2LGVA

Rbx1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RBX1
publication title Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgvA00
2KR4A 2K1JA 2YREA 2L75A 5H1UA 3QZVA 2MA5A 2YHNA 4V3KC 3O33A 1WIMA 1VYXA 4I7DA 3ASLA 4GNFA 4GB0A 5D1MB 2YUCA 4YC9A 2KWKA 5C11A 2KFTA 3MHHA 2NAAA 3N9MA 4R8PK 2LXHC 2LGLA 3EB5A 5LKTA 2LQ6A 3VK6A 4YBMA 5B76A 2M3HA 3LRQA 2VJEB 1MM2A 4O64A 3RPGB 2JMJA 4B86C 3U5PA 2G45A 3KV6A 3PUQA 1JOCA 2YYRA 2L43A 3N9QA 3O37A 4L7XA 4LJNA 1VD4A 5D1LB 2QICA 4I7CA 4UP0A 2YQLA 4F52B 5B8DA 4AYCA 2MD8C 2ECVA 2LRIC 2YW8A 2LV9A 2QIZA 5I3LA 3ZNIA 5B79A 2MIQA 2LGGA 5J3XA 4L58A 4ZDTA 2VPGA 4V3LC 4N4FA 2JRJA 2FUIA 2K4DA 4QF3A 2ECTA 2CKLB 1G25A 1WEMA 4ZUXU 5B75A 3N9PA 2LDRA 2KE1A 1T1HA 2F42A 4IC3A 1N87A 1WEEA 2MUMA 3O7AA 4MVTA 4C9ZA 2KWOA 4S3OB 1WEPA 1WILA 2VNFA 4A49A 3SOWA 3SOUA 2VPBA 1LDJB 2PNXA 2Y43A 5EYAF 5FERA 4CCGX 3I2DA 2YSMA 2Y1NA 2YU4A 3M62A 3U5OA 3N9OA 5G04B 4FO9A 2ECNA 4A0CD 4X3GA 2CSYA 4I7BA 2VPDA 1WEUA 2ECIA 4AYCB 5KH9A 5H1TA 2EGPA 1E4UA 4UI9B 1V87A 5AITA 3PURA 4B7YC 3SHBA 3EB6A 2KIZA 5FB1A 5KH3A 4WZ3B 4FK5A 4BBQA 4AP4A 3NG2A 4LLBA 3L1XA 4PPEA 4R7EA 4YATA 5DKAA 2G43A 3HCUA 3KV5A 1MM3A 3LQJA 5TDWA 2H0DA 1JM7A 3DPLR 3C6WA 5LCWB 2VPEA 5G05B 5G0FA 5FEYA 3LQIA 4ZQLA 1WEWA 5D1KB 2D8SA 4GNEA 4PTBA 1CHCA 5H1VA 2EODA 2RSDA 3O36A 4UP5A 2F6NA 2MA6A 3GL6A 5TDRA 2JMDA 2KYUA 3SOXA 2E6SA 3HCTA 2M6MA 4P5OB 2ECGA 3IHPA 4AUQB 2ECWA 2MD7B 1FBVA 2DX8A 3M99A 4YBTA 1X4JA 4N3WA 2M1RA 1WEOA 4YAXA 4Q6FA 3T6RA 1DVPA 4WA6A 1Z60A 4AVXA 1HYIA 3T7LA 2HYED 4XI1A 2LXPC 2H0DB 2YQMA 1JM7B 4A4BA 3GV4A 4FJCA 3KNVA 1F62A 2YSJA 2K17A 2I50A 3RPGC 3ZPV1 1WFKA 2XB1A 5TBNA 4LK9A 2KWNA 3C5KA 4LKAA 2RI7A 2LGKA 2UZGA 4YABA 1RMDA 3MHSA 1WEVA 3ZPVE 3L1ZB 5JG6A 2C2LA 3M63A 2K16A 4A4CA 3O70A 5DINA 2OXQC 5B78A 1ZBDB 1WESA 2VJFA 4R2YA 2L5UA 4FIPA 5C13A 2YT5A 2JMIA 2CSZA 2KU3A 4YBSA 1X4IA 5LKZA 1LDKC 5TRBA 4GNGA 2CKLA 3HTKC 1VFYA 2FSAA 5H9MA 2AN6A 3L11A 3ZTGA 4BHWA 3ZYQA 4GNDA 4WZ2A 1U6GB 2YURA 3ZVZB 2C2VS 2E6RA 3O34A 1WE9A 3V43A 2VP7A 4YADA 5FB0A 2XEUA 5AIUA 2F6JA 3ZVYA 2M85A 4LADB 3N9LA 2BAYA 2QJ0A 2HDPA 3DQVR 2PUYA 2YHOA 1WGMA 1WENA 1XWHA 3FL2A 3U5MA 2EA6A 3LQHA 4TKPB 4S3OC 4NN2A 2MT5A 5TABA 1FP0A 1X4UA 3KQIA 1IYMA 1Z6UA 1Z2QA 1BORA 2KGIA 3PHDA 2LGVA 2VJFB 4MSXA 1K2FA 2KWJA 5LKXA 3HCSA 2G6QA 2L0BA 3N9NA 2VJEA 2KGGA 2MNYA 5KH7A 4WZ0A 2ECJA 5B77A 4IC2A 2Y1MA 1HYJA 4QF2A 5LKUA 2CT2A 3O35A 2FUUA 4CA1A 2LN0A 3U5NA 2L80A 1WEQA 3RTRB 2IDAA 4W4UA 2KREA 2ZETC 2MNZA
