2LGVA

Rbx1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
GGGGTNSGAGKKRFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RBX1
publication title Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 100
sequence length 100
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2lgvA00
2UZGA 3DQVR 2E6RA 1VD4A 3V43A 2L75A 3C5KA 5C13A 5B78A 2VPGA 2HYED 1JOCA 2ECNA 2YHNA 3C6WA 2LXPC 3T7LA 2D8SA 2LGKA 4C9ZA 1X4JA 2Y1NA 2CT2A 5D1KB 5G0FA 3N9OA 3SOXA 3EB5A 1Z60A 5LCWB 2JMJA 2K1JA 4QF2A 2YSMA 3VK6A 1FBVA 4YADA 2M1RA 4UI9B 2KE1A 5AIUA 2LQ6A 2KR4A 4MSXA 2MD8C 3IHPA 2KWNA 4WZ2A 1WEEA 5B75A 4GNEA 3ZVYA 2Y43A 4BBQA 4BHWA 4S3OC 1WFKA 3KQIA 2Y1MA 3O34A 1Z2QA 3N9MA 4R8PK 2VJEA 2YUCA 2JMIA 4AYCA 2MT5A 5TDWA 5TRBA 2MA6A 2LV9A 3SOWA 4LLBA 1HYJA 2VP7A 5G04B 2NAAA 2LRIC 2YT5A 4LK9A 1LDKC 5D1LB 3DPLR 5H1TA 1WEUA 3HTKC 2YQLA 1HYIA 2CKLA 4FIPA 4S3OB 2G43A 4CCGX 2VJFA 3HCUA 4ZUXU 2G6QA 3RTRB 2I50A 2F42A 4GNFA 3LQIA 3RPGC 3ZNIA 3LQJA 2PNXA 2H0DA 3ZPV1 4MVTA 5EYAF 2VNFA 3ZVZB 4F52B 2K16A 3N9NA 2RI7A 5LKXA 1IYMA 4L58A 4FK5A 2ECTA 3LQHA 3ZPVE 3O7AA 1JM7B 5TDRA 1Z6UA 3RPGB 4QF3A 1V87A 2BAYA 2FUUA 4WZ0A 3L11A 5B76A 2MUMA 1WEVA 2KGIA 4I7CA 2VPBA 2ECVA 3U5MA 3U5PA 2C2LA 5TBNA 2KU3A 5DINA 4I7DA 2M3HA 2KWJA 2YW8A 5KH3A 2VJEB 4ZDTA 4GNDA 4AYCB 2MIQA 2MNYA 3SOUA 2L80A 5H9MA 4B86C 3ZYQA 5B79A 4CA1A 2K4DA 3FL2A 2YURA 4R7EA 2EODA 3KV6A 4LADB 3O37A 4X3GA 4V3KC 2F6NA 2YU4A 2MD7B 3O36A 4YC9A 4P5OB 2VJFB 2LXHC 2G45A 5G05B 2JRJA 2E6SA 5LKUA 2KREA 5FB1A 3GV4A 5LKTA 2JMDA 1WENA 4PPEA 2H0DB 2ZETC 1WILA 2CSYA 3QZVA 3EB6A 4WA6A 4FO9A 2KYUA 5LKZA 1LDJB 4GB0A 1WE9A 3LRQA 3MHSA 2CSZA 3SHBA 4A4BA 1X4IA 2C2VS 2LN0A 4Q6FA 4N3WA 1MM3A 4A4CA 1E4UA 2YSJA 1VFYA 5DKAA 2DX8A 1WGMA 2KIZA 5JG6A 1RMDA 4YAXA 4LJNA 2PUYA 2OXQC 2FSAA 1WEPA 3M63A 5FEYA 2M6MA 2EGPA 3O70A 1G25A 3L1ZB 2FUIA 4AVXA 2IDAA 3ZTGA 3M99A 5B8DA 4NN2A 3ASLA 2KWKA 2LDRA 3PURA 2QIZA 5B77A 3M62A 3KNVA 2QICA 2HDPA 4YBSA 1MM2A 2XEUA 4YBTA 5J3XA 2EA6A 1N87A 2YREA 4ZQLA 1XWHA 1VYXA 5FERA 2KFTA 2ECJA 4YBMA 2LGGA 4UP0A 3N9QA 3O35A 4LKAA 3KV5A 1BORA 1WEQA 2VPDA 4GNGA 1WESA 2CKLB 2VPEA 4W4UA 2RSDA 1DVPA 5I3LA 3T6RA 3O33A 1WEOA 1WEWA 2MNZA 1WIMA 3MHHA 1JM7A 5TABA 5KH7A 3HCSA 2KGGA 2L43A 4PTBA 2YYRA 2QJ0A 4TKPB 3N9PA 2ECWA 3U5NA 3PHDA 2M85A 2YQMA 4I7BA 4A49A 1U6GB 4L7XA 1CHCA 1X4UA 2K17A 2XB1A 4XI1A 2ECIA 1WEMA 2ECGA 3HCTA 4O64A 5H1VA 3U5OA 4IC2A 2KWOA 5FB0A 5AITA 4B7YC 4WZ3B 2LGVA 1ZBDB 3I2DA 5KH9A 4A0CD 4V3LC 3GL6A 3N9LA 3PUQA 2LGLA 2AN6A 2L5UA 5C11A 4R2YA 4N4FA 2F6JA 4YABA 4UP5A 1T1HA 2L0BA 5H1UA 2MA5A 5D1MB 4YATA 4AP4A 4FJCA 3L1XA 2YHOA 4AUQB 1F62A 4IC3A 1FP0A 1K2FA 3NG2A
