2MD7B 2H0DB 2MNYA 3E2DA 1WEQA 1WGMA 4I7CA 4CCGX 2XP0A 3SOUA 1RMDA 2EXUA 3N9QA 3JUEA 5KH3A 2Y1NA 3O33A 1T1HA 3L1XA 1VFYA 5TDWA 4PPEA 4R8PK 3O35A 2OXQC 2QIZA 4I7BA 3O47A 2CSYA 4X3GA 2CSZA 2YVRA 2KU3A 3HCTA 3GL6A 5D1MB 3DQVR 3LVRE 3U5OA 2ECNA 3SOWA 2I50A 2KWJA 5KH7A 2KWOA 2YYRA 2YSMA 2LGKA 1MM2A 3RTRB 2LXHC 4P5OB 4L58A 4C9ZA 5TABA 3VK6A 2VPGA 3MDBC 4CA1A 3EB6A 2CRRA 4B7YC 2B0OE 2FSAA 3N9MA 4YBSA 5K3QA 3PLWA 4ZDTA 2L5UA 4ZUXU 2XB1A 3SOXA 4FIPA 4WZ0A 2JMDA 3ZPVE 4R2YA 4AYCA 4LKAA 2KWNA 3GV4A 4YC9A 4FK5A 1WILA 2M13A 2EGPA 2LXPC 2L0BA 4YATA 3I2DA 3M7KA 3ZPV1 2VNFA 2CKLA
chains in the Genus database with same CATH topology
1FBVA 5DINA 2VJFB 3HTKC 2L80A 3O37A 3IHPA 2G45A 2YURA 5KH9A 3N9NA 2VPEA 2LRIC 2VPDA 5B77A 4GNDA 2EA6A 1WEMA 2EODA 2ECGA 2C2LA 4PTBA 1HYIA 3N9LA 4O64A 1WEVA 1WIMA 3M63A 2HDPA 2YT5A 4AP4A 5B75A 3RPGB 3ZYQA 1WEOA 4I7DA 2KGIA 4IC2A 4GB0A 3PUQA 5TRBA 4GNFA 3HCSA 1JOCA 3KV5A 4LLBA 4AUQB 5JG6A 3U5MA 1WFKA 2HYED 2RSDA 4UP0A 1VYXA 2YREA 2C2VS 2M85A 1Z2QA 5B76A 4LADB 1Z6UA 5B79A 5I3LA 5H1UA 1X4UA 1BORA 5FEYA 2DX8A 2F42A 1E4UA 5DKAA 1U6GB 2F6JA 5C11A 2LGLA 3PURA 2PUYA 2IDAA 4FJCA 2KGGA 3U5NA 4A49A 3T6RA 3EB5A 3O7AA 1F62A 2K17A 4L7XA 4N4FA 2YQMA 1V87A 2KE1A 5D1LB 2VJEA 2E6RA 3N9OA 3FL2A 1CHCA 2KYUA 5FERA 2JMJA 1Z60A 2KIZA 2NAAA 3M99A 5EYAF 5LKUA 3C6WA 4YBMA 4AYCB 4S3OB 3KNVA 5C13A 3T7LA 4F52B 2YQLA 2VPBA 3SHBA 2MA6A 4GNEA 2LQ6A 2YU4A 3O70A 2YUCA 4WA6A 2KR4A 3PHDA 5TDRA 4A0CD 2ECWA 5LKTA 4UP5A 1JM7A 2CKLB 2PNXA 2K16A 2ECVA 2M6MA 4UI9B 2QJ0A 2L43A 5LKXA 3LQJA 2JRJA 2FUUA 2D8SA 2YHOA 3KQIA 4W4UA 2ZETC 2YW8A 1IYMA 2RI7A 4XI1A 5TBNA 3ZNIA 1WEPA 3LQHA 3O34A 2LN0A 2H0DA 1WESA 2K1JA 5B8DA 1WEUA 4Q6FA 2G43A 2LDRA 1G25A 2QICA 2MIQA 3NG2A 5H1TA 3V43A 1N87A 4NN2A 2M3HA 3M62A 4GNGA 1VD4A 3HCUA 1FP0A 4S3OC 5FB0A 3O36A 5G04B 2UZGA 5B78A 2Y1MA 4LK9A 1HYJA 4R7EA 4BHWA 3C5KA 4YAXA 1WE9A 2Y43A 2F6NA 2E6SA 2FUIA 3ASLA 4WZ3B 4BBQA 2K4DA 4IC3A 4WZ2A 1DVPA 4AVXA 2MD8C 3ZTGA 4ZQLA 3DPLR 5H9MA 2YSJA 2MA5A 3RPGC 4YBTA 5LKZA 4N3WA 4MVTA 4LJNA 3L1ZB 