2KKYA

Solution structure of c-terminal domain of oxidized nleg2-3 (residue 90-191) from pathogenic e. coli o157:h7. northeast structural genomics consortium and midwest center for structural genomics target et109a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
SQESIQNKISQCKFSVCPERLQCPLEAIQCPITLEQPEKGIFVKNSDGSDVCTLFDAAAFSRLVGEGLPHPLTREPITASIIVKHEECIYDDTRGNFIIKGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein ECs2156
publication title NleG Type 3 effectors from enterohaemorrhagic Escherichia coli are U-Box E3 ubiquitin ligases.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2009-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.80 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2kkyA00
2KKXA 2KKYA
chains in the Genus database with same CATH superfamily
2FUUA 3E2DA 4MVTA 5B76A 1LDKC 3I2DA 1MBMA 2LN0A 2VP7A 2VJFB 3DWDA 3L1ZB 1DVPA 2LQ6A 3FL2A 1RMDA 2MIQA 2L7PA 1Z60A 4WZ3B 5LKZA 2K4DA 4H9DA 2HYED 4B86C 5LCWB 3SOXA 4BHWA 2VPEA 2DJAA 2LV9A 4PTBA 1MM3A 3ZPVE 1X4JA 3HTKC 4CA1A 4S3OC 2YREA 4A49A 5LKTA 5H9MA 1G25A 3O7AA 3FM8C 2LGVA 2YW8A 4F52B 1VYXA 2YHOA 2QIZA 3HCSA 1WEWA 2VJEA 1JM7A 2VPDA 5FB1A 1X4UA 3N9QA 2MD7B 3NG2A 5DKAA 2JM3A 3RPGB 2Y1NA 4A4CA 1X4IA 2DX8A 5B8DA 3N9NA 3EB5A 5B75A 2CONA 4IC3A 1IYMA 2M1RA 1WESA 5B77A 4A4BA 4B7YC 2LXHC 4I7BA 2YSMA 4YC9A 4AYCB 4UP5A 2L5UA 3O33A 2KR4A 2QJ0A 1VD4A 2M13A 3KDEC 1ZBDB 3KNVA 1WEUA 2KE1A 3LDYA 1FP0A 2ECTA 3ZNIA 2L43A 3LQIA 2KIZA 2K17A 3KV6A 4Q6FA 4S3OB 2C2LA 2L75A 2G43A 3RPGC 4GNEA 5TRBA 2P57A 5G05B 2LGKA 4AUQB 3KV5A 4BBQA 3GL6A 2IQJA 5B78A 2EGPA 3U5OA 1MM2A 1WEMA 2YU4A 3RTRB 2VJFA 4UI9B 2YYRA 5FB0A 4IC2A 3T7LA 5SVIB 1XWHA 4L58A 4WA6A 4YAXA 3PURA 5K3QA 3QZVA 2RI7A 1WILA 2ECVA 2MA6A 3DQVR 4ZDTA 2EGMA 2XB1A 5TBNA 2VPBA 2MNYA 2XOCA 1WEVA 2XP0A 5D1KB 4ZUXU 2YVRA 4WZ2A 4GNFA 1WENA 2KWKA 3EB6A 3HCUA 4AP4A 2ECIA 2E6RA 4QQ4A 1K2FA 4LKAA 5AIUA 4NN2A 2CRRA 2L0BA 2XOZA 4GNDA 3MDBC 5B79A 2L80A 4YBMA 2CRWA 3FEHA 2ECWA 2FFWA 1WE9A 4AVXA 5DINA 1WEOA 3FANA 4R8PK 3C5KA 2B0OE 2FSAA 1WEQA 3O70A 2JMDA 1WGMA 3LJUX 4Z0RA 5G04B 2G6QA 2KFTA 1WFKA 2HDPA 3LQHA 5I3LA 1BORA 1WEEA 3PUQA 4YATA 2KGGA 5SVYA 3ZVZB 2EODA 5KH9A 1WEPA 4AYCA 4V3KC 4LADB 2PNXA 5TABA 4V3LC 5H1VA 2LXPC 4FK5A 