chains in the Genus database with same CATH superfamily
2UZGA 3DQVR 2E6RA 1VD4A 3V43A 2L75A 3C5KA 5C13A 3KDEC 5B78A 2VPGA 2HYED 1JOCA 2KKXA 2ECNA 2YHNA 3C6WA 2LXPC 2OWAA 2P57A 3T7LA 2D8SA 2LGKA 4C9ZA 1X4JA 2DSMA 2Y1NA 2CT2A 5D1KB 5G0FA 3N9OA 2XOZA 3SOXA 3EB5A 1Z60A 2D8UA 5LCWB 2JMJA 2K1JA 4QF2A 2YSMA 3VK6A 1FBVA 4YADA 2M1RA 4UI9B 2KE1A 5AIUA 2LQ6A 3FAOA 2KR4A 4MSXA 2MD8C 3LDYA 3IHPA 3SUBA 2KWNA 4WZ2A 1WEEA 5B75A 4GNEA 3ZVYA 2XP0A 2Y43A 4BBQA 4BHWA 2CRRA 4S3OC 1WFKA 3KQIA 2Y1MA 3O34A 1Z2QA 3N9MA 4R8PK 2VJEA 2YUCA 2JMIA 5SVIB 4AYCA 2MT5A 5TDWA 5TRBA 2MA6A 2LV9A 3SOWA 3FEHA 4LLBA 1HYJA 2VP7A 5G04B 2NAAA 2LRIC 2YT5A 3FJUB 4LK9A 1LDKC 5D1LB 3DPLR 2LAUA 5H1TA 1WEUA 5SVYA 3HTKC 2YQLA 1HYIA 2CKLA 4FIPA 4S3OB 3E2DA 2EGMA 2G43A 1MBMA 4CCGX 2VJFA 3HCUA 4ZUXU 2G6QA 2MKEA 3RTRB 2EXUA 2I50A 2F42A 4GNFA 3LQIA 3RPGC 3ZNIA 5K3QA 3LQJA 2PNXA 2H0DA 3ZPV1 4O62A 4MVTA 2FD4A 5EYAF 3LVQE 2VNFA 3ZVZB 4F52B 2K16A 3N9NA 2RI7A 5LKXA 1IYMA 2CSVA 4L58A 4FK5A 2ECTA 3LQHA 3ZPVE 3O7AA 1JM7B 3MDBC 5TDRA 1Z6UA 3RPGB 4QF3A 1V87A 2BAYA 2FUUA 4WZ0A 3L11A 5B76A 2MUMA 1WEVA 2KGIA 4I7CA 2VPBA 2ECVA 3U5MA 3U5PA 3FM8C 2C2LA 5TBNA 2KU3A 5DINA 4I7DA 2M3HA 2KWJA 2YW8A 5KH3A 2VJEB 4ZDTA 4GNDA 4AYCB 2MIQA 2MNYA 3SOUA 2L80A 5H9MA 4B86C 3ZYQA 2E61A 5B79A 4CA1A 2K4DA 3FL2A 2YURA 4R7EA 2EODA 3KV6A 4LADB 3O37A 4X3GA 4V3KC 2F6NA 2YU4A 2RR4A 2MD7B 3O36A 4YC9A 4P5OB 2VJFB 2LXHC 2G45A 1DCQA 5G05B 2JRJA 2E6SA 5LKUA 2KREA 2IQJA 5FB1A 2L7PA 3GV4A 5LKTA 2JMDA 1WENA 4PPEA 2H0DB 2ZETC 1WILA 2CSYA 3QZVA 3EB6A 4WA6A 4FO9A 2KYUA 2DJAA 5LKZA 1LDJB 4GB0A 1WE9A 3LRQA 3MHSA 2CSZA 3SHBA 4A4BA 1X4IA 2C2VS 2CRWA 2LN0A 4Q6FA 3JUEA 4N3WA 3M7KA 1MM3A 4A4CA 1E4UA 2YSJA 1VFYA 5DKAA 5SVXA 2DX8A 1WGMA 2KIZA 5JG6A 1RMDA 4YAXA 4LJNA 2PUYA 2OXQC 4Z0OA 2FSAA 1WEPA 3M63A 5FEYA 2M6MA 4QQ4A 2EGPA 3O70A 1G25A 4F1PA 5SVIA 2JM3A 3L1ZB 2FUIA 3T9KA 4AVXA 2IDAA 3ZTGA 3M99A 5B8DA 4NN2A 3ASLA 4OGCA 4OGEA 2KWKA 2LDRA 3PURA 2CONA 2QIZA 5B77A 2XOYA 3LJUX 3M62A 3KNVA 2QICA 2HDPA 4YBSA 1MM2A 2XEUA 4YBTA 5J3XA 2EA6A 2YVRA 1N87A 3LVRE 2YREA 4ZQLA 4H9DA 1XWHA 1VYXA 5FERA 2KFTA 2ECJA 4YBMA 2LGGA 4UP0A 3N9QA 3O35A 4LKAA 3KV5A 