3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
4LKAA 3GL6A 2VPEA 2L75A 5ENFA 4LYIA 2E3KA 4QNSA 5F60A 4LJNA 5LCWB 2KWKA 1V87A 2YHNA 5D1MB 5FG4A 4ZW1A 2KWJA 4HBYA 3RPGC 3Q2EA 4MR3A 1N87A 2VP7A 5KTUA 4LADB 4UIWA 4N4IA 3UV4A 4CURA 2KE1A 4TYLA 4BHWA 4GB0A 4GNFA 3SVFA 5A85A 5EWVA 1RMDA 4PTBA 4YH4A 5DLXA 2K4DA 4QSUA 3K2JA 4J1PA 4J0RA 5CU8A 4PPEA 5D3RA 2R0VA 2R0YA 5KH7A 2GRCA 3V43A 5CQ4A 4A49A 2VNFA 2L5UA 5TDRA 5IBNA 2YHOA 2YELA 5C13A 3SOUA 4LZRA 4NR6A 4TTEA 5C89A 3O34A 5KTXA 5H9MA 4A9FA 5CQ3A 4C66A 3N9OA 4TZ8A 3LJWA 2YDWA 5DYCA 4A9MA 3UV5A 5F63A 4RVRA 4YK0A 5C85A 1DVPA 3RPGB 5HJCA 2ZETC 3ZYQA 2ECTA 3NG2A 2OSSA 3RCWA 5LKXA 2YQDA 4GNEA 5EK9A 4GNDA 5JG6A 3UW9A 1MM3A 3HTKC 3MB3A 3HMEA 4XY8A 4E96A 2M1RA 5E3GA 4YYKA 2XB1A 4IOQA 5F36A 3QZVA 5DYXA 5FE1A 4O78A 4NRBA 4QR4A 2DATA 4AUQB 5FE7A 3MUKA 4UI9B 2PUYA 1Z2QA 4V3KC 3UVXA 5HRXA 5ENGA 1WUMA 2RNWA 3MHSA 5F1LA 4AYCB 4ALHA 4YYIA 2RS9B 2RSDA 4S3OB 4A9EA 5C4QA 3LRQA 2RNXA 2D9EA 4A9JA 1WEPA 3L11A 4NRCA 4QUUA 5FE8A 4YYGA 5LKTA 2ECIA 4FK5A 5DFBA 5G05B 2YYNA 4QUTA 4MR6A 4YBTA 5C7NA 2FSAA 2R10A 4CA1A 5DKHA 1Z60A 4HXMA 4YYHA 4HXSA 4QEUA 2YUCA 3O37A 3O36A 2DKWA 4HXKA 5FG5A 2YREA 1G25A 1WUGA 4YABA 4X2IA 2NAAA 4IORA 4Q0NA 3JVKA 4P5OB 5KHMA 4KCXA 5F1HA 4WZ0A 4R7EA 5EWCA 2LN0A 2YT5A 1WEQA 1WEOA 2KREA 3N9QA 5FERA 3P1DA 4Q0OA 4YBSA 5L8UA 3P1FA 4L58A 2K17A 4ALGA 4LK9A 4KV1A 3PHDA 4LYWA 2KGIA 5DFCA 3I2DA 4O7FA 5I3LA 4QYDA 1WIMA 4TQNA 2G43A 5E9IA 5JI8A 2F6JA 2E6SA 3LQJA 5L97A 3L1ZB 3T7LA 3M99A 4O76A 5EV9A 5E3DA 2YYRA 2ECGA 1WFKA 4WHWA 4QY4A 1F62A 2FUUA 2YEKA 5I86A 4B86C 3S91A 5AMEA 4OGIA 4QSSA 3IU5A 5J3XA 5A5RA 5TBNA 5BT3A 5G4RA 4BW3A 3Q2FA 5HFRA 5KU3A 2JRJA 5F25A 3EB6A 4O77A 3DPLR 3LQHA 4AVXA 4J3IA 