2LGVA

Rbx1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
b'GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RBX1
publication title Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgvA00
5JG6A 4YBSA 3V43A 3LQIA 1FBVA 5LKXA 1Z6UA 2C2VS 2MT5A 1FP0A 2LDRA 2YYRA 2LQ6A 1CHCA 1WIMA 2YQMA 3PURA 5I3LA 2PUYA 1WEOA 4GNDA 2LGGA 3N9LA 5DKAA 1JM7B 5AITA 2LXPC 2QIZA 3SOWA 2E6SA 3SOXA 3L11A 3ZTGA 4LADB 3U5NA 2ECIA 3M62A 2ECVA 2CKLB 2MA5A 4N4FA 5TRBA 4CA1A 3U5OA 3PHDA 2YHNA 3ZVYA 2D8SA 2YW8A 2L75A 1G25A 2VJEB 5H9MA 4FO9A 2L80A 5B77A 1WEMA 2YREA 4IC3A 2H0DB 5TABA 2VP7A 1JM7A 4LKAA 2M1RA 2KE1A 2L43A 2AN6A 4I7DA 5H1VA 2EODA 2KIZA 2DX8A 4LLBA 2KREA 2F6NA 2VPBA 2L0BA 4UI9B 3N9OA 2UZGA 1MM2A 2CKLA 1K2FA 2Y1NA 3QZVA 2ECJA 1IYMA 2C2LA 2G43A 2ECWA 3EB5A 2YT5A 4A49A 4LJNA 4AVXA 4UP5A 5FB1A 2OXQC 2HYED 3HCTA 3GV4A 3KQIA 5C13A 5C11A 2M6MA 2YHOA 2XEUA 5TBNA 2KU3A 1MM3A 4ZUXU 2VNFA 2RI7A 4P5OB 3RTRB 4BBQA 2ZETC 2EGPA 5B76A 5H1UA 4FIPA 2Y43A 3FL2A 3L1ZB 3DQVR 2MNYA 4C9ZA 4WZ0A 2NAAA 2F42A 2LN0A 1Z60A 2VPGA 3ZPV1 4YC9A 1VD4A 4FK5A 2K17A 1U6GB 5FEYA 2FUUA 1ZBDB 3O36A 4R7EA 5D1LB 5J3XA 1WE9A 3SHBA 5TDWA 4B7YC 3GL6A 2YSJA 2BAYA 4A0CD 5FERA 2MD7B 4YAXA 3RPGC 3HTKC 4ZDTA 4WA6A 3M63A 2JMJA 4MSXA 3ZNIA 2KFTA 5LKTA 4GNGA 3M99A 4TKPB 3ZPVE 4S3OB 2CSYA 2I50A 4YBTA 3SOUA 3LQHA 2FSAA 2ECGA 4GNEA 4CCGX 4FJCA 2KWJA 2KWOA 2MNZA 5G0FA 5TDRA 4X3GA 5D1MB 2CT2A 2LRIC 5DINA 3N9NA 2VPDA 2G45A 3C5KA 1X4JA 3DPLR 4AYCB 5B79A 1WEPA 3O7AA 2VPEA 4YATA 4B86C 2JRJA 2F6JA 1V87A 3KV5A 2KGIA 5G04B 2VJFB 2ECNA 4QF3A 1HYIA 2YURA 2M3HA 1VFYA 1WEUA 3N9PA 4V3LC 5B78A 2FUIA 4XI1A 2G6QA 3T6RA 2LGVA 3I2DA 4GNFA 4LK9A 1WENA 3ZVZB 4A4BA 3O70A 5B75A 4AYCA 3KNVA 4GB0A 2MD8C 3U5MA 3KV6A 3MHSA 4UP0A 1WESA 3LRQA 2MIQA 4R8PK 4ZQLA 1VYXA 4W4UA 2EA6A 5H1TA 2VJFA 1N87A 4S3OC 2XB1A 4I7BA 3T7LA 2LGLA 3O33A 2ECTA 2KWKA 1XWHA 4WZ3B 5KH9A 3NG2A 1Z2QA 4PTBA 2KYUA 5EYAF 3O35A 3VK6A 3N9MA 4YABA 1HYJA 5G05B 2K4DA 2LGKA 2RSDA 2MUMA 5LCWB 1F62A 2KWNA 2QICA 4R2YA 3HCSA 1WFKA 3LQJA 5AIUA 5B8DA 4PPEA 4O64A 1LDJB 3L1XA 2LV9A 5D1KB 2E6RA 4V3KC 4NN2A 4BHWA 2M85A 1LDKC 1WEEA 4L58A 4Q6FA 3PUQA 1WEQA 1WEWA 2L5UA 2YQLA 3O37A 3ASLA 4N3WA 5KH7A 2JMDA 4YBMA 4AUQB 1JOCA 4L7XA 1WEVA 2K16A 2KR4A 1T1HA 2YU4A 2CSZA 4YADA 2JMIA 3C6WA 3U5PA 3RPGB 2QJ0A 1WILA 5LKZA 3EB6A 4IC2A 4AP4A 1WGMA 3IHPA 3N9QA 4A4CA 5KH3A 1X4UA 2MA6A 5LKUA 2VJEA 2IDAA 2Y1MA 3HCUA 2YUCA 1DVPA 2K1JA 2H0DA 4I7CA 4WZ2A 4F52B 2PNXA 3MHHA 3O34A 1E4UA 5FB0A 1X4IA 4QF2A 2YSMA 4MVTA 2HDPA 1RMDA 3ZYQA 1BORA 2LXHC 2KGGA