1BORA 1WEQA 2VPDA 4GNGA 1WESA 2CKLB 2KKYA 2VPEA 4W4UA 2RSDA 1DVPA 5I3LA 2B0OE 3T6RA 3O33A 1WEOA 1WEWA 2MNZA 1WIMA 3MHHA 3O47A 1JM7A 5TABA 5KH7A 3HCSA 2KGGA 2L43A 4PTBA 2YYRA 2QJ0A 4TKPB 3N9PA 2ECWA 3U5NA 3PHDA 2M85A 2YQMA 4I7BA 4A49A 1U6GB 4L7XA 1CHCA 1X4UA 2K17A 2FFWA 2XB1A 4XI1A 2ECIA 1WEMA 2ECGA 2M13A 3DDTA 3HCTA 4O64A 5H1VA 3U5OA 4IC2A 2KWOA 2XOCA 5FB0A 5AITA 3H7HA 4B7YC 4WZ3B 2LGVA 1ZBDB 3I2DA 5KH9A 4A0CD 4V3LC 3GL6A 3N9LA 3PUQA 2LGLA 4Z0RA 3Q1DA 2AN6A 2L5UA 5C11A 4R2YA 2JUNA 4N4FA 2F6JA 4YABA 4UP5A 1T1HA 3PLWA 2L0BA 5H1UA 3DWDA 2MA5A 5D1MB 4YATA 4AP4A 4FJCA 3L1XA 2YHOA 4AUQB 1F62A 4IC3A 1FP0A 1K2FA 3NG2A 3FANA
chains in the Genus database with same CATH topology
2UZGA 3DQVR 2E6RA 1VD4A 3V43A 2L75A 3C5KA 5C13A 5B78A 2VPGA 2HYED 1JOCA 2ECNA 2YHNA 3C6WA 2LXPC 3T7LA 2D8SA 2LGKA 4C9ZA 1X4JA 2Y1NA 2CT2A 5D1KB 5G0FA 3N9OA 3SOXA 3EB5A 1Z60A 5LCWB 2JMJA 2K1JA 4QF2A 2YSMA 3VK6A 1FBVA 4YADA 2M1RA 4UI9B 2KE1A 5AIUA 2LQ6A 2KR4A 4MSXA 2MD8C 3IHPA 2KWNA 4WZ2A 1WEEA 5B75A 4GNEA 3ZVYA 2Y43A 4BBQA 4BHWA 4S3OC 1WFKA 3KQIA 2Y1MA 3O34A 1Z2QA 3N9MA 4R8PK 2VJEA 2YUCA 2JMIA 4AYCA 2MT5A 5TDWA 5TRBA 2MA6A 2LV9A 3SOWA 4LLBA 1HYJA 2VP7A 5G04B 2NAAA 2LRIC 2YT5A 4LK9A 1LDKC 5D1LB 3DPLR 5H1TA 1WEUA 3HTKC 2YQLA 1HYIA 2CKLA 4FIPA 4S3OB 2G43A 4CCGX 2VJFA 3HCUA 4ZUXU 2G6QA 3RTRB 2I50A 2F42A 4GNFA 3LQIA 3RPGC 3ZNIA 3LQJA 2PNXA 2H0DA 3ZPV1 4MVTA 5EYAF 2VNFA 3ZVZB 4F52B 2K16A 3N9NA 2RI7A 5LKXA 1IYMA 4L58A 4FK5A 2ECTA 3LQHA 3ZPVE 3O7AA 1JM7B 5TDRA 1Z6UA 3RPGB 4QF3A 1V87A 2BAYA 2FUUA 4WZ0A 3L11A 5B76A 2MUMA 1WEVA 2KGIA 4I7CA 2VPBA 2ECVA 3U5MA 3U5PA 2C2LA 5TBNA 2KU3A 5DINA 4I7DA 2M3HA 2KWJA 2YW8A 5KH3A 2VJEB 4ZDTA 4GNDA 4AYCB 2MIQA 2MNYA 3SOUA 2L80A 5H9MA 4B86C 3ZYQA 5B79A 4CA1A 2K4DA 3FL2A 2YURA 4R7EA 2EODA 3KV6A 4LADB 3O37A 4X3GA 4V3KC 2F6NA 2YU4A 2MD7B 3O36A 4YC9A 4P5OB 2VJFB 2LXHC 2G45A 5G05B 2JRJA 2E6SA 5LKUA 2KREA 5FB1A 3GV4A 5LKTA 2JMDA 1WENA 4PPEA 2H0DB 2ZETC 1WILA 2CSYA 3QZVA 3EB6A 4WA6A 4FO9A 2KYUA 5LKZA 1LDJB 4GB0A 1WE9A 3LRQA 3MHSA 2CSZA 3SHBA 4A4BA 1X4IA 2C2VS 2LN0A 4Q6FA 4N3WA 1MM3A 4A4CA 1E4UA 2YSJA 1VFYA 5DKAA 2DX8A 1WGMA 2KIZA 5JG6A 1RMDA 4YAXA 4LJNA 2PUYA 2OXQC 2FSAA 1WEPA 3M63A 5FEYA 2M6MA 2EGPA 3O70A 1G25A 3L1ZB 2FUIA 4AVXA 2IDAA 3ZTGA 3M99A 5B8DA 4NN2A 3ASLA 2KWKA 2LDRA 3PURA 2QIZA 5B77A 3M62A 3KNVA 2QICA 2HDPA 4YBSA 1MM2A 2XEUA 4YBTA 5J3XA 2EA6A 1N87A 2YREA 