4MR4A 4PKLA 2DVQA 4MEOA 5EI4A 4TU4A 3VK6A 4O71A 1WE9A 5FE6A 5KO4A 5BT5A 5FB0A 2ECWA 3SHBA 5D25A 5CUDA 5FBXA 5FFWA 5LUUA 4NN2A 2MNZA 5EISA 3U5LA 5I88A 3KV5A 4MEQA 2LGVA 4QB3A 2XEUA 2LRIC 4CUUA 4LYSA 1FBVA 4QSRA 4BW1A 2YURA 4LRGA 5K29A 4NYWA 2JMDA 2VJFA 5AMFA 4QYLA 4YYNA 5HRVA 3KV6A 4FJCA 5DX4A 4Q6FA 4UIVA 4ZDTA 5J0DA 2EA6A 4NUCA 2RO1A 4YC9A 4ZC9A 5FE2A 4N3WA 2L80A 5D3SA 3ZPVE 4FIPA 4O7CA 2VPGA 2L0BA 4R2YA 4O7BA 1X0JA 3JVLA 3P1EA 4QZSA 5LVQA 2MA5A 1IYMA 4HBXA 5D3TA 4CFLA 5ENCA 4A9IA 5HLSA 1VFYA 5EP7A 3DWYA 5HM0A 2KYUA 2YEMA 3G0JA 3SVGA 3O7AA 4QSWA 5E7DA 5E9MA 3T6RA 4NYXA 4UYEA 4KV4A 2L85A 4HXOA 5A83A 2Y1MA 3PURA 5EICA 5II2A 5B78A 5FH6A 2I8NA 5HFQA 4AKNA 2E6RA 2G45A 2LXHC 3UVDA 4A9OA 5E9VA 5B75A 4Z6IA 2DVSA 2LGGA 4O72A 5CFWA 5CQAA 1JM4B 4QEWA 4LC2A 4FO9A 2MUMA 4OGJA 5EPRA 3U5MA 5A5OA 5I1QA 5I89A 4N4FA 4QSXA 4XUAA 1HYJA 5D24A 5IIDA 5FB1A 4A9HA 2LV9A 5L96A 3ZPV1 5I83A 4QEVA 4UYDA 3DQVR 5CZGA 5E9KA 3LQIA 5EM3A 5CRZA 3U5OA 4A9LA 2G6QA 3M62A 5B76A 3ZVZB 5AD2A 2DX8A 3N9PA 5D0CA 1WGMA 2MJVB 5CTLA 1E6IA 4O7AA 5ETDA 5F61A 2R0SA 4QC1A 5EQ1A 3QZSA 3ZTGA 4CL9A 5FDZA 5E73A 2YSJA 5FE4A 5EA1A 5KH9A 5D1KB 4O64A 2CSYA 5CQTA 4J0SA 3GG3A 2BAYA 1Z6UA 4GNGA 5HELA 4UP0A 2OXQC 3JVJA 3EB5A 3DAIA 2YW5A 4OUFA 1U6GB 5LKUA 3LXJA 3JVMA 4N4HA 5IGNA 4CUTA 4XI1A 2MNYA 2OUOA 2H60A 4TT6A 5A5SA 4CUPA 5TABA 4TT4A 4CUQA 2LSPB 4XYAA 5L98A 5F5ZA 3IHPA 2FUIA 4O7EA 3O70A 5A5NA 4Z1QA 4IR3A 5EVAA 4QSVA 5FE9A 3FL2A 4QF2A 4MR5A 2KU3A 5DLZA 5HQ6A 5LJ1A 5I80A 5DY7A 5C11A 1FP0A 5FE0A 5L99A 3MXFA 5F3AA 5AITA 1VYXA 5FH8A 2KGGA 4MENA 5DKDA 5LJ0A 4NR5A 4QR3A 5DBMA 2M85A 2I50A 3HCUA 3N9MA 4YYMA 5CQ6A 1X4JA 4WA6A 2YW8A 5L8TA 2DVRA 5CRMA 2Y1NA 4NXJA 5CQ7A 4CUSA 5DKAA 5DKCA 5G0FA 4UITA 