chains in the Genus database with same CATH superfamily
5JG6A 3LJUX 4YBSA 3LVQE 3V43A 3LQIA 1FBVA 5LKXA 1Z6UA 2C2VS 2MT5A 1FP0A 2CRRA 2LDRA 2LQ6A 2YYRA 1CHCA 1WIMA 2YQMA 3PURA 5I3LA 3FANA 2PUYA 1WEOA 4GNDA 2LGGA 3N9LA 5DKAA 1JM7B 5AITA 2LXPC 2QIZA 3SOWA 3FJUB 2E6SA 2KKXA 3SOXA 2FFWA 3L11A 3ZTGA 4LADB 3U5NA 2ECIA 3M62A 2ECVA 2CKLB 2MA5A 4N4FA 5TRBA 4CA1A 3U5OA 3PHDA 5SVXA 2YHNA 3ZVYA 2D8SA 2YW8A 2L75A 1G25A 2VJEB 5H9MA 4FO9A 2L80A 5B77A 1WEMA 3PLWA 2YREA 4IC3A 2H0DB 5TABA 2VP7A 1JM7A 4LKAA 2M1RA 2KE1A 2L43A 2AN6A 4I7DA 5H1VA 2EODA 2KIZA 2DX8A 4LLBA 2KREA 2F6NA 2VPBA 2L0BA 4UI9B 3N9OA 2UZGA 1MM2A 2CKLA 3FEHA 1K2FA 1MBMA 2Y1NA 3QZVA 2ECJA 1IYMA 2C2LA 2G43A 2ECWA 3EB5A 2YT5A 4A49A 4LJNA 4AVXA 4UP5A 5FB1A 2OXQC 2HYED 3HCTA 3GV4A 3E2DA 3KQIA 5C13A 5C11A 2M6MA 2YHOA 2XEUA 2XP0A 5TBNA 2KU3A 1MM3A 4ZUXU 2VNFA 2RI7A 4P5OB 3RTRB 4BBQA 2ZETC 2EGPA 5B76A 5H1UA 4FIPA 2Y43A 3FL2A 3LDYA 3L1ZB 3DQVR 2MNYA 4C9ZA 4WZ0A 2NAAA 2F42A 2LN0A 1Z60A 2KKYA 2VPGA 3ZPV1 4YC9A 1VD4A 4FK5A 2K17A 1U6GB 5FEYA 2FUUA 1ZBDB 3O36A 4R7EA 5D1LB 5J3XA 1WE9A 3SHBA 3T9KA 5TDWA 4B7YC 3GL6A 2YSJA 2BAYA 3KDEC 4A0CD 5FERA 2P57A 2MD7B 4YAXA 3RPGC 2D8UA 3HTKC 4ZDTA 4WA6A 3M63A 2JMJA 4MSXA 3ZNIA 2KFTA 5LKTA 4GNGA 3M99A 4TKPB 3ZPVE 3FM8C 2E61A 4H9DA 4S3OB 3FAOA 2XOYA 2CSYA 5K3QA 2I50A 4YBTA 3SOUA 3LQHA 2FSAA 2ECGA 2IQJA 1DCQA 4GNEA 4CCGX 4FJCA 2KWJA 2KWOA 2MNZA 4OGCA 5G0FA 5TDRA 4X3GA 5D1MB 2CT2A 2LRIC 5DINA 3N9NA 2VPDA 2G45A 4QQ4A 2CRWA 3C5KA 3JUEA 1X4JA 3DPLR 4AYCB 5B79A 1WEPA 3O7AA 2VPEA 4YATA 4B86C 2JRJA 2F6JA 1V87A 3KV5A 2KGIA 2FD4A 4O62A 5G04B 5SVYA 2VJFB 2ECNA 4QF3A 1HYIA 2YURA 2M3HA 2MKEA 2DSMA 1VFYA 1WEUA 3N9PA 4V3LC 5B78A 2FUIA 4XI1A 2G6QA 3T6RA 2LGVA 3I2DA 4GNFA 4LK9A 2JM3A 1WENA 3ZVZB 4A4BA 3O70A 5B75A 4AYCA 3KNVA 4GB0A 2MD8C 3U5MA 5SVIB 3KV6A 2XOCA 3MHSA 4UP0A 2EXUA 1WESA 3LRQA 2MIQA 4R8PK 4ZQLA 1VYXA 4W4UA 2EA6A 5H1TA 2VJFA 1N87A 4S3OC 2XB1A 4I7BA 3T7LA 2LGLA 3LVRE 3O33A 4Z0RA 2JUNA 2ECTA 2KWKA 1XWHA 4WZ3B 4Z0OA 5KH9A 3NG2A 1Z2QA 2YVRA 4PTBA 2KYUA 5EYAF 3O35A 3VK6A 3N9MA 4YABA 1HYJA 5G05B 2K4DA 2LGKA 2RSDA 2MUMA 5LCWB 1F62A 5SVIA 2KWNA 2QICA 4R2YA 2XOZA 3HCSA 1WFKA 3LQJA 5AIUA 5B8DA 4PPEA 3Q1DA 4O64A 1LDJB 3L1XA 2LV9A 5D1KB 