4ZQLA 1XWHA 1VYXA 5FERA 2KFTA 2ECJA 4YBMA 2LGGA 4UP0A 3N9QA 3O35A 4LKAA 3KV5A 1BORA 1WEQA 2VPDA 4GNGA 1WESA 2CKLB 2VPEA 4W4UA 2RSDA 1DVPA 5I3LA 3T6RA 3O33A 1WEOA 1WEWA 2MNZA 1WIMA 3MHHA 1JM7A 5TABA 5KH7A 3HCSA 2KGGA 2L43A 4PTBA 2YYRA 2QJ0A 4TKPB 3N9PA 2ECWA 3U5NA 3PHDA 2M85A 2YQMA 4I7BA 4A49A 1U6GB 4L7XA 1CHCA 1X4UA 2K17A 2XB1A 4XI1A 2ECIA 1WEMA 2ECGA 3HCTA 4O64A 5H1VA 3U5OA 4IC2A 2KWOA 5FB0A 5AITA 4B7YC 4WZ3B 2LGVA 1ZBDB 3I2DA 5KH9A 4A0CD 4V3LC 3GL6A 3N9LA 3PUQA 2LGLA 2AN6A 2L5UA 5C11A 4R2YA 4N4FA 2F6JA 4YABA 4UP5A 1T1HA 2L0BA 5H1UA 2MA5A 5D1MB 4YATA 4AP4A 4FJCA 3L1XA 2YHOA 4AUQB 1F62A 4IC3A 1FP0A 1K2FA 3NG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZG A;  3DQV R;  2E6R A;  1VD4 A;  3V43 A;  2L75 A;  3C5K A;  5C13 A;  5B78 A;  2VPG A;  2HYE D;  1JOC A;  2ECN A;  2YHN A;  3C6W A;  2LXP C;  3T7L A;  2D8S A;  2LGK A;  4C9Z A;  1X4J A;  2Y1N A;  2CT2 A;  5D1K B;  5G0F A;  3N9O A;  3SOX A;  3EB5 A;  1Z60 A;  5LCW B;  2JMJ A;  2K1J A;  4QF2 A;  2YSM A;  3VK6 A;  1FBV A;  4YAD A;  2M1R A;  4UI9 B;  2KE1 A;  5AIU A;  2LQ6 A;  2KR4 A;  4MSX A;  2MD8 C;  3IHP A;  2KWN A;  4WZ2 A;  1WEE A;  5B75 A;  4GNE A;  3ZVY A;  2Y43 A;  4BBQ A;  4BHW A;  4S3O C;  1WFK A;  3KQI A;  2Y1M A;  3O34 A;  1Z2Q A;  3N9M A;  4R8P K;  2VJE A;  2YUC A;  2JMI A;  4AYC A;  2MT5 A;  5TDW A;  5TRB A;  2MA6 A;  2LV9 A;  3SOW A;  4LLB A;  1HYJ A;  2VP7 A;  5G04 B;  2NAA A;  2LRI C;  2YT5 A;  4LK9 A;  1LDK C;  5D1L B;  3DPL R;  5H1T A;  1WEU A;  3HTK C;  2YQL A;  1HYI A;  2CKL A;  4FIP A;  4S3O B;  2G43 A;  4CCG X;  2VJF A;  3HCU A;  4ZUX U;  2G6Q A;  3RTR B;  2I50 A;  2F42 A;  4GNF A;  3LQI A;  3RPG C;  3ZNI A;  3LQJ A;  2PNX A;  2H0D A;  3ZPV 1;  4MVT A;  5EYA F;  2VNF A;  3ZVZ B;  4F52 B;  2K16 A;  3N9N A;  2RI7 A;  5LKX A;  1IYM A;  4L58 A;  4FK5 A;  2ECT A;  3LQH A;  3ZPV E;  3O7A A;  1JM7 B;  5TDR A;  1Z6U A;  3RPG B;  4QF3 A;  1V87 A;  2BAY A;  2FUU A;  4WZ0 A;  3L11 A;  5B76 A;  2MUM A;  1WEV A;  2KGI A;  4I7C A;  2VPB A;  2ECV A;  3U5M A;  3U5P A;  2C2L A;  5TBN A;  2KU3 A;  5DIN A;  4I7D A;  2M3H A;  2KWJ A;  2YW8 A;  5KH3 A;  2VJE B;  4ZDT A;  4GND A;  4AYC B;  2MIQ A;  2MNY A;  3SOU A;  2L80 A;  5H9M A;  4B86 C;  3ZYQ A;  5B79 A;  4CA1 A;  2K4D A;  3FL2 A;  2YUR A;  4R7E A;  2EOD A;  3KV6 A;  4LAD B;  3O37 A;  4X3G A;  4V3K C;  2F6N A;  2YU4 A;  2MD7 B;  3O36 A;  4YC9 