5TRBA 3ZNIA 4MVTA 4TT2A 5HRWA 3ASLA 1JM7A 2EODA 4N4GA 5H1VA 2HYED 4YATA 2KFTA 2LGLA 4WZ2A 5LKZA 1WEWA 5B77A 5EWDA 5FE5A 2E7NA 4IR6A 4HXPA 4PCEA 2I7KA 5TDWA 5HCLA 2WP2A 4TKPB 4MEPA 5LJ2A 2IDAA 4WHUA 2QIZA 2F42A 2QJ0A 5FE3A 2VJEA 1LDKC 3HMHA 2KWOA 3L1XA 5D3JA 5ETBA 5DINA 5A82A 3HMFA 5FG6A 5EGUA 4PS5A 5LVRA 4B7YC 4F52B 5H85A 5AD3A 5BT4A 5ENEA 4NYVA 2MT5A 2PNXA 5ACYA 2ECVA 5IGLA 4QSPA 2VJEB 5EPBA 5I7YA 3KNVA 5CGPA 4Y03A 5E9YA 5D1LB 5E74A 5CP5A 1EQFA 4HBVA 3MULA 5HEMA 4NRAA 5EYAF 2D82A 4XUBA 4UIUA 5D26A 5DYUA 1WESA 4I7CA 4C9ZA 3U5JA 5ENIA 5HQ7A 3ONIA 1ZBDB 1WEVA 5AIUA 3N9NA 1WENA 1ZS5A 2CT2A 4NQNA 4X3GA 2VJFB 4NR9A 4BBQA 2KTBB 1XWHA 5KH3A 2D8SA 2JMJA 5B79A 1WILA 5DW2A 2YSMA 4NUDA 5ENHA 2JMIA 4LDFA 2DVVA 2RNYA 5IG6A 5CY9A 4HXRA 4A9KA 4QC3A 5CS8A 3TLPA 4F3IA 4IC3A 4TS8A 3ZVYA 5IGKA 3IU6A 5FFYA 1JOCA 3SOXA 3P5OA 4R8PK 2ECJA 3N9LA 2DWWA 2KR4A 4C67A 2UZGA 3HCTA 5DW1A 5ENBA 2L5EA 5F2PA 1CHCA 5I29A 5CUBA 4NS5A 4O70A 3C6WA 4S3OC 4LZ2A 4O74A 4QSTA 5G4SA 5FFVA 5D3LA 4CLBA 5D3HA 4IR4A 4HXLA 4NQMA 5A5QA 4YAXA 4BW2A 2Y43A 4YH3A 4V3LC 4A4BA 4Z6HA 3U5KA 2E7OA 3UV2A 2N9GA 2WP1A 5CUAA 5CUEA 4NR8A 4BJXA 5H1UA 2RFJA 2VPDA 5EWHA 5G04B 1WEEA 5FEYA 4NR4A 2MA6A 2YQMA 4TU6A 4YYJA 4A4CA 5E0RA 2MD7B 5CQ5A 4W4UA 4HXNA 5D3NA 1K2FA 4LR6A 2NXBA 5D3PA 2RI7A 5I40A 5B8DA 4A9NA 4UP5A 4QSQA 4Z93A 1VD4A 4GPJA 2L84A 4WZ3B 4AYCA 4LZSA 2KIZA 3SVHA 4UIZA 1BORA 3QZTA 2LQ6A 4YBMA 1LDJB 3MHHA 4A0CD 3MB4A 1JSPB 2CKLA 5FH7A 1T1HA 4NUEA 4IR5A 3P1CA 2C2LA 5HENA 4NR7A 2M6MA 1E4UA 4I7BA 4YADA 3HCSA 3C5KA 5TB6A 1MM2A 4UYFA 4IOOA 4AP4A 2G4AA 4UYGA 3SOWA 2CKLB 2K1JA 3M63A 2L43A 2LGKA 4XY9A 5CPEA 4LLBA 3GV4A 2C2VS 4UYFB 2H0DA 2VPBA 5KTWA 1N72A 5COIA 5H1TA 4L7XA 3ZYUA 5CUGA 5TCMA 