4QF3A 2L75A 3QZVA 5G0FA 4A4BA 2CT2A 4V3LC 2LGVA 2VJEB 1ZBDB 2XEUA 1LDKC 4A4CA 3U5PA 1LDJB 5AIUA 2VJFA 4TKPB 5J3XA 3L11A 5D1KB 2JMIA 5H1VA 3MHSA 2ECIA 1K2FA 1MM3A 4B86C 4V3KC 2YHNA 2G6QA 2M1RA 2KFTA 3LQIA 1WEEA 5G05B 3KV6A 2MT5A 2ECTA 2AN6A 4QF2A 5FB1A 3ZVYA 2MNZA 2KWKA 4MSXA 1JM7B 3LRQA 1WEWA 1X4JA 2MUMA 2KREA 4YADA 4FO9A 1WENA 2VP7A 3MHHA 2LV9A 4YABA 3N9PA 2LGGA 1XWHA 5AITA 1X4IA 2BAYA 2ECJA 5LCWB 3ZVZB 2MD7B 2H0DB 2MNYA 1WEQA 1WGMA 4I7CA 4CCGX 3SOUA 1RMDA 3N9QA 5KH3A 2Y1NA 3O33A 1T1HA 5TDWA 1VFYA 3L1XA 4PPEA 4R8PK 3O35A 2OXQC 2QIZA 4I7BA 2CSYA 4X3GA 2CSZA 2KU3A 3HCTA 3GL6A 5D1MB 3DQVR 3U5OA 2ECNA 3SOWA 2I50A 2KWJA 5KH7A 2KWOA 2YYRA 2YSMA 2LGKA 1MM2A 3RTRB 2LXHC 4P5OB 4L58A 4C9ZA 5TABA 3VK6A 2VPGA 4CA1A 3EB6A 4B7YC 3N9MA 2FSAA 4YBSA 4ZDTA 2L5UA 4ZUXU 2XB1A 3SOXA 4FIPA 4WZ0A 2JMDA 3ZPVE 4R2YA 4AYCA 4LKAA 2KWNA 3GV4A 4YC9A 4FK5A 1WILA 2EGPA 2LXPC 2L0BA 4YATA 3I2DA 3ZPV1 2VNFA 2CKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBV A;  5DIN A;  2VJF B;  3HTK C;  2L80 A;  3O37 A;  3IHP A;  2G45 A;  2YUR A;  5KH9 A;  3N9N A;  2VPE A;  2LRI C;  2VPD A;  5B77 A;  4GND A;  2EA6 A;  1WEM A;  2EOD A;  2ECG A;  2C2L A;  4PTB A;  1HYI A;  3N9L A;  4O64 A;  1WEV A;  1WIM A;  3M63 A;  2HDP A;  2YT5 A;  4AP4 A;  5B75 A;  3RPG B;  3ZYQ A;  1WEO A;  4I7D A;  2KGI A;  4IC2 A;  4GB0 A;  3PUQ A;  5TRB A;  4GNF A;  3HCS A;  1JOC A;  3KV5 A;  4LLB A;  4AUQ B;  5JG6 A;  3U5M A;  1WFK A;  2HYE D;  2RSD A;  4UP0 A;  1VYX A;  2YRE A;  2C2V S;  2M85 A;  1Z2Q A;  5B76 A;  4LAD B;  1Z6U A;  5B79 A;  5I3L A;  5H1U A;  1X4U A;  1BOR A;  5FEY A;  2DX8 A;  2F42 A;  1E4U A;  5DKA A;  1U6G B;  2F6J A;  5C11 A;  2LGL A;  3PUR A;  2PUY A;  2IDA A;  4FJC A;  2KGG A;  3U5N A;  4A49 A;  3T6R A;  3EB5 A;  3O7A A;  1F62 A;  2K17 A;  4L7X A;  4N4F A;  2YQM A;  1V87 A;  2KE1 A;  5D1L B;  2VJE A;  2E6R A;  3N9O A;  3FL2 A;  1CHC A;  2KYU A;  5FER A;  2JMJ A;  1Z60 A;  2KIZ A;  2NAA A;  3M99 A;  5EYA F;  5LKU A;  3C6W A;  4YBM A;  4AYC B;  4S3O B;  3KNV A;  5C13 