A;  4P5O B;  2VJF B;  2LXH C;  2G45 A;  5G05 B;  2JRJ A;  2E6S A;  5LKU A;  2KRE A;  5FB1 A;  3GV4 A;  5LKT A;  2JMD A;  1WEN A;  4PPE A;  2H0D B;  2ZET C;  1WIL A;  2CSY A;  3QZV A;  3EB6 A;  4WA6 A;  4FO9 A;  2KYU A;  5LKZ A;  1LDJ B;  4GB0 A;  1WE9 A;  3LRQ A;  3MHS A;  2CSZ A;  3SHB A;  4A4B A;  1X4I A;  2C2V S;  2LN0 A;  4Q6F A;  4N3W A;  1MM3 A;  4A4C A;  1E4U A;  2YSJ A;  1VFY A;  5DKA A;  2DX8 A;  1WGM A;  2KIZ A;  5JG6 A;  1RMD A;  4YAX A;  4LJN A;  2PUY A;  2OXQ C;  2FSA A;  1WEP A;  3M63 A;  5FEY A;  2M6M A;  2EGP A;  3O70 A;  1G25 A;  3L1Z B;  2FUI A;  4AVX A;  2IDA A;  3ZTG A;  3M99 A;  5B8D A;  4NN2 A;  3ASL A;  2KWK A;  2LDR A;  3PUR A;  2QIZ A;  5B77 A;  3M62 A;  3KNV A;  2QIC A;  2HDP A;  4YBS A;  1MM2 A;  2XEU A;  4YBT A;  5J3X A;  2EA6 A;  1N87 A;  2YRE A;  4ZQL A;  1XWH A;  1VYX A;  5FER A;  2KFT A;  2ECJ A;  4YBM A;  2LGG A;  4UP0 A;  3N9Q A;  3O35 A;  4LKA A;  3KV5 A;  1BOR A;  1WEQ A;  2VPD A;  4GNG A;  1WES A;  2CKL B;  2VPE A;  4W4U A;  2RSD A;  1DVP A;  5I3L A;  3T6R A;  3O33 A;  1WEO A;  1WEW A;  2MNZ A;  1WIM A;  3MHH A;  1JM7 A;  5TAB A;  5KH7 A;  3HCS A;  2KGG A;  2L43 A;  4PTB A;  2YYR A;  2QJ0 A;  4TKP B;  3N9P A;  2ECW A;  3U5N A;  3PHD A;  2M85 A;  2YQM A;  4I7B A;  4A49 A;  1U6G B;  4L7X A;  1CHC A;  1X4U A;  2K17 A;  2XB1 A;  4XI1 A;  2ECI A;  1WEM A;  2ECG A;  3HCT A;  4O64 A;  5H1V A;  3U5O A;  4IC2 A;  2KWO A;  5FB0 A;  5AIT A;  4B7Y C;  4WZ3 B;  2LGV A;  1ZBD B;  3I2D A;  5KH9 A;  4A0C D;  4V3L C;  3GL6 A;  3N9L A;  3PUQ A;  2LGL A;  2AN6 A;  2L5U A;  5C11 A;  4R2Y A;  4N4F A;  2F6J A;  4YAB A;  4UP5 A;  1T1H A;  2L0B A;  5H1U A;  2MA5 A;  5D1M B;  4YAT A;  4AP4 A;  4FJC A;  3L1X A;  2YHO A;  4AUQ B;  1F62 A;  4IC3 A;  1FP0 A;  1K2F A;  3NG2 A; 
#chains in the Genus database with same CATH topology
 2UZG A;  3DQV R;  2E6R A;  1VD4 A;  3V43 A;  2L75 A;  3C5K A;  5C13 A;  3KDE C;  5B78 A;  2VPG A;  2HYE D;  1JOC A;  2KKX A;  2ECN A;  2YHN A;  3C6W A;  2LXP C;  2OWA A;  2P57 A;  3T7L A;  2D8S A;  2LGK A;  4C9Z A;  1X4J A;  2DSM A;  2Y1N A;  2CT2 A;  5D1K B;  5G0F A;  3N9O A;  2XOZ A;  3SOX A;  3EB5 A;  1Z60 A;  2D8U A;  5LCW B;  2JMJ A;  2K1J A;  4QF2 A;  2YSM A;  3VK6 A;  1FBV A;  4YAD A;  2M1R A;  4UI9 B;  2KE1 A;  5AIU A;  2LQ6 A;  3FAO A;  2KR4 A;  4MSX A;  2MD8 C;  3LDY A;  3IHP A;  3SUB A;  2KWN A;  4WZ2 