4ZUXU 2YQLA 5HQ5A 3AADA 4O75A 4HBWA 5C87A 5IGMA 4PY6A 5CUCA 4YY4A 1WEUA 2YU4A 2MD8C 2H0DB 3I3JA 4UYHA 2OO1A 2ECNA 3G0LA 5D7XA 4QBMA 4TZ2A 3S92A 4MSXA 1HYIA 5A7CA 5C8GA 4CFKA 1F68A 3RTRB 4UIXA 3KQIA 5E9LA 4CCGX 4PCIA 5DFDA 1JM7B 2LDRA 1X4IA 4I7DA 3U5NA 1WEMA 5A81A 2EGPA 1X4UA 4UIYA 2KWNA 5CQ8A 2AN6A 5ENJA 4BW4A 3NXBA 4DONA 4YY6A 4ZQLA 5EU1A 4YYDA 3D7CA 2QICA 2MIQA 3AQAA 5DYAA 4QR5A 3O35A 3MQMA 5II1A 4Z1SA 5A5PA 5F62A 3UVWA 5EWWA 4FLPA 3O33A 3FKMX 2F6NA 5I7XA 4WIVA 2CSZA 3UVYA 2LXPC 5EPSA 4IC2A 2HDPA 2M3HA 3PUQA 5JWMA 2K16A 3U5PA 4QF3A
chains in the Genus database with same CATH superfamily
4LKAA 3GL6A 2VPEA 2L75A 5ENFA 4LYIA 2E3KA 4QNSA 5F60A 4LJNA 5LCWB 2KWKA 1V87A 2YHNA 5D1MB 5FG4A 4ZW1A 2KWJA 4HBYA 3RPGC 3Q2EA 4MR3A 1N87A 1PUOA 5KTUA 2VP7A 4UIWA 4LADB 4N4IA 3UV4A 2FD4A 4CURA 2KE1A 4TYLA 4BHWA 4GB0A 4GNFA 3SVFA 5A85A 5EWVA 5K3QA 1RMDA 4PTBA 4YH4A 5DLXA 2K4DA 4QSUA 3FEHA 3K2JA 4J1PA 4J0RA 5CU8A 3DDTA 4PPEA 5D3RA 2R0VA 2R0YA 5KH7A 2GRCA 3D1BA 3V43A 5CQ4A 4A49A 2VNFA 3DWDA 2L5UA 5TDRA 5IBNA 2YHOA 2YELA 5C13A 3JUEA 4AKGA 3SOUA 4LZRA 4NR6A 4TTEA 5C89A 3O34A 5KTXA 5H9MA 4A9FA 5CQ3A 4C66A 4AI6A 4TZ8A 3LJWA 2YDWA 5DYCA 4A9MA 3N9OA 3UV5A 5F63A 4RVRA 4YK0A 5C85A 1DVPA 3RPGB 5HJCA 2ZETC 3ZYQA 2ECTA 3NG2A 2OSSA 3RCWA 5LKXA 2YQDA 4GNEA 5EK9A 4GNDA 5JG6A 3UW9A 1MM3A 3HTKC 3MB3A 3HMEA 4XY8A 4E96A 2M1RA 5E3GA 4YYKA 2XB1A 4IOQA 5F36A 3QZVA 5DYXA 5FE1A 4O78A 4NRBA 4QR4A 2DATA 4AUQB 5FE7A 3MUKA 4UI9B 2PUYA 1Z2QA 4V3KC 3UVXA 5HRXA 5ENGA 1WUMA 2RNWA 3MHSA 5F1LA 4AYCB 4ALHA 4YYIA 2RS9B 2RSDA 4S3OB 4A9EA 3MDBC 5C4QA 2FFWA 3LRQA 2RNXA 2D9EA 4A9JA 1WEPA 3L11A 4NRCA 4QUUA 5FE8A 4YYGA 5LKTA 2ECIA 4FK5A 3E2DA 5DFBA 5G05B 2YYNA 4QUTA 4MR6A 2LAUA 3SUBA 4YBTA 5C7NA 2FSAA 2R10A 4CA1A 5DKHA 1Z60A 4HXMA 4YYHA 4HXSA 4QEUA 2YUCA 3O37A 3O36A 1DCQA 2DKWA 4HXKA 5FG5A 2YREA 1G25A 1WUGA 2CONA 4YABA 4X2IA 2NAAA 4IORA 4Q0NA 3JVKA 4P5OB 5KHMA 4AKHA 1MBMA 4KCXA 5F1HA 2XOCA 4WZ0A 4R7EA 5EWCA 2LN0A 2YT5A 1WEQA 1WEOA 2KREA 3N9QA 5FERA 3P1DA 3VKGA 4Q0OA 4YBSA 5L8UA 3P1FA 4L58A 2K17A 2KKXA 4ALGA 4LK9A 4KV1A 3PHDA 4Z0RA 4LYWA 2KGIA 5DFCA 3I2DA 4O7FA 5I3LA 4QYDA 1WIMA 4TQNA 2G43A 5E9IA 5JI8A 2F6JA 2E6SA 3LQJA 5L97A 3L1ZB 3T7LA 3M99A 4O76A 5EV9A 3FM8C 5E3DA 2YYRA 2ECGA 1WFKA 4WHWA 2D8UA 4QY4A 1F62A 2FUUA 2YEKA 5I86A 5SVYA 4B86C 3S91A 3FJUB 5AMEA 4OGIA 4QSSA 3IU5A 5J3XA 5A5RA 2E61A 5TBNA 5BT3A 5G4RA 4BW3A 3Q2FA 5HFRA 5KU3A 2JRJA 5F25A 3EB6A 4O77A 3DPLR 3LQHA 4AVXA 4J3IA 4MR4A 4PKLA 2DVQA 4MEOA 5EI4A 4TU4A 3VK6A 4O71A 1WE9A 5FE6A 5KO4A 2EGMA 5BT5A 5FB0A 2ECWA 3SHBA 5D25A 5CUDA 5FBXA 5FFWA 5LUUA 4NN2A 2MNZA 5EISA 3U5LA 3FAOA 5I88A 3KV5A 4MEQA 2LGVA 4QB3A 2XEUA 2EXUA 4CUUA 4LYSA 1FBVA 2LRIC 2XP0A 4QSRA 2EJNA 4BW1A 2YURA 4LRGA 5K29A 4NYWA 2JUNA 2JMDA 2VJFA 5AMFA 4QYLA 2DSMA 4YYNA 5HRVA 3KV6A 4FJCA 5DX4A 4Q6FA 4UIVA 4ZDTA 5J0DA 2EA6A 4NUCA 2RO1A 4YC9A 4ZC9A 5FE2A 4N3WA 2L80A 5D3SA 3O47A 4FIPA 4O7CA 3ZPVE 2VPGA 2L0BA 4R2YA 4O7BA 1X0JA 3JVLA 3M7KA 2XOYA 3P1EA 4QZSA 5LVQA 2MA5A 1IYMA 4HBXA 5D3TA 4CFLA 5ENCA 4A9IA 5HLSA 1VFYA 5EP7A 3DWYA 5HM0A 2KYUA 2YEMA 3G0JA 3SVGA 3O7AA 4QSWA 5E7DA 2OWAA 5E9MA 3T6RA 4NYXA 4UYEA 4KV4A 2L85A 4HXOA 5A83A 2Y1MA 5SVXA 3PURA 5EICA 5II2A 5B78A 5FH6A 2I8NA 5HFQA 4AKNA 2E6RA 2G45A 2LXHC 2KKYA 3KDEC 3UVDA 4A9OA 5E9VA 5B75A 4Z6IA 2DVSA 2LGGA 4O72A 5CFWA 5CQAA 1JM4B 4QEWA 4LC2A 4FO9A 2MUMA 4OGJA 5EPRA 3U5MA 5A5OA 5I1QA 5I89A 4N4FA 4QSXA 4XUAA 1HYJA 5D24A 5IIDA 5FB1A 4A9HA 2LV9A 5L96A 