A;  3T7L A;  4F52 B;  2YQL A;  2VPB A;  3SHB A;  2MA6 A;  4GNE A;  2LQ6 A;  2YU4 A;  3O70 A;  2YUC A;  4WA6 A;  2KR4 A;  3PHD A;  5TDR A;  4A0C D;  2ECW A;  5LKT A;  4UP5 A;  1JM7 A;  2CKL B;  2PNX A;  2K16 A;  2ECV A;  2M6M A;  4UI9 B;  2QJ0 A;  2L43 A;  5LKX A;  3LQJ A;  2JRJ A;  2FUU A;  2D8S A;  2YHO A;  3KQI A;  4W4U A;  2ZET C;  2YW8 A;  1IYM A;  2RI7 A;  4XI1 A;  5TBN A;  3ZNI A;  1WEP A;  3LQH A;  3O34 A;  2LN0 A;  2H0D A;  1WES A;  2K1J A;  5B8D A;  1WEU A;  4Q6F A;  2G43 A;  2LDR A;  1G25 A;  2QIC A;  2MIQ A;  3NG2 A;  5H1T A;  3V43 A;  1N87 A;  4NN2 A;  2M3H A;  3M62 A;  4GNG A;  1VD4 A;  3HCU A;  1FP0 A;  4S3O C;  5FB0 A;  3O36 A;  5G04 B;  2UZG A;  5B78 A;  2Y1M A;  4LK9 A;  1HYJ A;  4R7E A;  4BHW A;  3C5K A;  4YAX A;  1WE9 A;  2Y43 A;  2F6N A;  2E6S A;  2FUI A;  3ASL A;  4WZ3 B;  4BBQ A;  2K4D A;  4IC3 A;  4WZ2 A;  1DVP A;  4AVX A;  2MD8 C;  3ZTG A;  4ZQL A;  3DPL R;  5H9M A;  2YSJ A;  2MA5 A;  3RPG C;  4YBT A;  5LKZ A;  4N3W A;  4MVT A;  4LJN A;  3L1Z B;  4QF3 A;  2L75 A;  3QZV A;  5G0F A;  4A4B A;  2CT2 A;  4V3L C;  2LGV A;  2VJE B;  1ZBD B;  2XEU A;  1LDK C;  4A4C A;  3U5P A;  1LDJ B;  5AIU A;  2VJF A;  4TKP B;  5J3X A;  3L11 A;  5D1K B;  2JMI A;  5H1V A;  3MHS A;  2ECI A;  1K2F A;  1MM3 A;  4B86 C;  4V3K C;  2YHN A;  2G6Q A;  2M1R A;  2KFT A;  3LQI A;  1WEE A;  5G05 B;  3KV6 A;  2MT5 A;  2ECT A;  2AN6 A;  4QF2 A;  5FB1 A;  3ZVY A;  2MNZ A;  2KWK A;  4MSX A;  1JM7 B;  3LRQ A;  1WEW A;  1X4J A;  2MUM A;  2KRE A;  4YAD A;  4FO9 A;  1WEN A;  2VP7 A;  3MHH A;  2LV9 A;  4YAB A;  3N9P A;  2LGG A;  1XWH A;  5AIT A;  1X4I A;  2BAY A;  2ECJ A;  5LCW B;  3ZVZ B;  2MD7 B;  2H0D B;  2MNY A;  1WEQ A;  1WGM A;  4I7C A;  4CCG X;  3SOU A;  1RMD A;  3N9Q A;  5KH3 A;  2Y1N A;  3O33 A;  1T1H A;  5TDW A;  1VFY A;  3L1X A;  4PPE A;  4R8P K;  3O35 A;  2OXQ C;  2QIZ A;  4I7B A;  2CSY A;  4X3G A;  2CSZ A;  2KU3 A;  3HCT A;  3GL6 A;  5D1M B;  3DQV R;  3U5O A;  2ECN A;  3SOW A;  2I50 A;  2KWJ A;  5KH7 A;  2KWO A;  2YYR A;  2YSM