A;  1WEE A;  5B75 A;  4GNE A;  3ZVY A;  2XP0 A;  2Y43 A;  4BBQ A;  4BHW A;  2CRR A;  4S3O C;  1WFK A;  3KQI A;  2Y1M A;  3O34 A;  1Z2Q A;  3N9M A;  4R8P K;  2VJE A;  2YUC A;  2JMI A;  5SVI B;  4AYC A;  2MT5 A;  5TDW A;  5TRB A;  2MA6 A;  2LV9 A;  3SOW A;  3FEH A;  4LLB A;  1HYJ A;  2VP7 A;  5G04 B;  2NAA A;  2LRI C;  2YT5 A;  3FJU B;  4LK9 A;  1LDK C;  5D1L B;  3DPL R;  2LAU A;  5H1T A;  1WEU A;  5SVY A;  3HTK C;  2YQL A;  1HYI A;  2CKL A;  4FIP A;  4S3O B;  3E2D A;  2EGM A;  2G43 A;  1MBM A;  4CCG X;  2VJF A;  3HCU A;  4ZUX U;  2G6Q A;  2MKE A;  3RTR B;  2EXU A;  2I50 A;  2F42 A;  4GNF A;  3LQI A;  3RPG C;  3ZNI A;  5K3Q A;  3LQJ A;  2PNX A;  2H0D A;  3ZPV 1;  4O62 A;  4MVT A;  2FD4 A;  5EYA F;  3LVQ E;  2VNF A;  3ZVZ B;  4F52 B;  2K16 A;  3N9N A;  2RI7 A;  5LKX A;  1IYM A;  2CSV A;  4L58 A;  4FK5 A;  2ECT A;  3LQH A;  3ZPV E;  3O7A A;  1JM7 B;  3MDB C;  5TDR A;  1Z6U A;  3RPG B;  4QF3 A;  1V87 A;  2BAY A;  2FUU A;  4WZ0 A;  3L11 A;  5B76 A;  2MUM A;  1WEV A;  2KGI A;  4I7C A;  2VPB A;  2ECV A;  3U5M A;  3U5P A;  3FM8 C;  2C2L A;  5TBN A;  2KU3 A;  5DIN A;  4I7D A;  2M3H A;  2KWJ A;  2YW8 A;  5KH3 A;  2VJE B;  4ZDT A;  4GND A;  4AYC B;  2MIQ A;  2MNY A;  3SOU A;  2L80 A;  5H9M A;  4B86 C;  3ZYQ A;  2E61 A;  5B79 A;  4CA1 A;  2K4D A;  3FL2 A;  2YUR A;  4R7E A;  2EOD A;  3KV6 A;  4LAD B;  3O37 A;  4X3G A;  4V3K C;  2F6N A;  2YU4 A;  2RR4 A;  2MD7 B;  3O36 A;  4YC9 A;  4P5O B;  2VJF B;  2LXH C;  2G45 A;  1DCQ A;  5G05 B;  2JRJ A;  2E6S A;  5LKU A;  2KRE A;  2IQJ A;  5FB1 A;  2L7P A;  3GV4 A;  5LKT A;  2JMD A;  1WEN A;  4PPE A;  2H0D B;  2ZET C;  1WIL A;  2CSY A;  3QZV A;  3EB6 A;  4WA6 A;  4FO9 A;  2KYU A;  2DJA A;  5LKZ A;  1LDJ B;  4GB0 A;  1WE9 A;  3LRQ A;  3MHS A;  2CSZ A;  3SHB A;  4A4B A;  1X4I A;  2C2V S;  2CRW A;  2LN0 A;  4Q6F A;  3JUE A;  4N3W A;  3M7K A;  1MM3 A;  4A4C A;  1E4U A;  2YSJ A;  1VFY A;  5DKA A;  5SVX A;  2DX8 A;  1WGM A;  2KIZ A;  5JG6 A;  1RMD A;  4YAX A;  4LJN A;  2PUY A;  2OXQ C;  4Z0O A;  2FSA A;  1WEP A;  3M63 A;  5FEY A;  2M6M A;  4QQ4 A;  2EGP A;  3O70 A;  1G25 A;  4F1P A;  5SVI A;  2JM3 A;  3L1Z B;  2FUI A;  3T9K A;  4AVX A;  2IDA A;  3ZTG A;  3M99 A;  5B8D A;  4NN2 A;  3ASL A;  4OGC A;  4OGE A;  2KWK A;  2LDR A;  3PUR A;  2CON A;  2QIZ A;  5B77 A;  2XOY A;  3LJU X;  3M62 A;  3KNV A;  2QIC A;  2HDP A;  4YBS A;  1MM2 A;  