chains in the Genus database with same CATH superfamily
2DJAA 2KR4A 2K1JA 2YREA 2L75A 1DCQA 5H1UA 3QZVA 2MA5A 2YHNA 4V3KC 2EGMA 3O33A 1WIMA 1VYXA 4I7DA 3ASLA 4GNFA 2FD4A 4GB0A 5D1MB 2YUCA 4YC9A 2CRWA 2KWKA 5C11A 2KFTA 3MHHA 2RR4A 2NAAA 3N9MA 4R8PK 2LXHC 2LGLA 3EB5A 5LKTA 2LQ6A 3VK6A 4QQ4A 4YBMA 5B76A 2M3HA 3LRQA 2VJEB 1MM2A 4O64A 3RPGB 2JMJA 3PLWA 4B86C 3SUBA 3U5PA 2G45A 3KV6A 3PUQA 1JOCA 2YYRA 2L43A 3N9QA 2JUNA 2CSVA 3O37A 4L7XA 4LJNA 3H7HA 1VD4A 4H9DA 5D1LB 2QICA 2XOYA 4I7CA 4UP0A 2YQLA 4F52B 5K3QA 5B8DA 4AYCA 2MD8C 2ECVA 2LRIC 2YW8A 2LV9A 2QIZA 5I3LA 3ZNIA 5B79A 2MIQA 2LGGA 5J3XA 2IQJA 2CRRA 2M13A 4L58A 4ZDTA 2VPGA 3KDEC 5SVIA 4V3LC 4N4FA 3DDTA 2JRJA 2FUIA 2K4DA 4QF3A 4F1PA 2ECTA 2CKLB 1G25A 1WEMA 4ZUXU 5B75A 3N9PA 2LDRA 2KE1A 1T1HA 2F42A 4IC3A 1N87A 1WEEA 2MUMA 3O7AA 4MVTA 4OGCA 4C9ZA 2KWOA 4S3OB 1WEPA 1WILA 2VNFA 4A49A 3SOWA 3SOUA 2VPBA 1LDJB 2PNXA 2Y43A 5EYAF 5FERA 4CCGX 3I2DA 3LJUX 2YSMA 2XP0A 2Y1NA 2YU4A 3M62A 3U5OA 2L7PA 3N9OA 5G04B 2MKEA 4FO9A 2ECNA 4A0CD 4X3GA 2CSYA 4I7BA 2VPDA 1WEUA 2ECIA 5SVXA 4AYCB 5KH9A 5H1TA 2EGPA 1E4UA 4UI9B 1V87A 5AITA 3PURA 4B7YC 3SHBA 3E2DA 3EB6A 5SVIB 2KIZA 5FB1A 5KH3A 4WZ3B 4FK5A 2P57A 4BBQA 4AP4A 3NG2A 4LLBA 3L1XA 4PPEA 4R7EA 4YATA 5DKAA 2G43A 3HCUA 2E61A 3KV5A 3T9KA 1MM3A 3LQJA 5TDWA 2H0DA 1JM7A 3DPLR 3C6WA 3Q1DA 5LCWB 2VPEA 5G05B 5G0FA 5FEYA 3LQIA 4ZQLA 1WEWA 5D1KB 2D8SA 4GNEA 4PTBA 1CHCA 5H1VA 2XOCA 2EODA 2RSDA 3FJUB 3O36A 4UP5A 2F6NA 2D8UA 2MA6A 3GL6A 5TDRA 2JMDA 4Z0OA 2KYUA 3SOXA 2E6SA 3HCTA 2M6MA 4P5OB 2ECGA 3IHPA 4AUQB 2ECWA 3FANA 2MD7B 1FBVA 2DX8A 3JUEA 3M99A 4YBTA 1X4JA 4N3WA 2M1RA 1WEOA 4YAXA 4Q6FA 3T6RA 1DVPA 4WA6A 1Z60A 4AVXA 1HYIA 3T7LA 2HYED 4XI1A 2LXPC 2H0DB 2YQMA 1JM7B 3FEHA 4A4BA 3GV4A 4FJCA 3KNVA 1F62A 2YSJA 2KKXA 2K17A 2I50A 3RPGC 3ZPV1 1WFKA 2XB1A 4Z0RA 5TBNA 4LK9A 2KWNA 3C5KA 4LKAA 2YVRA 2RI7A 3FM8C 2LGKA 2UZGA 4YABA 1RMDA 3MHSA 1WEVA 3O47A 3LVQE 3ZPVE 3L1ZB 5JG6A 2C2LA 3M63A 2K16A 4A4CA 3O70A 5DINA 2OXQC 5B78A 5SVYA 1ZBDB 1WESA 2VJFA 4R2YA 3LVRE 2L5UA 4FIPA 5C13A 2YT5A 2JMIA 2CSZA 2CONA 2KU3A 4YBSA 4OGEA 2XOZA 1X4IA 5LKZA 1LDKC 5TRBA 4GNGA 2DSMA 2CKLA 3HTKC 3MDBC 1VFYA 2FSAA 5H9MA 2AN6A 3L11A 3ZTGA 4BHWA 3ZYQA 2LAUA 4GNDA 4WZ2A 3DWDA 1U6GB 2YURA 3ZVZB 2EXUA 4O62A 2C2VS 