A;  2LGK A;  1MM2 A;  3RTR B;  2LXH C;  4P5O B;  4L58 A;  4C9Z A;  5TAB A;  3VK6 A;  2VPG A;  4CA1 A;  3EB6 A;  4B7Y C;  3N9M A;  2FSA A;  4YBS A;  4ZDT A;  2L5U A;  4ZUX U;  2XB1 A;  3SOX A;  4FIP A;  4WZ0 A;  2JMD A;  3ZPV E;  4R2Y A;  4AYC A;  4LKA A;  2KWN A;  3GV4 A;  4YC9 A;  4FK5 A;  1WIL A;  2EGP A;  2LXP C;  2L0B A;  4YAT A;  3I2D A;  3ZPV 1;  2VNF A;  2CKL A; 
#chains in the Genus database with same CATH topology
 1FBV A;  2D8U A;  5DIN A;  2VJF B;  3HTK C;  2XOC A;  2L80 A;  3O37 A;  3IHP A;  2E61 A;  2G45 A;  2YUR A;  5KH9 A;  3N9N A;  5SVI B;  2VPE A;  2LRI C;  2VPD A;  5B77 A;  4GND A;  2EA6 A;  1WEM A;  2EOD A;  2ECG A;  2C2L A;  4PTB A;  1HYI A;  3LJU X;  3N9L A;  5SVX A;  4O64 A;  1WEV A;  1WIM A;  3M63 A;  2HDP A;  2YT5 A;  2CON A;  4AP4 A;  5B75 A;  3RPG B;  3ZYQ A;  1WEO A;  4I7D A;  2KGI A;  4IC2 A;  4GB0 A;  3PUQ A;  5TRB A;  2RR4 A;  4GNF A;  3HCS A;  1JOC A;  3KV5 A;  4LLB A;  4AUQ B;  3LVQ E;  5JG6 A;  3U5M A;  1WFK A;  2HYE D;  2RSD A;  4UP0 A;  1VYX A;  2YRE A;  2C2V S;  2M85 A;  1Z2Q A;  5B76 A;  4Z0O A;  4LAD B;  1Z6U A;  2OWA A;  5B79 A;  5I3L A;  5H1U A;  1X4U A;  1BOR A;  2P57 A;  5FEY A;  2DX8 A;  2F42 A;  3FAN A;  1E4U A;  5DKA A;  1U6G B;  2F6J A;  5C11 A;  2LGL A;  3PUR A;  2PUY A;  2IDA A;  4FJC A;  2JUN A;  2KGG A;  3U5N A;  4A49 A;  3T6R A;  3Q1D A;  3EB5 A;  3O7A A;  2DSM A;  1F62 A;  2K17 A;  4L7X A;  4N4F A;  2YQM A;  1V87 A;  1MBM A;  2CSV A;  2KE1 A;  5D1L B;  2VJE A;  2E6R A;  3N9O A;  3FL2 A;  2L7P A;  1CHC A;  2KYU A;  5FER A;  2JMJ A;  4QQ4 A;  1Z60 A;  2KIZ A;  2NAA A;  3M99 A;  5EYA F;  5LKU A;  3C6W A;  4YBM A;  2XOY A;  3LDY A;  4AYC B;  4S3O B;  3KNV A;  5C13 A;  3T7L A;  4F52 B;  2YQL A;  2VPB A;  3SHB A;  2MA6 A;  4GNE A;  2LQ6 A;  2YU4 A;  2JM3 A;  3T9K A;  3O70 A;  2YUC A;  4WA6 A;  2EGM A;  2KR4 A;  3PHD A;  5TDR A;  4A0C D;  2ECW A;  5LKT A;  4UP5 A;  1JM7 A;  2FD4 A;  2CRW A;  2CKL B;  2PNX A;  2K16 A;  2ECV A;  2M6M A;  4UI9 B;  2QJ0 A;  2L43 A;  5LKX A;  3LQJ A;  2JRJ A;  2FUU A;  2D8S A;  2YHO A;  3KQI A;  4W4U A;  2ZET C;  2YW8 A;  1IYM A;  2RI7 A;  4XI1 A;  5TBN A;  3ZNI A;  1WEP A;  3LQH A;  3O34 A;  2LN0 A;  2H0D A;  1WES A;  2K1J A;  5B8D A;  1WEU A;  4Q6F A;  2G43 A;  2LDR A;  1G25 A;  2QIC A;  3DWD A;  2MIQ A;  3NG2 A;  5H1T A;  2XOZ A;  3V43 A;  1N87 A;  4NN2 A;  2M3H A;  1DCQ A;  3M62 A;  3FJU B;  4GNG A;  1VD4 A;  3HCU A;  1FP0 A;  4S3O C;  5FB0 A;  3FEH A;  3O36 A;  5G04 B;  2LAU A;  2UZG A;  5B78 A;  2Y1M A;  4LK9 A;  1HYJ A;  4R7E A;  4BHW A;  3C5K A;  4YAX A;  1WE9 A;  2Y43 A;  3H7H A;  2F6N A;  2E6S A;  2FUI A;  4OGC A;  3ASL A;  4WZ3 B;  4BBQ A;  2K4D A;  4IC3 A;  4OGE A;  4WZ2 A;  1DVP A;  4AVX A;  2MD8 C;  3ZTG A;  4ZQL A;  3DPL R;  5H9M A;  2YSJ A;  2KKY A;  2MA5 A;  3SUB A;  3RPG C;  4YBT A;  5SVY A;  5LKZ A;  4N3W A;  2FFW A;  4MVT A;  4LJN A;  3L1Z B;  4QF3 A;  3KDE C;  2L75 A;  3QZV A;  4H9D A;  5G0F A;  4A4B A;  2CT2 A;  2KKX A;  4V3L C;  2LGV A;  2VJE B;  1ZBD B;  2XEU A;  1LDK C;  4A4C A;  3U5P A;  1LDJ B;  5AIU A;  2VJF A;  4O62 A;  4TKP B;  5J3X A;  3L11 A;  5D1K B;  3FM8 C;  2JMI A;  5H1V A;  3MHS A;  5SVI A;  2ECI A;  2DJA A;  1K2F A;  1MM3 A;  4B86 C;  4V3K C;  2YHN A;  2G6Q A;  2M1R A;  2KFT A;  3LQI A;  1WEE A;  5G05 B;  3FAO A;  3KV6 A;  2MT5 A;  2ECT A;  3DDT A;  2AN6 A;  4QF2 A;  5FB1 A;  3ZVY A;  4F1P A;  2MNZ A;  2KWK A;  4MSX A;  1JM7 B;  3LRQ A;  4Z0R A;  1WEW A;  2MKE A;  1X4J A;  2MUM A;  2KRE A;  4YAD A;  4FO9 A;  1WEN A;  2VP7 A;  3MHH A;  2LV9 A;  4YAB A;  3N9P A;  2LGG A;  1XWH A;  5AIT A;  1X4I A;  2BAY A;  2ECJ A;  2IQJ A;  5LCW B;  3ZVZ B;  2MD7 B;  2H0D B;  2MNY A;  3E2D A;  1WEQ A;  1WGM A;  4I7C A;  4CCG X;  2XP0 A;  3SOU A;  1RMD A;  2EXU A;  3N9Q A;  3JUE A;  5KH3 A;  2Y1N A;  3O33 A;  1T1H A;  3L1X A;  1VFY A;  5TDW A;  4PPE A;  4R8P K;  3O35 A;  2OXQ C;  2QIZ A;  4I7B A;  3O47 A;  2CSY A;  4X3G A;  2CSZ A;  2YVR A;  2KU3 A;  3HCT A;  3GL6 A;  5D1M B;  3DQV R;  3LVR E;  3U5O A;  2ECN A;  3SOW A;  2I50 A;  2KWJ A;  5KH7 