3ZPV1 5I83A 2XOZA 4QEVA 4UYDA 3DQVR 5CZGA 5E9KA 3LQIA 5EM3A 5CRZA 3U5OA 4A9LA 2G6QA 3M62A 5B76A 3ZVZB 5AD2A 2DX8A 3N9PA 5D0CA 1WGMA 2MJVB 5CTLA 1E6IA 4O7AA 5ETDA 5F61A 2R0SA 4QC1A 5EQ1A 5SVIA 3QZSA 3ZTGA 4CL9A 5FDZA 5E73A 2YSJA 5FE4A 5EA1A 5KH9A 3LVRE 5D1KB 4O62A 4O64A 2B0OE 2CSYA 5CQTA 4J0SA 3GG3A 2BAYA 1Z6UA 4GNGA 5HELA 4UP0A 3H7HA 5SVIB 2OXQC 3JVJA 3EB5A 3DAIA 2YW5A 4OUFA 1U6GB 5LKUA 3LXJA 3D1DA 3JVMA 4N4HA 4CUTA 5IGNA 4XI1A 4Z0OA 2MNYA 2OUOA 2H60A 4TT6A 5A5SA 4QQ4A 4CUPA 5TABA 4TT4A 4CUQA 2LSPB 4XYAA 5L98A 5F5ZA 3IHPA 3T9KA 2FUIA 4O7EA 3O70A 5A5NA 4Z1QA 4IR3A 5EVAA 4QSVA 5FE9A 3FL2A 4QF2A 4MR5A 4AKIA 2KU3A 5DLZA 3LJUX 5HQ6A 5LJ1A 5I80A 5DY7A 5C11A 1FP0A 5FE0A 5L99A 3MXFA 5F3AA 5AITA 1VYXA 5FH8A 2KGGA 4MENA 5DKDA 5LJ0A 4NR5A 4QR3A 5DBMA 2CRRA 2M85A 2I50A 3HCUA 3N9MA 4YYMA 5CQ6A 1X4JA 4WA6A 2YW8A 5L8TA 2DVRA 5CRMA 2Y1NA 4NXJA 5CQ7A 4CUSA 5DKAA 5DKCA 5G0FA 4UITA 5TRBA 3ZNIA 4MVTA 4TT2A 5HRWA 3ASLA 1JM7A 2EODA 4N4GA 5H1VA 2HYED 4YATA 2KFTA 2LGLA 4WZ2A 5LKZA 1WEWA 5B77A 5EWDA 5FE5A 2E7NA 4IR6A 4HXPA 4PCEA 2I7KA 5TDWA 5HCLA 2WP2A 4TKPB 4MEPA 5LJ2A 2IDAA 4WHUA 2QIZA 2F42A 2QJ0A 5FE3A 2VJEA 1LDKC 3HMHA 2KWOA 3L1XA 5D3JA 5ETBA 5DINA 5A82A 3HMFA 5FG6A 5EGUA 4PS5A 5LVRA 4B7YC 4F52B 5H85A 5AD3A 5BT4A 2RR4A 5ENEA 4NYVA 2MT5A 2PNXA 5ACYA 2ECVA 5IGLA 4QSPA 2VJEB 5EPBA 4H9DA 5I7YA 3KNVA 2M13A 5CGPA 4Y03A 5E9YA 5D1LB 5E74A 5CP5A 1EQFA 4HBVA 3MULA 5HEMA 4NRAA 5EYAF 2D82A 4XUBA 4UIUA 5D26A 5DYUA 1WESA 4I7CA 4C9ZA 3U5JA 5ENIA 5HQ7A 3ONIA 1ZBDB 2YVRA 1WEVA 5AIUA 3N9NA 1WENA 1ZS5A 2CT2A 4NQNA 3Q1DA 4X3GA 2VJFB 4NR9A 2L7PA 4BBQA 2KTBB 1XWHA 5KH3A 2D8SA 2JMJA 5B79A 1WILA 3LDYA 5DW2A 2YSMA 4NUDA 5ENHA 3ERRA 2JMIA 4LDFA 2DVVA 2RNYA 5IG6A 5CY9A 