3L11A 4OGCA 2YHNA 3SHBA 2D8UA 2Y1MA 5H1UA 5D1MB 2F42A 2YT5A 4P5OB 2I50A 3N9LA 2CKLA 4QF2A 2EA6A 2MD8C 5H1TA 3O35A 4OGEA 1DCQA 3LRQA 2YQMA 2CKLB 4QF3A 2CSZA 2CSYA 2KGIA 2KU3A 3O37A 3L1XA 5SVXA 3DPLR 5FEYA 3V43A 3T9KA 2RR4A 3MHHA 2KWNA 4FO9A 2F6NA 1N87A 1T1HA 1CHCA 1U6GB 2FUIA 2LGLA 2MNZA 2OXQC 4O62A 2JRJA 5SVIA 2RSDA 5G0FA 5JG6A 3SOUA 4R2YA 4I7CA 2OWAA 4PPEA 3N9MA 3T6RA 4YBTA 3VK6A 2DSMA 4LK9A 3O36A 5AITA 5D1LB 4YBSA 2K1JA 3M7KA 4GB0A 4YADA 3ZYQA 4FIPA 3M62A 3SOWA 2ZETC 4YABA 3ZPV1 4N4FA 3PLWA 2F6JA 2C2VS 4MSXA 1HYIA 3MHSA 2M3HA 4L7XA 3M99A 5C13A 5KH3A 2M6MA 3LVRE 4N3WA 3SUBA 2FD4A 1FBVA 2CT2A 2NAAA 5TDWA 3LQJA 3PHDA 4I7DA 3U5PA 3ZTGA 2IDAA 3ASLA 1JOCA 4X3GA 1HYJA 2AN6A 2LGGA 1V87A 4CCGX 2XOYA 1LDJB 2CSVA 2VPGA 1E4UA 4W4UA 3KQIA 4LLBA 3HCTA 2KKYA 5FERA 2KWJA 5J3XA 3JUEA 2YSJA 3ZVYA 4A0CD 2VJEB 2ECJA 4Z0OA 2BAYA 1JM7B 3O47A 2MA5A 2KREA 2H0DA 4FJCA 2K16A 3FJUB 3U5NA 3N9PA 2MT5A 4LJNA 2H0DB 4C9ZA 4R7EA 5TDRA 2YQLA 3U5MA 1Z2QA 2M85A 2XEUA 4XI1A 4TKPB 5LKUA 2YURA 2E61A 4GNGA 3M63A 4ZQLA 4O64A 2LRIC 3H7HA 2D8SA 2LAUA 4F1PA 3GV4A 2KWOA 4WZ0A 2UZGA 3DDTA 5C11A 1F62A 3N9OA 2PUYA 1Z6UA 5LKXA 2MUMA 3O34A 2JMJA 1VFYA 3FAOA 2ECGA 2ECNA 2VNFA 2KKXA 5EYAF 3IHPA 2E6SA 2LDRA 4UP0A 2YUCA 2KYUA 2Y43A 2G45A 2QICA 2JUNA 3C6WA 2JMIA 2MKEA 1WIMA 3LVQE 5KH7A 3Q1DA 2EXUA
chains in the Genus database with same CATH topology
4OGCA 3DDTA 2B0OE 3E2DA 2D8UA 3O47A 2OWAA 5SVXA 5SVIB 2E61A 3LJUX 4Z0RA 2XOYA 3DWDA 3T9KA 2CSVA 2YREA 2RR4A 4QQ4A 2P57A 5K3QA 2L7PA 3FM8C 3LVRE 2M13A 3H7HA 3SUBA 3M7KA 2FD4A 4H9DA 2CONA 3FJUB 2KKXA 3KDEC 2EGMA 4OGEA 2CRRA 2KKYA 2XOZA 2IQJA 3MDBC 5SVYA 3JUEA 3LDYA 1DCQA 2CRWA 3FEHA 2JUNA 4O62A 2FFWA 2LAUA 4F1PA 2MKEA 2XOCA 5SVIA 2XP0A 3LVQE 3Q1DA 2YVRA 2EXUA 2JM3A 4Z0OA 2DJAA 3PLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKX A;  2KKY A; 
#chains in the Genus database with same CATH topology
 2FUU A;  3E2D A;  4MVT A;  5B76 A;  1LDK C;  3I2D A;  1MBM A;  2LN0 A;  2VP7 A;  2VJF B;  3DWD A;  3L1Z B;  1DVP A;  2LQ6 A;  3FL2 A;  1RMD A;  2MIQ A;  2L7P A;  1Z60 A;  4WZ3 B;  5LKZ A;  2K4D A;  4H9D A;  2HYE D;  4B86 C;  5LCW B;  3SOX A;  4BHW A;  2VPE A;  2DJA A;  2LV9 A;  4PTB A;  1MM3 A;  3ZPV E;  1X4J A;  3HTK C;  