A;  2KWO A;  2YYR A;  2YSM A;  2LGK A;  1MM2 A;  3RTR B;  2LXH C;  4P5O B;  4L58 A;  4C9Z A;  5TAB A;  3VK6 A;  2VPG A;  3MDB C;  4CA1 A;  3EB6 A;  2CRR A;  4B7Y C;  2B0O E;  2FSA A;  3N9M A;  4YBS A;  5K3Q A;  3PLW A;  4ZDT A;  2L5U A;  4ZUX U;  2XB1 A;  3SOX A;  4FIP A;  4WZ0 A;  2JMD A;  3ZPV E;  4R2Y A;  4AYC A;  4LKA A;  2KWN A;  3GV4 A;  4YC9 A;  4FK5 A;  1WIL A;  2M13 A;  2EGP A;  2LXP C;  2L0B A;  4YAT A;  3I2D A;  3M7K A;  3ZPV 1;  2VNF A;  2CKL A; 
#chains in the Genus database with same CATH homology
 1FBV A;  5DIN A;  2VJF B;  3HTK C;  2L80 A;  3O37 A;  3IHP A;  2G45 A;  2YUR A;  5KH9 A;  3N9N A;  2VPE A;  2LRI C;  2VPD A;  5B77 A;  4GND A;  2EA6 A;  1WEM A;  2EOD A;  2ECG A;  2C2L A;  4PTB A;  1HYI A;  3N9L A;  4O64 A;  1WEV A;  1WIM A;  3M63 A;  2HDP A;  2YT5 A;  4AP4 A;  5B75 A;  3RPG B;  3ZYQ A;  1WEO A;  4I7D A;  2KGI A;  4IC2 A;  4GB0 A;  3PUQ A;  5TRB A;  4GNF A;  3HCS A;  1JOC A;  3KV5 A;  4LLB A;  4AUQ B;  5JG6 A;  3U5M A;  1WFK A;  2HYE D;  2RSD A;  4UP0 A;  1VYX A;  2YRE A;  2C2V S;  2M85 A;  1Z2Q A;  5B76 A;  4LAD B;  1Z6U A;  5B79 A;  5I3L A;  5H1U A;  1X4U A;  1BOR A;  5FEY A;  2DX8 A;  2F42 A;  1E4U A;  5DKA A;  1U6G B;  2F6J A;  5C11 A;  2LGL A;  3PUR A;  2PUY A;  2IDA A;  4FJC A;  2KGG A;  3U5N A;  4A49 A;  3T6R A;  3EB5 A;  3O7A A;  1F62 A;  2K17 A;  4L7X A;  4N4F A;  2YQM A;  1V87 A;  2KE1 A;  5D1L B;  2VJE A;  2E6R A;  3N9O A;  3FL2 A;  1CHC A;  2KYU A;  5FER A;  2JMJ A;  1Z60 A;  2KIZ A;  2NAA A;  3M99 A;  5EYA F;  5LKU A;  3C6W A;  4YBM A;  4AYC B;  4S3O B;  3KNV A;  5C13 A;  3T7L A;  4F52 B;  2YQL A;  2VPB A;  3SHB A;  2MA6 A;  4GNE A;  2LQ6 A;  2YU4 A;  3O70 A;  2YUC A;  4WA6 A;  2KR4 A;  3PHD A;  5TDR A;  4A0C D;  2ECW A;  5LKT A;  4UP5 A;  1JM7 A;  2CKL B;  2PNX A;  2K16 A;  2ECV A;  2M6M A;  4UI9 B;  2QJ0 A;  2L43 A;  5LKX A;  3LQJ A;  2JRJ A;  2FUU A;  2D8S A;  2YHO A;  3KQI A;  4W4U A;  2ZET C;  2YW8 A;  1IYM A;  2RI7 A;  4XI1 A;  5TBN A;  3ZNI A;  1WEP A;  3LQH A;  3O34 A;  2LN0 