2E6RA 3O34A 1WE9A 3V43A 2VP7A 3FAOA 4YADA 3M7KA 5FB0A 2XEUA 5AIUA 3LDYA 2F6JA 3ZVYA 2M85A 4LADB 3N9LA 2BAYA 2QJ0A 2HDPA 3DQVR 2PUYA 2YHOA 1WGMA 1WENA 1XWHA 2FFWA 3FL2A 3U5MA 2EA6A 3LQHA 4TKPB 4S3OC 2OWAA 4NN2A 2MT5A 5TABA 1FP0A 1X4UA 3KQIA 1IYMA 1Z6UA 1Z2QA 2B0OE 1BORA 2KGIA 3PHDA 2LGVA 2VJFB 4MSXA 1K2FA 2KWJA 5LKXA 3HCSA 2G6QA 2L0BA 3N9NA 2VJEA 2KGGA 2MNYA 1MBMA 5KH7A 4WZ0A 2ECJA 5B77A 4IC2A 2Y1MA 1HYJA 4QF2A 5LKUA 2CT2A 3O35A 2JM3A 2FUUA 4CA1A 2LN0A 2KKYA 3U5NA 2L80A 1WEQA 3RTRB 2IDAA 4W4UA 2KREA 2ZETC 2MNZA
chains in the Genus database with same CATH topology
2KR4A 2K1JA 2YREA 2L75A 5H1UA 3QZVA 2MA5A 2YHNA 4V3KC 3O33A 1WIMA 1VYXA 4I7DA 3ASLA 4GNFA 4GB0A 5D1MB 2YUCA 4YC9A 2KWKA 5C11A 2KFTA 3MHHA 2NAAA 3N9MA 4R8PK 2LXHC 2LGLA 3EB5A 5LKTA 2LQ6A 3VK6A 4YBMA 5B76A 2M3HA 3LRQA 2VJEB 1MM2A 4O64A 3RPGB 2JMJA 4B86C 3U5PA 2G45A 3KV6A 3PUQA 1JOCA 2YYRA 2L43A 3N9QA 3O37A 4L7XA 4LJNA 1VD4A 5D1LB 2QICA 4I7CA 4UP0A 2YQLA 4F52B 5B8DA 4AYCA 2MD8C 2ECVA 2LRIC 2YW8A 2LV9A 2QIZA 5I3LA 3ZNIA 5B79A 2MIQA 2LGGA 5J3XA 4L58A 4ZDTA 2VPGA 4V3LC 4N4FA 2JRJA 2FUIA 2K4DA 4QF3A 2ECTA 2CKLB 1G25A 1WEMA 4ZUXU 5B75A 3N9PA 2LDRA 2KE1A 1T1HA 2F42A 4IC3A 1N87A 1WEEA 2MUMA 3O7AA 4MVTA 4C9ZA 2KWOA 4S3OB 1WEPA 1WILA 2VNFA 4A49A 3SOWA 3SOUA 2VPBA 1LDJB 2PNXA 2Y43A 5EYAF 5FERA 4CCGX 3I2DA 2YSMA 2Y1NA 2YU4A 3M62A 3U5OA 3N9OA 5G04B 4FO9A 2ECNA 4A0CD 4X3GA 2CSYA 4I7BA 2VPDA 1WEUA 2ECIA 4AYCB 5KH9A 5H1TA 2EGPA 1E4UA 4UI9B 1V87A 5AITA 3PURA 4B7YC 3SHBA 3EB6A 2KIZA 5FB1A 5KH3A 4WZ3B 4FK5A 4BBQA 4AP4A 3NG2A 4LLBA 3L1XA 4PPEA 4R7EA 4YATA 5DKAA 2G43A 3HCUA 3KV5A 1MM3A 3LQJA 5TDWA 2H0DA 1JM7A 3DPLR 3C6WA 5LCWB 2VPEA 5G05B 5G0FA 5FEYA 3LQIA 4ZQLA 1WEWA 5D1KB 2D8SA 4GNEA 4PTBA 1CHCA 5H1VA 2EODA 2RSDA 3O36A 4UP5A 2F6NA 2MA6A 3GL6A 5TDRA 2JMDA 2KYUA 3SOXA 2E6SA 3HCTA 2M6MA 4P5OB 2ECGA 3IHPA 4AUQB 2ECWA 2MD7B 1FBVA 2DX8A 3M99A 4YBTA 1X4JA 4N3WA 2M1RA 1WEOA 4YAXA 4Q6FA 3T6RA 1DVPA 4WA6A 1Z60A 4AVXA 1HYIA 3T7LA 2HYED 4XI1A 2LXPC 2H0DB 2YQMA 1JM7B 4A4BA 3GV4A 4FJCA 3KNVA 1F62A 2YSJA 2K17A 2I50A 3RPGC 3ZPV1 1WFKA 2XB1A 5TBNA 4LK9A 2KWNA 3C5KA 4LKAA 2RI7A 2LGKA 2UZGA 4YABA 1RMDA 3MHSA 1WEVA 3ZPVE 3L1ZB 5JG6A 2C2LA 3M63A 2K16A 4A4CA 3O70A 5DINA 2OXQC 5B78A 1ZBDB 1WESA 2VJFA 4R2YA 2L5UA 4FIPA 5C13A 2YT5A 2JMIA 2CSZA 2KU3A 4YBSA 1X4IA 5LKZA 1LDKC 5TRBA 4GNGA 2CKLA 3HTKC 1VFYA 2FSAA 5H9MA 2AN6A 3L11A 3ZTGA 4BHWA 3ZYQA 4GNDA 4WZ2A 1U6GB 2YURA 3ZVZB 2C2VS 2E6RA 3O34A 1WE9A 3V43A 2VP7A 4YADA 5FB0A 2XEUA 5AIUA 2F6JA 3ZVYA 2M85A 4LADB 3N9LA 2BAYA 2QJ0A 2HDPA 3DQVR 2PUYA 2YHOA 1WGMA 1WENA 1XWHA 3FL2A 3U5MA 2EA6A 3LQHA 4TKPB 4S3OC 4NN2A 2MT5A 5TABA 1FP0A 1X4UA 3KQIA 1IYMA 1Z6UA 1Z2QA 1BORA 2KGIA 3PHDA 2LGVA 2VJFB 4MSXA 1K2FA 2KWJA 5LKXA 3HCSA 2G6QA 2L0BA 3N9NA 2VJEA 2KGGA 2MNYA 5KH7A 4WZ0A 2ECJA 5B77A 4IC2A 2Y1MA 1HYJA 4QF2A 5LKUA 2CT2A 3O35A 2FUUA 4CA1A 2LN0A 3U5NA 2L80A 1WEQA 3RTRB 2IDAA 4W4UA 2KREA 2ZETC 2MNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KR4 A;  2K1J A;  2YRE A;  2L75 A;  5H1U A;  3QZV A;  2MA5 A;  2YHN A;  4V3K C;  3O33 A;  1WIM A;  1VYX A;  4I7D A;  3ASL A;  4GNF A;  4GB0 A;  5D1M B;  2YUC A;  4YC9 A;  2KWK A;  5C11 A;  2KFT A;  3MHH A;  2NAA A;  3N9M A;  4R8P K;  2LXH C;  2LGL A;  3EB5 A;  5LKT A;  2LQ6 A;  3VK6 A;  4YBM A;  5B76 A;  2M3H A;  3LRQ A;  2VJE B;  1MM2 A;  4O64 A;  3RPG B;  2JMJ A;  4B86 C;  3U5P A;  2G45 A;  3KV6 A;  3PUQ A;  1JOC A;  2YYR A;  2L43 A;  3N9Q A;  3O37 A;  4L7X A;  4LJN A;  1VD4 A;  5D1L B;  2QIC A;  4I7C A;  4UP0 A;  2YQL A;  4F52 B;  5B8D A;  4AYC A;  2MD8 C;  2ECV A;  2LRI C;  2YW8 A;  2LV9 A;  2QIZ A;  5I3L A;  3ZNI A;  5B79 A;  2MIQ A;  2LGG A;  5J3X A;  4L58 A;  4ZDT A;  2VPG A;  4V3L C;  4N4F A;  2JRJ A;  2FUI A;  2K4D A;  4QF3 A;  2ECT A;  2CKL B;  1G25 A;  1WEM A;  4ZUX U;  5B75 A;  3N9P A;  2LDR A;  2KE1 A;  1T1H A;  2F42 A;  4IC3 A;  1N87 A;  1WEE A;  2MUM A;  3O7A A;  4MVT A;  4C9Z A;  2KWO A;  4S3O B;  1WEP A;  1WIL A;  2VNF A;  4A49 A;  3SOW A;  3SOU A;  2VPB A;  1LDJ B;  2PNX A;  2Y43 A;  5EYA F;  5FER A;  4CCG X;  3I2D A;  2YSM A;  2Y1N A;  2YU4 A;  3M62 A;  3U5O A;  3N9O A;  5G04 B;  4FO9 A;  2ECN A;  4A0C D;  4X3G A;  2CSY A;  4I7B A;  2VPD A;  1WEU A;  2ECI A;  4AYC B;  5KH9 A;  5H1T A;  2EGP A;  1E4U A;  4UI9 B;  1V87 A;  5AIT A;  3PUR A;  4B7Y C;  3SHB A;  3EB6 A;  2KIZ A;  5FB1 A;  5KH3 A;  4WZ3 B;  4FK5 A;  4BBQ A;  4AP4 A;  3NG2 A;  4LLB A;  3L1X A;  4PPE A;  4R7E A;  4YAT A;  5DKA A;  2G43 A;  3HCU A;  3KV5 A;  1MM3 A;  3LQJ A;  5TDW A;  2H0D A;  1JM7 A;  3DPL R;  3C6W A;  5LCW B;  2VPE A;  5G05 B;  5G0F A;  5FEY A;  3LQI A;  4ZQL A;  1WEW A;  5D1K B;  2D8S A;  4GNE A;  4PTB A;  1CHC A;  5H1V A;  2EOD A;  2RSD A;  3O36 A;  4UP5 A;  2F6N A;  2MA6 