2E6RA 4V3KC 4NN2A 4BHWA 2M85A 1LDKC 3H7HA 1WEEA 4L58A 4Q6FA 3PUQA 1WEQA 1WEWA 3SUBA 2L5UA 2YQLA 3O37A 4OGEA 3MDBC 3ASLA 4N3WA 5KH7A 3M7KA 3O47A 2JMDA 4YBMA 4AUQB 1JOCA 4L7XA 1WEVA 2K16A 2KR4A 2EGMA 1T1HA 2YU4A 2CSVA 2CSZA 4YADA 2JMIA 2RR4A 3C6WA 3U5PA 3RPGB 3DDTA 2QJ0A 2DJAA 1WILA 2L7PA 5LKZA 3EB6A 4IC2A 4F1PA 4AP4A 1WGMA 3IHPA 3N9QA 4A4CA 5KH3A 1X4UA 2MA6A 2OWAA 5LKUA 2VJEA 2IDAA 2M13A 2Y1MA 3HCUA 2YUCA 1DVPA 2K1JA 2H0DA 3DWDA 4I7CA 4WZ2A 2LAUA 4F52B 2PNXA 3O34A 3MHHA 1E4UA 2CONA 5FB0A 2B0OE 1X4IA 4QF2A 2YSMA 4MVTA 2HDPA 1RMDA 3ZYQA 1BORA 2LXHC 2KGGA
chains in the Genus database with same CATH topology
5JG6A 4YBSA 3V43A 3LQIA 1FBVA 5LKXA 1Z6UA 2C2VS 2MT5A 1FP0A 2LDRA 2YYRA 2LQ6A 1CHCA 1WIMA 2YQMA 3PURA 5I3LA 2PUYA 1WEOA 4GNDA 2LGGA 3N9LA 5DKAA 1JM7B 5AITA 2LXPC 2QIZA 3SOWA 2E6SA 3SOXA 3L11A 3ZTGA 4LADB 3U5NA 2ECIA 3M62A 2ECVA 2CKLB 2MA5A 4N4FA 5TRBA 4CA1A 3U5OA 3PHDA 2YHNA 3ZVYA 2D8SA 2YW8A 2L75A 1G25A 2VJEB 5H9MA 4FO9A 2L80A 5B77A 1WEMA 2YREA 4IC3A 2H0DB 5TABA 2VP7A 1JM7A 4LKAA 2M1RA 2KE1A 2L43A 2AN6A 4I7DA 5H1VA 2EODA 2KIZA 2DX8A 4LLBA 2KREA 2F6NA 2VPBA 2L0BA 4UI9B 3N9OA 2UZGA 1MM2A 2CKLA 1K2FA 2Y1NA 3QZVA 2ECJA 1IYMA 2C2LA 2G43A 2ECWA 3EB5A 2YT5A 4A49A 4LJNA 4AVXA 4UP5A 5FB1A 2OXQC 2HYED 3HCTA 3GV4A 3KQIA 5C13A 5C11A 2M6MA 2YHOA 2XEUA 5TBNA 2KU3A 1MM3A 4ZUXU 2VNFA 2RI7A 4P5OB 3RTRB 4BBQA 2ZETC 2EGPA 5B76A 5H1UA 4FIPA 2Y43A 3FL2A 3L1ZB 3DQVR 2MNYA 4C9ZA 4WZ0A 2NAAA 2F42A 2LN0A 1Z60A 2VPGA 3ZPV1 4YC9A 1VD4A 4FK5A 2K17A 1U6GB 5FEYA 2FUUA 1ZBDB 3O36A 4R7EA 5D1LB 5J3XA 1WE9A 3SHBA 5TDWA 4B7YC 3GL6A 2YSJA 2BAYA 4A0CD 5FERA 2MD7B 4YAXA 3RPGC 3HTKC 4ZDTA 4WA6A 3M63A 2JMJA 4MSXA 3ZNIA 2KFTA 5LKTA 4GNGA 3M99A 4TKPB 3ZPVE 4S3OB 2CSYA 2I50A 4YBTA 3SOUA 3LQHA 2FSAA 2ECGA 4GNEA 4CCGX 4FJCA 2KWJA 2KWOA 2MNZA 5G0FA 5TDRA 4X3GA 5D1MB 2CT2A 2LRIC 5DINA 3N9NA 2VPDA 2G45A 3C5KA 1X4JA 3DPLR 4AYCB 5B79A 1WEPA 3O7AA 2VPEA 4YATA 4B86C 2JRJA 2F6JA 1V87A 3KV5A 2KGIA 5G04B 2VJFB 2ECNA 4QF3A 1HYIA 2YURA 2M3HA 1VFYA 1WEUA 3N9PA 4V3LC 5B78A 2FUIA 4XI1A 2G6QA 3T6RA 2LGVA 3I2DA 4GNFA 4LK9A 1WENA 3ZVZB 4A4BA 3O70A 5B75A 4AYCA 3KNVA 4GB0A 2MD8C 3U5MA 3KV6A 3MHSA 4UP0A 1WESA 3LRQA 2MIQA 4R8PK 4ZQLA 1VYXA 4W4UA 2EA6A 5H1TA 2VJFA 1N87A 4S3OC 2XB1A 4I7BA 3T7LA 2LGLA 3O33A 2ECTA 2KWKA 1XWHA 4WZ3B 5KH9A 3NG2A 1Z2QA 4PTBA 2KYUA 5EYAF 3O35A 3VK6A 3N9MA 4YABA 1HYJA 5G05B 2K4DA 