2XEU A;  4YBT A;  5J3X A;  2EA6 A;  2YVR A;  1N87 A;  3LVR E;  2YRE A;  4ZQL A;  4H9D A;  1XWH A;  1VYX A;  5FER A;  2KFT A;  2ECJ A;  4YBM A;  2LGG A;  4UP0 A;  3N9Q A;  3O35 A;  4LKA A;  3KV5 A;  1BOR A;  1WEQ A;  2VPD A;  4GNG A;  1WES A;  2CKL B;  2KKY A;  2VPE A;  4W4U A;  2RSD A;  1DVP A;  5I3L A;  2B0O E;  3T6R A;  3O33 A;  1WEO A;  1WEW A;  2MNZ A;  1WIM A;  3MHH A;  3O47 A;  1JM7 A;  5TAB A;  5KH7 A;  3HCS A;  2KGG A;  2L43 A;  4PTB A;  2YYR A;  2QJ0 A;  4TKP B;  3N9P A;  2ECW A;  3U5N A;  3PHD A;  2M85 A;  2YQM A;  4I7B A;  4A49 A;  1U6G B;  4L7X A;  1CHC A;  1X4U A;  2K17 A;  2FFW A;  2XB1 A;  4XI1 A;  2ECI A;  1WEM A;  2ECG A;  2M13 A;  3DDT A;  3HCT A;  4O64 A;  5H1V A;  3U5O A;  4IC2 A;  2KWO A;  2XOC A;  5FB0 A;  5AIT A;  3H7H A;  4B7Y C;  4WZ3 B;  2LGV A;  1ZBD B;  3I2D A;  5KH9 A;  4A0C D;  4V3L C;  3GL6 A;  3N9L A;  3PUQ A;  2LGL A;  4Z0R A;  3Q1D A;  2AN6 A;  2L5U A;  5C11 A;  4R2Y A;  2JUN A;  4N4F A;  2F6J A;  4YAB A;  4UP5 A;  1T1H A;  3PLW A;  2L0B A;  5H1U A;  3DWD A;  2MA5 A;  5D1M B;  4YAT A;  4AP4 A;  4FJC A;  3L1X A;  2YHO A;  4AUQ B;  1F62 A;  4IC3 A;  1FP0 A;  1K2F A;  3NG2 A;  3FAN A; 
#chains in the Genus database with same CATH homology
 2UZG A;  3DQV R;  2E6R A;  1VD4 A;  3V43 A;  2L75 A;  3C5K A;  5C13 A;  5B78 A;  2VPG A;  2HYE D;  1JOC A;  2ECN A;  2YHN A;  3C6W A;  2LXP C;  3T7L A;  2D8S A;  2LGK A;  4C9Z A;  1X4J A;  2Y1N A;  2CT2 A;  5D1K B;  5G0F A;  3N9O A;  3SOX A;  3EB5 A;  1Z60 A;  5LCW B;  2JMJ A;  2K1J A;  4QF2 A;  2YSM A;  3VK6 A;  1FBV A;  4YAD A;  2M1R A;  4UI9 B;  2KE1 A;  5AIU A;  2LQ6 A;  2KR4 A;  4MSX A;  2MD8 C;  3IHP A;  2KWN A;  4WZ2 A;  1WEE A;  5B75 A;  4GNE A;  3ZVY A;  2Y43 A;  4BBQ A;  4BHW A;  4S3O C;  1WFK A;  3KQI A;  2Y1M A;  3O34 A;  1Z2Q A;  3N9M A;  4R8P K;  2VJE A;  2YUC A;  2JMI A;  4AYC A;  2MT5 A;  5TDW A;  5TRB A;  2MA6 A;  2LV9 A;  3SOW A;  4LLB A;  1HYJ A;  2VP7 A;  5G04 B;  2NAA A;  2LRI C;  2YT5 A;  4LK9 A;  1LDK C;  5D1L B;  3DPL R;  5H1T A;  1WEU A;  3HTK C;  2YQL A;  1HYI A;  2CKL A;  4FIP A;  4S3O B;  2G43 A;  4CCG X;  2VJF A;  3HCU A;  4ZUX U;  2G6Q A;  3RTR B;  2I50 A;  2F42 A;  4GNF A;  3LQI A;  3RPG C;  3ZNI A;  3LQJ A;  2PNX A;  2H0D A;  3ZPV 1;  4MVT A;  5EYA F;  2VNF A;  3ZVZ B;  4F52 B;  2K16 A;  3N9N A;  2RI7 A;  5LKX A;  1IYM A;  4L58 A;  4FK5 A;  2ECT A;  