A;  3GL6 A;  5TDR A;  2JMD A;  2KYU A;  3SOX A;  2E6S A;  3HCT A;  2M6M A;  4P5O B;  2ECG A;  3IHP A;  4AUQ B;  2ECW A;  2MD7 B;  1FBV A;  2DX8 A;  3M99 A;  4YBT A;  1X4J A;  4N3W A;  2M1R A;  1WEO A;  4YAX A;  4Q6F A;  3T6R A;  1DVP A;  4WA6 A;  1Z60 A;  4AVX A;  1HYI A;  3T7L A;  2HYE D;  4XI1 A;  2LXP C;  2H0D B;  2YQM A;  1JM7 B;  4A4B A;  3GV4 A;  4FJC A;  3KNV A;  1F62 A;  2YSJ A;  2K17 A;  2I50 A;  3RPG C;  3ZPV 1;  1WFK A;  2XB1 A;  5TBN A;  4LK9 A;  2KWN A;  3C5K A;  4LKA A;  2RI7 A;  2LGK A;  2UZG A;  4YAB A;  1RMD A;  3MHS A;  1WEV A;  3ZPV E;  3L1Z B;  5JG6 A;  2C2L A;  3M63 A;  2K16 A;  4A4C A;  3O70 A;  5DIN A;  2OXQ C;  5B78 A;  1ZBD B;  1WES A;  2VJF A;  4R2Y A;  2L5U A;  4FIP A;  5C13 A;  2YT5 A;  2JMI A;  2CSZ A;  2KU3 A;  4YBS A;  1X4I A;  5LKZ A;  1LDK C;  5TRB A;  4GNG A;  2CKL A;  3HTK C;  1VFY A;  2FSA A;  5H9M A;  2AN6 A;  3L11 A;  3ZTG A;  4BHW A;  3ZYQ A;  4GND A;  4WZ2 A;  1U6G B;  2YUR A;  3ZVZ B;  2C2V S;  2E6R A;  3O34 A;  1WE9 A;  3V43 A;  2VP7 A;  4YAD A;  5FB0 A;  2XEU A;  5AIU A;  2F6J A;  3ZVY A;  2M85 A;  4LAD B;  3N9L A;  2BAY A;  2QJ0 A;  2HDP A;  3DQV R;  2PUY A;  2YHO A;  1WGM A;  1WEN A;  1XWH A;  3FL2 A;  3U5M A;  2EA6 A;  3LQH A;  4TKP B;  4S3O C;  4NN2 A;  2MT5 A;  5TAB A;  1FP0 A;  1X4U A;  3KQI A;  1IYM A;  1Z6U A;  1Z2Q A;  1BOR A;  2KGI A;  3PHD A;  2LGV A;  2VJF B;  4MSX A;  1K2F A;  2KWJ A;  5LKX A;  3HCS A;  2G6Q A;  2L0B A;  3N9N A;  2VJE A;  2KGG A;  2MNY A;  5KH7 A;  4WZ0 A;  2ECJ A;  5B77 A;  4IC2 A;  2Y1M A;  1HYJ A;  4QF2 A;  5LKU A;  2CT2 A;  3O35 A;  2FUU A;  4CA1 A;  2LN0 A;  3U5N A;  2L80 A;  1WEQ A;  3RTR B;  2IDA A;  4W4U A;  2KRE A;  2ZET C;  2MNZ A; 
#chains in the Genus database with same CATH topology
 2DJA A;  2KR4 A;  2K1J A;  2YRE A;  2L75 A;  1DCQ A;  5H1U A;  3QZV A;  2MA5 A;  2YHN A;  4V3K C;  2EGM A;  3O33 A;  1WIM A;  1VYX A;  4I7D A;  3ASL A;  4GNF A;  2FD4 A;  4GB0 A;  5D1M B;  2YUC A;  4YC9 A;  2CRW A;  2KWK A;  5C11 A;  2KFT A;  3MHH A;  2RR4 A;  2NAA A;  3N9M A;  4R8P K;  2LXH C;  2LGL A;  3EB5 A;  5LKT A;  2LQ6 A;  3VK6 A;  4QQ4 A;  4YBM A;  5B76 A;  2M3H A;  3LRQ A;  2VJE B;  1MM2 A;  4O64 A;  3RPG B;  2JMJ A;  3PLW A;  4B86 C;  3SUB A;  3U5P A;  2G45 A;  3KV6 A;  3PUQ A;  1JOC A;  2YYR A;  2L43 A;  3N9Q A;  2JUN A;  2CSV A;  3O37 A;  4L7X A;  4LJN A;  