2LGKA 2RSDA 2MUMA 5LCWB 1F62A 2KWNA 2QICA 4R2YA 3HCSA 1WFKA 3LQJA 5AIUA 5B8DA 4PPEA 4O64A 1LDJB 3L1XA 2LV9A 5D1KB 2E6RA 4V3KC 4NN2A 4BHWA 2M85A 1LDKC 1WEEA 4L58A 4Q6FA 3PUQA 1WEQA 1WEWA 2L5UA 2YQLA 3O37A 3ASLA 4N3WA 5KH7A 2JMDA 4YBMA 4AUQB 1JOCA 4L7XA 1WEVA 2K16A 2KR4A 1T1HA 2YU4A 2CSZA 4YADA 2JMIA 3C6WA 3U5PA 3RPGB 2QJ0A 1WILA 5LKZA 3EB6A 4IC2A 4AP4A 1WGMA 3IHPA 3N9QA 4A4CA 5KH3A 1X4UA 2MA6A 5LKUA 2VJEA 2IDAA 2Y1MA 3HCUA 2YUCA 1DVPA 2K1JA 2H0DA 4I7CA 4WZ2A 4F52B 2PNXA 3MHHA 3O34A 1E4UA 5FB0A 1X4IA 4QF2A 2YSMA 4MVTA 2HDPA 1RMDA 3ZYQA 1BORA 2LXHC 2KGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JG6 A;  4YBS A;  3V43 A;  3LQI A;  1FBV A;  5LKX A;  1Z6U A;  2C2V S;  2MT5 A;  1FP0 A;  2LDR A;  2YYR A;  2LQ6 A;  1CHC A;  1WIM A;  2YQM A;  3PUR A;  5I3L A;  2PUY A;  1WEO A;  4GND A;  2LGG A;  3N9L A;  5DKA A;  1JM7 B;  5AIT A;  2LXP C;  2QIZ A;  3SOW A;  2E6S A;  3SOX A;  3L11 A;  3ZTG A;  4LAD B;  3U5N A;  2ECI A;  3M62 A;  2ECV A;  2CKL B;  2MA5 A;  4N4F A;  5TRB A;  4CA1 A;  3U5O A;  3PHD A;  2YHN A;  3ZVY A;  2D8S A;  2YW8 A;  2L75 A;  1G25 A;  2VJE B;  5H9M A;  4FO9 A;  2L80 A;  5B77 A;  1WEM A;  2YRE A;  4IC3 A;  2H0D B;  5TAB A;  2VP7 A;  1JM7 A;  4LKA A;  2M1R A;  2KE1 A;  2L43 A;  2AN6 A;  4I7D A;  5H1V A;  2EOD A;  2KIZ A;  2DX8 A;  4LLB A;  2KRE A;  2F6N A;  2VPB A;  2L0B A;  4UI9 B;  3N9O A;  2UZG A;  1MM2 A;  2CKL A;  1K2F A;  2Y1N A;  3QZV A;  2ECJ A;  1IYM A;  2C2L A;  2G43 A;  2ECW A;  3EB5 A;  2YT5 A;  4A49 A;  4LJN A;  4AVX A;  4UP5 A;  5FB1 A;  2OXQ C;  2HYE D;  3HCT A;  3GV4 A;  3KQI A;  5C13 A;  5C11 A;  2M6M A;  2YHO A;  2XEU A;  5TBN A;  2KU3 A;  1MM3 A;  4ZUX U;  2VNF A;  2RI7 A;  4P5O B;  3RTR B;  4BBQ A;  2ZET C;  2EGP A;  5B76 A;  5H1U A;  4FIP A;  2Y43 A;  3FL2 A;  3L1Z B;  3DQV R;  2MNY A;  4C9Z A;  4WZ0 A;  2NAA A;  2F42 A;  2LN0 A;  1Z60 A;  2VPG A;  3ZPV 1;  4YC9 A;  1VD4 A;  4FK5 A;  2K17 A;  1U6G B;  5FEY A;  2FUU A;  1ZBD B;  3O36 A;  4R7E A;  5D1L B;  5J3X A;  1WE9 A;  3SHB A;  5TDW A;  4B7Y C;  3GL6 A;  2YSJ A;  2BAY A;  4A0C D;  5FER A;  2MD7 B;  4YAX A;  3RPG C;  3HTK C;  4ZDT A;  4WA6 A;  3M63 A;  2JMJ A;  4MSX A;  3ZNI A;  2KFT A;  5LKT A;  4GNG A;  3M99 A;  4TKP B;  3ZPV E;  4S3O B;  2CSY A;  2I50 A;  4YBT A;  3SOU A;  3LQH A;  2FSA A;  2ECG A;  4GNE A;  4CCG X;  4FJC A;  2KWJ A;  2KWO A;  2MNZ A;  5G0F A;  5TDR A;  4X3G A;  5D1M B;  2CT2 A;  2LRI C;  5DIN A;  3N9N A;  2VPD A;  2G45 A;  3C5K A;  1X4J A;  3DPL R;  4AYC B;  5B79 A;  1WEP A;  3O7A A;  2VPE A;  4YAT A;  4B86 C;  2JRJ A;  2F6J A;  1V87 A;  3KV5 A;  2KGI A;  5G04 B;  2VJF B;  2ECN A;  4QF3 A;  1HYI A;  2YUR A;  2M3H A;  1VFY A;  1WEU A;  3N9P A;  4V3L C;  5B78 A;  2FUI A;  4XI1 A;  2G6Q A;  3T6R A;  2LGV A;  3I2D A;  4GNF A;  4LK9 A;  1WEN A;  3ZVZ B;  4A4B A;  3O70 A;  5B75 A;  4AYC A;  3KNV A;  4GB0 A;  2MD8 C;  3U5M A;  3KV6 A;  3MHS A;  4UP0 A;  1WES A;  3LRQ A;  2MIQ A;  4R8P K;  4ZQL A;  1VYX A;  4W4U A;  2EA6 A;  5H1T A;  2VJF A;  1N87 A;  4S3O C;  2XB1 A;  4I7B A;  3T7L A;  2LGL A;  3O33 A;  2ECT A;  2KWK A;  1XWH A;  4WZ3 B;  5KH9 A;  3NG2 A;  1Z2Q A;  4PTB A;  2KYU A;  5EYA F;  3O35 A;  3VK6 A;  3N9M A;  4YAB A;  1HYJ A;  5G05 B;  2K4D A;  2LGK A;  2RSD A;  2MUM A;  5LCW B;  1F62 A;  2KWN A;  2QIC A;  4R2Y A;  3HCS A;  1WFK A;  3LQJ A;  5AIU A;  5B8D A;  4PPE A;  4O64 A;  1LDJ B;  3L1X A;  2LV9 A;  5D1K B;  2E6R A;  4V3K C;  4NN2 A;  4BHW A;  2M85 A;  1LDK C;  1WEE A;  4L58 A;  4Q6F A;  3PUQ A;  1WEQ A;  1WEW A;  2L5U A;  2YQL A;  3O37 A;  3ASL A;  4N3W A;  5KH7 A;  2JMD A;  4YBM A;  4AUQ B;  1JOC A;  4L7X A;  1WEV A;  2K16 A;  2KR4 A;  1T1H A;  2YU4 A;  2CSZ A;  4YAD A;  2JMI A;  3C6W A;  3U5P A;  3RPG B;  2QJ0 A;  1WIL A;  5LKZ A;  3EB6 A;  4IC2 A;  4AP4 A;  1WGM A;  3IHP A;  3N9Q A;  4A4C A;  5KH3 A;  1X4U A;  2MA6 A;  5LKU A;  2VJE A;  2IDA A;  2Y1M A;  3HCU A;  2YUC A;  1DVP A;  2K1J A;  2H0D A;  4I7C A;  4WZ2 A;  4F52 B;  2PNX A;  3MHH A;  3O34 A;  1E4U A;  5FB0 A;  1X4I A;  4QF2 A;  2YSM A;  4MVT A;  2HDP A;  1RMD A;  3ZYQ A;  1BOR A;  2LXH C;  2KGG A; 
#chains in the Genus database with same CATH topology
 5JG6 A;  3LJU X;  4YBS A;  3LVQ E;  3V43 A;  3LQI A;  1FBV A;  5LKX A;  1Z6U A;  2C2V S;  2MT5 A;  1FP0 A;  2CRR A;  2LDR A;  2LQ6 A;  2YYR A;  1CHC A;  1WIM A;  2YQM A;  3PUR A;  5I3L A;  3FAN A;  2PUY A;  1WEO A;  4GND A;  2LGG A;  3N9L A;  5DKA A;  1JM7 B;  5AIT A;  2LXP C;  2QIZ A;  3SOW A;  3FJU B;  2E6S A;  2KKX A;  3SOX A;  2FFW A;  3L11 A;  3ZTG A;  4LAD B;  3U5N A;  2ECI A;  3M62 A;  2ECV A;  2CKL B;  2MA5 A;  4N4F A;  5TRB A;  4CA1 A;  3U5O A;  3PHD A;  5SVX A;  2YHN A;  3ZVY A;  2D8S A;  2YW8 A;  2L75 A;  1G25 A;  2VJE B;  5H9M A;  4FO9 