3LQH A;  3ZPV E;  3O7A A;  1JM7 B;  5TDR A;  1Z6U A;  3RPG B;  4QF3 A;  1V87 A;  2BAY A;  2FUU A;  4WZ0 A;  3L11 A;  5B76 A;  2MUM A;  1WEV A;  2KGI A;  4I7C A;  2VPB A;  2ECV A;  3U5M A;  3U5P A;  2C2L A;  5TBN A;  2KU3 A;  5DIN A;  4I7D A;  2M3H A;  2KWJ A;  2YW8 A;  5KH3 A;  2VJE B;  4ZDT A;  4GND A;  4AYC B;  2MIQ A;  2MNY A;  3SOU A;  2L80 A;  5H9M A;  4B86 C;  3ZYQ A;  5B79 A;  4CA1 A;  2K4D A;  3FL2 A;  2YUR A;  4R7E A;  2EOD A;  3KV6 A;  4LAD B;  3O37 A;  4X3G A;  4V3K C;  2F6N A;  2YU4 A;  2MD7 B;  3O36 A;  4YC9 A;  4P5O B;  2VJF B;  2LXH C;  2G45 A;  5G05 B;  2JRJ A;  2E6S A;  5LKU A;  2KRE A;  5FB1 A;  3GV4 A;  5LKT A;  2JMD A;  1WEN A;  4PPE A;  2H0D B;  2ZET C;  1WIL A;  2CSY A;  3QZV A;  3EB6 A;  4WA6 A;  4FO9 A;  2KYU A;  5LKZ A;  1LDJ B;  4GB0 A;  1WE9 A;  3LRQ A;  3MHS A;  2CSZ A;  3SHB A;  4A4B A;  1X4I A;  2C2V S;  2LN0 A;  4Q6F A;  4N3W A;  1MM3 A;  4A4C A;  1E4U A;  2YSJ A;  1VFY A;  5DKA A;  2DX8 A;  1WGM A;  2KIZ A;  5JG6 A;  1RMD A;  4YAX A;  4LJN A;  2PUY A;  2OXQ C;  2FSA A;  1WEP A;  3M63 A;  5FEY A;  2M6M A;  2EGP A;  3O70 A;  1G25 A;  3L1Z B;  2FUI A;  4AVX A;  2IDA A;  3ZTG A;  3M99 A;  5B8D A;  4NN2 A;  3ASL A;  2KWK A;  2LDR A;  3PUR A;  2QIZ A;  5B77 A;  3M62 A;  3KNV A;  2QIC A;  2HDP A;  4YBS A;  1MM2 A;  2XEU A;  4YBT A;  5J3X A;  2EA6 A;  1N87 A;  2YRE A;  4ZQL A;  1XWH A;  1VYX A;  5FER A;  2KFT A;  2ECJ A;  4YBM A;  2LGG A;  4UP0 A;  3N9Q A;  3O35 A;  4LKA A;  3KV5 A;  1BOR A;  1WEQ A;  2VPD A;  4GNG A;  1WES A;  2CKL B;  2VPE A;  4W4U A;  2RSD A;  1DVP A;  5I3L A;  3T6R A;  3O33 A;  1WEO A;  1WEW A;  2MNZ A;  1WIM A;  3MHH A;  1JM7 A;  5TAB A;  5KH7 A;  3HCS A;  2KGG A;  2L43 A;  4PTB A;  2YYR A;  2QJ0 A;  4TKP B;  3N9P A;  2ECW A;  3U5N A;  3PHD A;  2M85 A;  2YQM A;  4I7B A;  4A49 A;  1U6G B;  4L7X A;  1CHC A;  1X4U A;  2K17 A;  2XB1 A;  4XI1 A;  2ECI A;  1WEM A;  2ECG A;  3HCT A;  4O64 A;  5H1V A;  3U5O A;  4IC2 A;  2KWO A;  5FB0 A;  5AIT A;  4B7Y C;  4WZ3 B;  2LGV A;  1ZBD B;  3I2D A;  5KH9 A;  4A0C D;  4V3L C;  3GL6 A;  3N9L A;  3PUQ A;  2LGL A;  2AN6 A;  2L5U A;  5C11 A;  4R2Y A;  4N4F A;  2F6J A;  4YAB A;  4UP5 A;  1T1H A;  2L0B A;  5H1U A;  2MA5 A;  5D1M B;  4YAT A;  4AP4 A;  4FJC A;  3L1X A;  2YHO A;  4AUQ B;  1F62 A;  4IC3 A;  1FP0 A;  1K2F A;  3NG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...