3H7H A;  1VD4 A;  4H9D A;  5D1L B;  2QIC A;  2XOY A;  4I7C A;  4UP0 A;  2YQL A;  4F52 B;  5K3Q A;  5B8D A;  4AYC A;  2MD8 C;  2ECV A;  2LRI C;  2YW8 A;  2LV9 A;  2QIZ A;  5I3L A;  3ZNI A;  5B79 A;  2MIQ A;  2LGG A;  5J3X A;  2IQJ A;  2CRR A;  2M13 A;  4L58 A;  4ZDT A;  2VPG A;  3KDE C;  5SVI A;  4V3L C;  4N4F A;  3DDT A;  2JRJ A;  2FUI A;  2K4D A;  4QF3 A;  4F1P A;  2ECT A;  2CKL B;  1G25 A;  1WEM A;  4ZUX U;  5B75 A;  3N9P A;  2LDR A;  2KE1 A;  1T1H A;  2F42 A;  4IC3 A;  1N87 A;  1WEE A;  2MUM A;  3O7A A;  4MVT A;  4OGC A;  4C9Z A;  2KWO A;  4S3O B;  1WEP A;  1WIL A;  2VNF A;  4A49 A;  3SOW A;  3SOU A;  2VPB A;  1LDJ B;  2PNX A;  2Y43 A;  5EYA F;  5FER A;  4CCG X;  3I2D A;  3LJU X;  2YSM A;  2XP0 A;  2Y1N A;  2YU4 A;  3M62 A;  3U5O A;  2L7P A;  3N9O A;  5G04 B;  2MKE A;  4FO9 A;  2ECN A;  4A0C D;  4X3G A;  2CSY A;  4I7B A;  2VPD A;  1WEU A;  2ECI A;  5SVX A;  4AYC B;  5KH9 A;  5H1T A;  2EGP A;  1E4U A;  4UI9 B;  1V87 A;  5AIT A;  3PUR A;  4B7Y C;  3SHB A;  3E2D A;  3EB6 A;  5SVI B;  2KIZ A;  5FB1 A;  5KH3 A;  4WZ3 B;  4FK5 A;  2P57 A;  4BBQ A;  4AP4 A;  3NG2 A;  4LLB A;  3L1X A;  4PPE A;  4R7E A;  4YAT A;  5DKA A;  2G43 A;  3HCU A;  2E61 A;  3KV5 A;  3T9K A;  1MM3 A;  3LQJ A;  5TDW A;  2H0D A;  1JM7 A;  3DPL R;  3C6W A;  3Q1D A;  5LCW B;  2VPE A;  5G05 B;  5G0F A;  5FEY A;  3LQI A;  4ZQL A;  1WEW A;  5D1K B;  2D8S A;  4GNE A;  4PTB A;  1CHC A;  5H1V A;  2XOC A;  2EOD A;  2RSD A;  3FJU B;  3O36 A;  4UP5 A;  2F6N A;  2D8U A;  2MA6 A;  3GL6 A;  5TDR A;  2JMD A;  4Z0O A;  2KYU A;  3SOX A;  2E6S A;  3HCT A;  2M6M A;  4P5O B;  2ECG A;  3IHP A;  4AUQ B;  2ECW A;  3FAN A;  2MD7 B;  1FBV A;  2DX8 A;  3JUE A;  3M99 A;  4YBT A;  1X4J A;  4N3W A;  2M1R A;  1WEO A;  4YAX A;  4Q6F A;  3T6R A;  1DVP A;  4WA6 A;  1Z60 A;  4AVX A;  1HYI A;  3T7L A;  2HYE D;  4XI1 A;  2LXP C;  2H0D B;  2YQM A;  1JM7 B;  3FEH A;  4A4B A;  3GV4 A;  4FJC A;  3KNV A;  1F62 A;  2YSJ A;  2KKX A;  2K17 A;  2I50 A;  3RPG C;  3ZPV 1;  1WFK A;  2XB1 A;  4Z0R A;  5TBN A;  4LK9 A;  2KWN A;  3C5K A;  4LKA A;  2YVR A;  2RI7 A;  3FM8 C;  2LGK A;  2UZG A;  4YAB A;  1RMD A;  3MHS A;  1WEV A;  3O47 A;  3LVQ E;  3ZPV E;  3L1Z B;  5JG6 A;  2C2L A;  3M63 A;  2K16 A;  4A4C A;  3O70 A;  5DIN A;  2OXQ C;  5B78 A;  5SVY A;  1ZBD B;  1WES A;  2VJF A;  4R2Y A;  3LVR E;  2L5U A;  4FIP A;  