4CA1 A;  4S3O C;  2YRE A;  4A49 A;  5LKT A;  5H9M A;  1G25 A;  3O7A A;  3FM8 C;  2LGV A;  2YW8 A;  4F52 B;  1VYX A;  2YHO A;  2QIZ A;  3HCS A;  1WEW A;  2VJE A;  1JM7 A;  2VPD A;  5FB1 A;  1X4U A;  3N9Q A;  2MD7 B;  3NG2 A;  5DKA A;  2JM3 A;  3RPG B;  2Y1N A;  4A4C A;  1X4I A;  2DX8 A;  5B8D A;  3N9N A;  3EB5 A;  5B75 A;  2CON A;  4IC3 A;  1IYM A;  2M1R A;  1WES A;  5B77 A;  4A4B A;  4B7Y C;  2LXH C;  4I7B A;  2YSM A;  4YC9 A;  4AYC B;  4UP5 A;  2L5U A;  3O33 A;  2KR4 A;  2QJ0 A;  1VD4 A;  2M13 A;  3KDE C;  1ZBD B;  3KNV A;  1WEU A;  2KE1 A;  3LDY A;  1FP0 A;  2ECT A;  3ZNI A;  2L43 A;  3LQI A;  2KIZ A;  2K17 A;  3KV6 A;  4Q6F A;  4S3O B;  2C2L A;  2L75 A;  2G43 A;  3RPG C;  4GNE A;  5TRB A;  2P57 A;  5G05 B;  2LGK A;  4AUQ B;  3KV5 A;  4BBQ A;  3GL6 A;  2IQJ A;  5B78 A;  2EGP A;  3U5O A;  1MM2 A;  1WEM A;  2YU4 A;  3RTR B;  2VJF A;  4UI9 B;  2YYR A;  5FB0 A;  4IC2 A;  3T7L A;  5SVI B;  1XWH A;  4L58 A;  4WA6 A;  4YAX A;  3PUR A;  5K3Q A;  3QZV A;  2RI7 A;  1WIL A;  2ECV A;  2MA6 A;  3DQV R;  4ZDT A;  2EGM A;  2XB1 A;  5TBN A;  2VPB A;  2MNY A;  2XOC A;  1WEV A;  2XP0 A;  5D1K B;  4ZUX U;  2YVR A;  4WZ2 A;  4GNF A;  1WEN A;  2KWK A;  3EB6 A;  3HCU A;  4AP4 A;  2ECI A;  2E6R A;  4QQ4 A;  1K2F A;  4LKA A;  5AIU A;  4NN2 A;  2CRR A;  2L0B A;  2XOZ A;  4GND A;  3MDB C;  5B79 A;  2L80 A;  4YBM A;  2CRW A;  3FEH A;  2ECW A;  2FFW A;  1WE9 A;  4AVX A;  5DIN A;  1WEO A;  3FAN A;  4R8P K;  3C5K A;  2B0O E;  2FSA A;  1WEQ A;  3O70 A;  2JMD A;  1WGM A;  3LJU X;  4Z0R A;  5G04 B;  2G6Q A;  2KFT A;  1WFK A;  2HDP A;  3LQH A;  5I3L A;  1BOR A;  1WEE A;  3PUQ A;  4YAT A;  2KGG A;  5SVY A;  3ZVZ B;  2EOD A;  5KH9 A;  1WEP A;  4AYC A;  4V3K C;  4LAD B;  2PNX A;  5TAB A;  4V3L C;  5H1V A;  2LXP C;  4FK5 A;  3L11 A;  4OGC A;  2YHN A;  3SHB A;  2D8U A;  2Y1M A;  5H1U A;  5D1M B;  2F42 A;  2YT5 A;  4P5O B;  2I50 A;  3N9L A;  2CKL A;  4QF2 A;  2EA6 A;  2MD8 C;  5H1T A;  3O35 A;  4OGE A;  1DCQ A;  3LRQ A;  2YQM A;  2CKL B;  4QF3 A;  2CSZ A;  2CSY A;  2KGI A;  2KU3 A;  3O37 A;  3L1X A;  5SVX A;  3DPL R;  5FEY A;  3V43 A;  3T9K A;  2RR4 A;  3MHH A;  2KWN A;  4FO9 A;  2F6N A;  1N87 A;  1T1H A;  1CHC A;  1U6G B;  2FUI A;  2LGL A;  2MNZ A;  