A;  2L80 A;  5B77 A;  1WEM A;  3PLW A;  2YRE A;  4IC3 A;  2H0D B;  5TAB A;  2VP7 A;  1JM7 A;  4LKA A;  2M1R A;  2KE1 A;  2L43 A;  2AN6 A;  4I7D A;  5H1V A;  2EOD A;  2KIZ A;  2DX8 A;  4LLB A;  2KRE A;  2F6N A;  2VPB A;  2L0B A;  4UI9 B;  3N9O A;  2UZG A;  1MM2 A;  2CKL A;  3FEH A;  1K2F A;  1MBM A;  2Y1N A;  3QZV A;  2ECJ A;  1IYM A;  2C2L A;  2G43 A;  2ECW A;  3EB5 A;  2YT5 A;  4A49 A;  4LJN A;  4AVX A;  4UP5 A;  5FB1 A;  2OXQ C;  2HYE D;  3HCT A;  3GV4 A;  3E2D A;  3KQI A;  5C13 A;  5C11 A;  2M6M A;  2YHO A;  2XEU A;  2XP0 A;  5TBN A;  2KU3 A;  1MM3 A;  4ZUX U;  2VNF A;  2RI7 A;  4P5O B;  3RTR B;  4BBQ A;  2ZET C;  2EGP A;  5B76 A;  5H1U A;  4FIP A;  2Y43 A;  3FL2 A;  3LDY A;  3L1Z B;  3DQV R;  2MNY A;  4C9Z A;  4WZ0 A;  2NAA A;  2F42 A;  2LN0 A;  1Z60 A;  2KKY A;  2VPG A;  3ZPV 1;  4YC9 A;  1VD4 A;  4FK5 A;  2K17 A;  1U6G B;  5FEY A;  2FUU A;  1ZBD B;  3O36 A;  4R7E A;  5D1L B;  5J3X A;  1WE9 A;  3SHB A;  3T9K A;  5TDW A;  4B7Y C;  3GL6 A;  2YSJ A;  2BAY A;  3KDE C;  4A0C D;  5FER A;  2P57 A;  2MD7 B;  4YAX A;  3RPG C;  2D8U A;  3HTK C;  4ZDT A;  4WA6 A;  3M63 A;  2JMJ A;  4MSX A;  3ZNI A;  2KFT A;  5LKT A;  4GNG A;  3M99 A;  4TKP B;  3ZPV E;  3FM8 C;  2E61 A;  4H9D A;  4S3O B;  3FAO A;  2XOY A;  2CSY A;  5K3Q A;  2I50 A;  4YBT A;  3SOU A;  3LQH A;  2FSA A;  2ECG A;  2IQJ A;  1DCQ A;  4GNE A;  4CCG X;  4FJC A;  2KWJ A;  2KWO A;  2MNZ A;  4OGC A;  5G0F A;  5TDR A;  4X3G A;  5D1M B;  2CT2 A;  2LRI C;  5DIN A;  3N9N A;  2VPD A;  2G45 A;  4QQ4 A;  2CRW A;  3C5K A;  3JUE A;  1X4J A;  3DPL R;  4AYC B;  5B79 A;  1WEP A;  3O7A A;  2VPE A;  4YAT A;  4B86 C;  2JRJ A;  2F6J A;  1V87 A;  3KV5 A;  2KGI A;  2FD4 A;  4O62 A;  5G04 B;  5SVY A;  2VJF B;  2ECN A;  4QF3 A;  1HYI A;  2YUR A;  2M3H A;  2MKE A;  2DSM A;  1VFY A;  1WEU A;  3N9P A;  4V3L C;  5B78 A;  2FUI A;  4XI1 A;  2G6Q A;  3T6R A;  2LGV A;  3I2D A;  4GNF A;  4LK9 A;  2JM3 A;  1WEN A;  3ZVZ B;  4A4B A;  3O70 A;  5B75 A;  4AYC A;  3KNV A;  4GB0 A;  2MD8 C;  3U5M A;  5SVI B;  3KV6 A;  2XOC A;  3MHS A;  4UP0 A;  2EXU A;  1WES A;  3LRQ A;  2MIQ A;  4R8P K;  4ZQL A;  1VYX A;  4W4U A;  2EA6 A;  5H1T A;  2VJF A;  1N87 A;  4S3O C;  2XB1 A;  4I7B A;  3T7L A;  2LGL A;  3LVR E;  3O33 A;  4Z0R A;  2JUN A;  2ECT A;  2KWK A;  1XWH A;  4WZ3 B;  4Z0O A;  5KH9 A;  3NG2 A;  1Z2Q A;  2YVR A;  4PTB A;  2KYU