5C13 A;  2YT5 A;  2JMI A;  2CSZ A;  2CON A;  2KU3 A;  4YBS A;  4OGE A;  2XOZ A;  1X4I A;  5LKZ A;  1LDK C;  5TRB A;  4GNG A;  2DSM A;  2CKL A;  3HTK C;  3MDB C;  1VFY A;  2FSA A;  5H9M A;  2AN6 A;  3L11 A;  3ZTG A;  4BHW A;  3ZYQ A;  2LAU A;  4GND A;  4WZ2 A;  3DWD A;  1U6G B;  2YUR A;  3ZVZ B;  2EXU A;  4O62 A;  2C2V S;  2E6R A;  3O34 A;  1WE9 A;  3V43 A;  2VP7 A;  3FAO A;  4YAD A;  3M7K A;  5FB0 A;  2XEU A;  5AIU A;  3LDY A;  2F6J A;  3ZVY A;  2M85 A;  4LAD B;  3N9L A;  2BAY A;  2QJ0 A;  2HDP A;  3DQV R;  2PUY A;  2YHO A;  1WGM A;  1WEN A;  1XWH A;  2FFW A;  3FL2 A;  3U5M A;  2EA6 A;  3LQH A;  4TKP B;  4S3O C;  2OWA A;  4NN2 A;  2MT5 A;  5TAB A;  1FP0 A;  1X4U A;  3KQI A;  1IYM A;  1Z6U A;  1Z2Q A;  2B0O E;  1BOR A;  2KGI A;  3PHD A;  2LGV A;  2VJF B;  4MSX A;  1K2F A;  2KWJ A;  5LKX A;  3HCS A;  2G6Q A;  2L0B A;  3N9N A;  2VJE A;  2KGG A;  2MNY A;  1MBM A;  5KH7 A;  4WZ0 A;  2ECJ A;  5B77 A;  4IC2 A;  2Y1M A;  1HYJ A;  4QF2 A;  5LKU A;  2CT2 A;  3O35 A;  2JM3 A;  2FUU A;  4CA1 A;  2LN0 A;  2KKY A;  3U5N A;  2L80 A;  1WEQ A;  3RTR B;  2IDA A;  4W4U A;  2KRE A;  2ZET C;  2MNZ A; 
#chains in the Genus database with same CATH homology
 2KR4 A;  2K1J A;  2YRE A;  2L75 A;  5H1U A;  3QZV A;  2MA5 A;  2YHN A;  4V3K C;  3O33 A;  1WIM A;  1VYX A;  4I7D A;  3ASL A;  4GNF A;  4GB0 A;  5D1M B;  2YUC A;  4YC9 A;  2KWK A;  5C11 A;  2KFT A;  3MHH A;  2NAA A;  3N9M A;  4R8P K;  2LXH C;  2LGL A;  3EB5 A;  5LKT A;  2LQ6 A;  3VK6 A;  4YBM A;  5B76 A;  2M3H A;  3LRQ A;  2VJE B;  1MM2 A;  4O64 A;  3RPG B;  2JMJ A;  4B86 C;  3U5P A;  2G45 A;  3KV6 A;  3PUQ A;  1JOC A;  2YYR A;  2L43 A;  3N9Q A;  3O37 A;  4L7X A;  4LJN A;  1VD4 A;  5D1L B;  2QIC A;  4I7C A;  4UP0 A;  2YQL A;  4F52 B;  5B8D A;  4AYC A;  2MD8 C;  2ECV A;  2LRI C;  2YW8 A;  2LV9 A;  2QIZ A;  5I3L A;  3ZNI A;  5B79 A;  2MIQ A;  2LGG A;  5J3X A;  4L58 A;  4ZDT A;  2VPG A;  4V3L C;  4N4F A;  2JRJ A;  2FUI A;  2K4D A;  4QF3 A;  2ECT A;  2CKL B;  1G25 A;  1WEM A;  4ZUX U;  5B75 A;  3N9P A;  2LDR A;  2KE1 A;  1T1H A;  2F42 A;  4IC3 A;  1N87 A;  1WEE A;  2MUM A;  3O7A A;  4MVT A;  4C9Z A;  2KWO A;  4S3O B;  1WEP A;  1WIL A;  2VNF A;  4A49 A;  3SOW A;  3SOU A;  2VPB A;  1LDJ B;  2PNX A;  2Y43 A;  5EYA F;  5FER A;  4CCG X;  3I2D A;  2YSM A;  2Y1N A;  2YU4 A;  3M62 A;  3U5O A;  3N9O A;  5G04 B;  4FO9 