2OXQ C;  4O62 A;  2JRJ A;  5SVI A;  2RSD A;  5G0F A;  5JG6 A;  3SOU A;  4R2Y A;  4I7C A;  2OWA A;  4PPE A;  3N9M A;  3T6R A;  4YBT A;  3VK6 A;  2DSM A;  4LK9 A;  3O36 A;  5AIT A;  5D1L B;  4YBS A;  2K1J A;  3M7K A;  4GB0 A;  4YAD A;  3ZYQ A;  4FIP A;  3M62 A;  3SOW A;  2ZET C;  4YAB A;  3ZPV 1;  4N4F A;  3PLW A;  2F6J A;  2C2V S;  4MSX A;  1HYI A;  3MHS A;  2M3H A;  4L7X A;  3M99 A;  5C13 A;  5KH3 A;  2M6M A;  3LVR E;  4N3W A;  3SUB A;  2FD4 A;  1FBV A;  2CT2 A;  2NAA A;  5TDW A;  3LQJ A;  3PHD A;  4I7D A;  3U5P A;  3ZTG A;  2IDA A;  3ASL A;  1JOC A;  4X3G A;  1HYJ A;  2AN6 A;  2LGG A;  1V87 A;  4CCG X;  2XOY A;  1LDJ B;  2CSV A;  2VPG A;  1E4U A;  4W4U A;  3KQI A;  4LLB A;  3HCT A;  2KKY A;  5FER A;  2KWJ A;  5J3X A;  3JUE A;  2YSJ A;  3ZVY A;  4A0C D;  2VJE B;  2ECJ A;  4Z0O A;  2BAY A;  1JM7 B;  3O47 A;  2MA5 A;  2KRE A;  2H0D A;  4FJC A;  2K16 A;  3FJU B;  3U5N A;  3N9P A;  2MT5 A;  4LJN A;  2H0D B;  4C9Z A;  4R7E A;  5TDR A;  2YQL A;  3U5M A;  1Z2Q A;  2M85 A;  2XEU A;  4XI1 A;  4TKP B;  5LKU A;  2YUR A;  2E61 A;  4GNG A;  3M63 A;  4ZQL A;  4O64 A;  2LRI C;  3H7H A;  2D8S A;  2LAU A;  4F1P A;  3GV4 A;  2KWO A;  4WZ0 A;  2UZG A;  3DDT A;  5C11 A;  1F62 A;  3N9O A;  2PUY A;  1Z6U A;  5LKX A;  2MUM A;  3O34 A;  2JMJ A;  1VFY A;  3FAO A;  2ECG A;  2ECN A;  2VNF A;  2KKX A;  5EYA F;  3IHP A;  2E6S A;  2LDR A;  4UP0 A;  2YUC A;  2KYU A;  2Y43 A;  2G45 A;  2QIC A;  2JUN A;  3C6W A;  2JMI A;  2MKE A;  1WIM A;  3LVQ E;  5KH7 A;  3Q1D A;  2EXU A; 
#chains in the Genus database with same CATH homology
 4OGC A;  3DDT A;  2B0O E;  3E2D A;  2D8U A;  3O47 A;  2OWA A;  5SVX A;  5SVI B;  2E61 A;  3LJU X;  4Z0R A;  2XOY A;  3DWD A;  3T9K A;  2CSV A;  2YRE A;  2RR4 A;  4QQ4 A;  2P57 A;  5K3Q A;  2L7P A;  3FM8 C;  3LVR E;  2M13 A;  3H7H A;  3SUB A;  3M7K A;  2FD4 A;  4H9D A;  2CON A;  3FJU B;  2KKX A;  3KDE C;  2EGM A;  4OGE A;  2CRR A;  2KKY A;  2XOZ A;  2IQJ A;  3MDB C;  5SVY A;  3JUE A;  3LDY A;  1DCQ A;  2CRW A;  3FEH A;  2JUN A;  4O62 A;  2FFW A;  2LAU A;  4F1P A;  2MKE A;  2XOC A;  5SVI A;  2XP0 A;  3LVQ E;  3Q1D A;  2YVR A;  2EXU A;  2JM3 A;  4Z0O A;  2DJA A;  3PLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...