A;  5EYA F;  3O35 A;  3VK6 A;  3N9M A;  4YAB A;  1HYJ A;  5G05 B;  2K4D A;  2LGK A;  2RSD A;  2MUM A;  5LCW B;  1F62 A;  5SVI A;  2KWN A;  2QIC A;  4R2Y A;  2XOZ A;  3HCS A;  1WFK A;  3LQJ A;  5AIU A;  5B8D A;  4PPE A;  3Q1D A;  4O64 A;  1LDJ B;  3L1X A;  2LV9 A;  5D1K B;  2E6R A;  4V3K C;  4NN2 A;  4BHW A;  2M85 A;  1LDK C;  3H7H A;  1WEE A;  4L58 A;  4Q6F A;  3PUQ A;  1WEQ A;  1WEW A;  3SUB A;  2L5U A;  2YQL A;  3O37 A;  4OGE A;  3MDB C;  3ASL A;  4N3W A;  5KH7 A;  3M7K A;  3O47 A;  2JMD A;  4YBM A;  4AUQ B;  1JOC A;  4L7X A;  1WEV A;  2K16 A;  2KR4 A;  2EGM A;  1T1H A;  2YU4 A;  2CSV A;  2CSZ A;  4YAD A;  2JMI A;  2RR4 A;  3C6W A;  3U5P A;  3RPG B;  3DDT A;  2QJ0 A;  2DJA A;  1WIL A;  2L7P A;  5LKZ A;  3EB6 A;  4IC2 A;  4F1P A;  4AP4 A;  1WGM A;  3IHP A;  3N9Q A;  4A4C A;  5KH3 A;  1X4U A;  2MA6 A;  2OWA A;  5LKU A;  2VJE A;  2IDA A;  2M13 A;  2Y1M A;  3HCU A;  2YUC A;  1DVP A;  2K1J A;  2H0D A;  3DWD A;  4I7C A;  4WZ2 A;  2LAU A;  4F52 B;  2PNX A;  3O34 A;  3MHH A;  1E4U A;  2CON A;  5FB0 A;  2B0O E;  1X4I A;  4QF2 A;  2YSM A;  4MVT A;  2HDP A;  1RMD A;  3ZYQ A;  1BOR A;  2LXH C;  2KGG A; 
#chains in the Genus database with same CATH homology
 5JG6 A;  4YBS A;  3V43 A;  3LQI A;  1FBV A;  5LKX A;  1Z6U A;  2C2V S;  2MT5 A;  1FP0 A;  2LDR A;  2YYR A;  2LQ6 A;  1CHC A;  1WIM A;  2YQM A;  3PUR A;  5I3L A;  2PUY A;  1WEO A;  4GND A;  2LGG A;  3N9L A;  5DKA A;  1JM7 B;  5AIT A;  2LXP C;  2QIZ A;  3SOW A;  2E6S A;  3SOX A;  3L11 A;  3ZTG A;  4LAD B;  3U5N A;  2ECI A;  3M62 A;  2ECV A;  2CKL B;  2MA5 A;  4N4F A;  5TRB A;  4CA1 A;  3U5O A;  3PHD A;  2YHN A;  3ZVY A;  2D8S A;  2YW8 A;  2L75 A;  1G25 A;  2VJE B;  5H9M A;  4FO9 A;  2L80 A;  5B77 A;  1WEM A;  2YRE A;  4IC3 A;  2H0D B;  5TAB A;  2VP7 A;  1JM7 A;  4LKA A;  2M1R A;  2KE1 A;  2L43 A;  2AN6 A;  4I7D A;  5H1V A;  2EOD A;  2KIZ A;  2DX8 A;  4LLB A;  2KRE A;  2F6N A;  2VPB A;  2L0B A;  4UI9 B;  3N9O A;  2UZG A;  1MM2 A;  2CKL A;  1K2F A;  2Y1N A;  3QZV A;  2ECJ A;  1IYM A;  2C2L A;  2G43 A;  2ECW A;  3EB5 A;  2YT5 A;  4A49 A;  4LJN A;  4AVX A;  4UP5 A;  5FB1 A;  2OXQ C;  2HYE D;  3HCT A;  3GV4 A;  3KQI A;  5C13 A;  5C11 A;  2M6M A;  2YHO A;  2XEU A;  5TBN A;  2KU3 A;  1MM3 A;  4ZUX U;  2VNF A;  2RI7 A;  4P5O B;  3RTR B;  4BBQ A;  2ZET C;  2EGP A;  5B76 A;  5H1U A;  4FIP A;  2Y43 A;  3FL2 