A;  2H0D A;  1WES A;  2K1J A;  5B8D A;  1WEU A;  4Q6F A;  2G43 A;  2LDR A;  1G25 A;  2QIC A;  2MIQ A;  3NG2 A;  5H1T A;  3V43 A;  1N87 A;  4NN2 A;  2M3H A;  3M62 A;  4GNG A;  1VD4 A;  3HCU A;  1FP0 A;  4S3O C;  5FB0 A;  3O36 A;  5G04 B;  2UZG A;  5B78 A;  2Y1M A;  4LK9 A;  1HYJ A;  4R7E A;  4BHW A;  3C5K A;  4YAX A;  1WE9 A;  2Y43 A;  2F6N A;  2E6S A;  2FUI A;  3ASL A;  4WZ3 B;  4BBQ A;  2K4D A;  4IC3 A;  4WZ2 A;  1DVP A;  4AVX A;  2MD8 C;  3ZTG A;  4ZQL A;  3DPL R;  5H9M A;  2YSJ A;  2MA5 A;  3RPG C;  4YBT A;  5LKZ A;  4N3W A;  4MVT A;  4LJN A;  3L1Z B;  4QF3 A;  2L75 A;  3QZV A;  5G0F A;  4A4B A;  2CT2 A;  4V3L C;  2LGV A;  2VJE B;  1ZBD B;  2XEU A;  1LDK C;  4A4C A;  3U5P A;  1LDJ B;  5AIU A;  2VJF A;  4TKP B;  5J3X A;  3L11 A;  5D1K B;  2JMI A;  5H1V A;  3MHS A;  2ECI A;  1K2F A;  1MM3 A;  4B86 C;  4V3K C;  2YHN A;  2G6Q A;  2M1R A;  2KFT A;  3LQI A;  1WEE A;  5G05 B;  3KV6 A;  2MT5 A;  2ECT A;  2AN6 A;  4QF2 A;  5FB1 A;  3ZVY A;  2MNZ A;  2KWK A;  4MSX A;  1JM7 B;  3LRQ A;  1WEW A;  1X4J A;  2MUM A;  2KRE A;  4YAD A;  4FO9 A;  1WEN A;  2VP7 A;  3MHH A;  2LV9 A;  4YAB A;  3N9P A;  2LGG A;  1XWH A;  5AIT A;  1X4I A;  2BAY A;  2ECJ A;  5LCW B;  3ZVZ B;  2MD7 B;  2H0D B;  2MNY A;  1WEQ A;  1WGM A;  4I7C A;  4CCG X;  3SOU A;  1RMD A;  3N9Q A;  5KH3 A;  2Y1N A;  3O33 A;  1T1H A;  5TDW A;  1VFY A;  3L1X A;  4PPE A;  4R8P K;  3O35 A;  2OXQ C;  2QIZ A;  4I7B A;  2CSY A;  4X3G A;  2CSZ A;  2KU3 A;  3HCT A;  3GL6 A;  5D1M B;  3DQV R;  3U5O A;  2ECN A;  3SOW A;  2I50 A;  2KWJ A;  5KH7 A;  2KWO A;  2YYR A;  2YSM A;  2LGK A;  1MM2 A;  3RTR B;  2LXH C;  4P5O B;  4L58 A;  4C9Z A;  5TAB A;  3VK6 A;  2VPG A;  4CA1 A;  3EB6 A;  4B7Y C;  3N9M A;  2FSA A;  4YBS A;  4ZDT A;  2L5U A;  4ZUX U;  2XB1 A;  3SOX A;  4FIP A;  4WZ0 A;  2JMD A;  3ZPV E;  4R2Y A;  4AYC A;  4LKA A;  2KWN A;  3GV4 A;  4YC9 A;  4FK5 A;  1WIL A;  2EGP A;  2LXP C;  2L0B A;  4YAT A;  3I2D A;  3ZPV 1;  2VNF A;  2CKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...