A;  2ECN A;  4A0C D;  4X3G A;  2CSY A;  4I7B A;  2VPD A;  1WEU A;  2ECI A;  4AYC B;  5KH9 A;  5H1T A;  2EGP A;  1E4U A;  4UI9 B;  1V87 A;  5AIT A;  3PUR A;  4B7Y C;  3SHB A;  3EB6 A;  2KIZ A;  5FB1 A;  5KH3 A;  4WZ3 B;  4FK5 A;  4BBQ A;  4AP4 A;  3NG2 A;  4LLB A;  3L1X A;  4PPE A;  4R7E A;  4YAT A;  5DKA A;  2G43 A;  3HCU A;  3KV5 A;  1MM3 A;  3LQJ A;  5TDW A;  2H0D A;  1JM7 A;  3DPL R;  3C6W A;  5LCW B;  2VPE A;  5G05 B;  5G0F A;  5FEY A;  3LQI A;  4ZQL A;  1WEW A;  5D1K B;  2D8S A;  4GNE A;  4PTB A;  1CHC A;  5H1V A;  2EOD A;  2RSD A;  3O36 A;  4UP5 A;  2F6N A;  2MA6 A;  3GL6 A;  5TDR A;  2JMD A;  2KYU A;  3SOX A;  2E6S A;  3HCT A;  2M6M A;  4P5O B;  2ECG A;  3IHP A;  4AUQ B;  2ECW A;  2MD7 B;  1FBV A;  2DX8 A;  3M99 A;  4YBT A;  1X4J A;  4N3W A;  2M1R A;  1WEO A;  4YAX A;  4Q6F A;  3T6R A;  1DVP A;  4WA6 A;  1Z60 A;  4AVX A;  1HYI A;  3T7L A;  2HYE D;  4XI1 A;  2LXP C;  2H0D B;  2YQM A;  1JM7 B;  4A4B A;  3GV4 A;  4FJC A;  3KNV A;  1F62 A;  2YSJ A;  2K17 A;  2I50 A;  3RPG C;  3ZPV 1;  1WFK A;  2XB1 A;  5TBN A;  4LK9 A;  2KWN A;  3C5K A;  4LKA A;  2RI7 A;  2LGK A;  2UZG A;  4YAB A;  1RMD A;  3MHS A;  1WEV A;  3ZPV E;  3L1Z B;  5JG6 A;  2C2L A;  3M63 A;  2K16 A;  4A4C A;  3O70 A;  5DIN A;  2OXQ C;  5B78 A;  1ZBD B;  1WES A;  2VJF A;  4R2Y A;  2L5U A;  4FIP A;  5C13 A;  2YT5 A;  2JMI A;  2CSZ A;  2KU3 A;  4YBS A;  1X4I A;  5LKZ A;  1LDK C;  5TRB A;  4GNG A;  2CKL A;  3HTK C;  1VFY A;  2FSA A;  5H9M A;  2AN6 A;  3L11 A;  3ZTG A;  4BHW A;  3ZYQ A;  4GND A;  4WZ2 A;  1U6G B;  2YUR A;  3ZVZ B;  2C2V S;  2E6R A;  3O34 A;  1WE9 A;  3V43 A;  2VP7 A;  4YAD A;  5FB0 A;  2XEU A;  5AIU A;  2F6J A;  3ZVY A;  2M85 A;  4LAD B;  3N9L A;  2BAY A;  2QJ0 A;  2HDP A;  3DQV R;  2PUY A;  2YHO A;  1WGM A;  1WEN A;  1XWH A;  3FL2 A;  3U5M A;  2EA6 A;  3LQH A;  4TKP B;  4S3O C;  4NN2 A;  2MT5 A;  5TAB A;  1FP0 A;  1X4U A;  3KQI A;  1IYM A;  1Z6U A;  1Z2Q A;  1BOR A;  2KGI A;  3PHD A;  2LGV A;  2VJF B;  4MSX A;  1K2F A;  2KWJ A;  5LKX A;  3HCS A;  2G6Q A;  2L0B A;  3N9N A;  2VJE A;  2KGG A;  2MNY A;  5KH7 A;  4WZ0 A;  2ECJ A;  5B77 A;  4IC2 A;  2Y1M A;  1HYJ A;  4QF2 A;  5LKU A;  2CT2 A;  3O35 A;  2FUU A;  4CA1 A;  2LN0 A;  3U5N A;  2L80 A;  1WEQ A;  3RTR B;  2IDA A;  4W4U A;  2KRE A;  2ZET C;  2MNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...