A;  3L1Z B;  3DQV R;  2MNY A;  4C9Z A;  4WZ0 A;  2NAA A;  2F42 A;  2LN0 A;  1Z60 A;  2VPG A;  3ZPV 1;  4YC9 A;  1VD4 A;  4FK5 A;  2K17 A;  1U6G B;  5FEY A;  2FUU A;  1ZBD B;  3O36 A;  4R7E A;  5D1L B;  5J3X A;  1WE9 A;  3SHB A;  5TDW A;  4B7Y C;  3GL6 A;  2YSJ A;  2BAY A;  4A0C D;  5FER A;  2MD7 B;  4YAX A;  3RPG C;  3HTK C;  4ZDT A;  4WA6 A;  3M63 A;  2JMJ A;  4MSX A;  3ZNI A;  2KFT A;  5LKT A;  4GNG A;  3M99 A;  4TKP B;  3ZPV E;  4S3O B;  2CSY A;  2I50 A;  4YBT A;  3SOU A;  3LQH A;  2FSA A;  2ECG A;  4GNE A;  4CCG X;  4FJC A;  2KWJ A;  2KWO A;  2MNZ A;  5G0F A;  5TDR A;  4X3G A;  5D1M B;  2CT2 A;  2LRI C;  5DIN A;  3N9N A;  2VPD A;  2G45 A;  3C5K A;  1X4J A;  3DPL R;  4AYC B;  5B79 A;  1WEP A;  3O7A A;  2VPE A;  4YAT A;  4B86 C;  2JRJ A;  2F6J A;  1V87 A;  3KV5 A;  2KGI A;  5G04 B;  2VJF B;  2ECN A;  4QF3 A;  1HYI A;  2YUR A;  2M3H A;  1VFY A;  1WEU A;  3N9P A;  4V3L C;  5B78 A;  2FUI A;  4XI1 A;  2G6Q A;  3T6R A;  2LGV A;  3I2D A;  4GNF A;  4LK9 A;  1WEN A;  3ZVZ B;  4A4B A;  3O70 A;  5B75 A;  4AYC A;  3KNV A;  4GB0 A;  2MD8 C;  3U5M A;  3KV6 A;  3MHS A;  4UP0 A;  1WES A;  3LRQ A;  2MIQ A;  4R8P K;  4ZQL A;  1VYX A;  4W4U A;  2EA6 A;  5H1T A;  2VJF A;  1N87 A;  4S3O C;  2XB1 A;  4I7B A;  3T7L A;  2LGL A;  3O33 A;  2ECT A;  2KWK A;  1XWH A;  4WZ3 B;  5KH9 A;  3NG2 A;  1Z2Q A;  4PTB A;  2KYU A;  5EYA F;  3O35 A;  3VK6 A;  3N9M A;  4YAB A;  1HYJ A;  5G05 B;  2K4D A;  2LGK A;  2RSD A;  2MUM A;  5LCW B;  1F62 A;  2KWN A;  2QIC A;  4R2Y A;  3HCS A;  1WFK A;  3LQJ A;  5AIU A;  5B8D A;  4PPE A;  4O64 A;  1LDJ B;  3L1X A;  2LV9 A;  5D1K B;  2E6R A;  4V3K C;  4NN2 A;  4BHW A;  2M85 A;  1LDK C;  1WEE A;  4L58 A;  4Q6F A;  3PUQ A;  1WEQ A;  1WEW A;  2L5U A;  2YQL A;  3O37 A;  3ASL A;  4N3W A;  5KH7 A;  2JMD A;  4YBM A;  4AUQ B;  1JOC A;  4L7X A;  1WEV A;  2K16 A;  2KR4 A;  1T1H A;  2YU4 A;  2CSZ A;  4YAD A;  2JMI A;  3C6W A;  3U5P A;  3RPG B;  2QJ0 A;  1WIL A;  5LKZ A;  3EB6 A;  4IC2 A;  4AP4 A;  1WGM A;  3IHP A;  3N9Q A;  4A4C A;  5KH3 A;  1X4U A;  2MA6 A;  5LKU A;  2VJE A;  2IDA A;  2Y1M A;  3HCU A;  2YUC A;  1DVP A;  2K1J A;  2H0D A;  4I7C A;  4WZ2 A;  4F52 B;  2PNX A;  3MHH A;  3O34 A;  1E4U A;  5FB0 A;  1X4I A;  4QF2 A;  2YSM A;  4MVT A;  2HDP A;  1RMD A;  3ZYQ A;  1BOR A;  2LXH C;  2KGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...