4HXRA 4A9KA 4QC3A 5CS8A 3TLPA 4F3IA 4IC3A 4TS8A 3ZVYA 5IGKA 3IU6A 5FFYA 1JOCA 3SOXA 3P5OA 4R8PK 2ECJA 3N9LA 2DWWA 2KR4A 4C67A 2UZGA 3HCTA 5DW1A 5ENBA 2DJAA 2L5EA 5F2PA 1CHCA 5I29A 5CUBA 4NS5A 4O70A 3C6WA 4S3OC 4LZ2A 4O74A 4QSTA 5G4SA 5FFVA 5D3LA 4CLBA 5D3HA 4IR4A 4HXLA 4NQMA 5A5QA 3FANA 4YAXA 4BW2A 2Y43A 4YH3A 4V3LC 4A4BA 4Z6HA 3U5KA 2E7OA 3UV2A 2N9GA 2WP1A 5CUAA 5CUEA 4NR8A 4BJXA 5H1UA 2RFJA 2VPDA 5EWHA 5G04B 1WEEA 5FEYA 4NR4A 2MA6A 2YQMA 4TU6A 4YYJA 4A4CA 5E0RA 2MD7B 2MKEA 5CQ5A 4W4UA 4HXNA 5D3NA 1K2FA 4LR6A 2NXBA 5D3PA 2RI7A 5I40A 5B8DA 4A9NA 4UP5A 4QSQA 4Z93A 1VD4A 4GPJA 2L84A 4WZ3B 4AYCA 4LZSA 2KIZA 3SVHA 4UIZA 1BORA 3QZTA 2LQ6A 3PLWA 4YBMA 1LDJB 3MHHA 4A0CD 3MB4A 1JSPB 2CKLA 5FH7A 1T1HA 4NUEA 4IR5A 3P1CA 2C2LA 5HENA 4NR7A 2M6MA 1E4UA 4I7BA 4OGEA 4YADA 2JM3A 3C5KA 3HCSA 5TB6A 1MM2A 4UYFA 4IOOA 4AP4A 2G4AA 4UYGA 3SOWA 2CKLB 2K1JA 3M63A 2L43A 2LGKA 3VKHA 4XY9A 5CPEA 4LLBA 3GV4A 2C2VS 4UYFB 2H0DA 2VPBA 5KTWA 1N72A 5COIA 5H1TA 4L7XA 3ZYUA 5CUGA 5TCMA 4ZUXU 2YQLA 5HQ5A 3AADA 4O75A 4HBWA 5C87A 5IGMA 4PY6A 5CUCA 4YY4A 1WEUA 2YU4A 2MD8C 2H0DB 3I3JA 4UYHA 2OO1A 2IQJA 2ECNA 3G0LA 5D7XA 4QBMA 4TZ2A 3S92A 4MSXA 1HYIA 5A7CA 5C8GA 4CFKA 1F68A 3RTRB 4UIXA 3KQIA 5E9LA 4CCGX 2P57A 4PCIA 5DFDA 1JM7B 2LDRA 1X4IA 4I7DA 3U5NA 1WEMA 5A81A 2CSVA 2EGPA 1X4UA 4UIYA 2KWNA 5CQ8A 2AN6A 5ENJA 4BW4A 1ZKRA 3NXBA 4DONA 4YY6A 3LVQE 4ZQLA 5EU1A 4YYDA 3D7CA 2QICA 4OGCA 2MIQA 3AQAA 5DYAA 4QR5A 3O35A 3MQMA 5II1A 4Z1SA 2CRWA 5A5PA 5F62A 3UVWA 5EWWA 4FLPA 3O33A 3FKMX 2F6NA 5I7XA 4WIVA 2CSZA 3UVYA 2LXPC 5EPSA 4IC2A 2HDPA 2M3HA 3PUQA 4F1PA 5JWMA 2K16A 3U5PA 4QF3A
chains in the Genus database with same CATH topology
4LKAA 3GL6A 2VPEA 2L75A 5ENFA 4LYIA 2E3KA 4QNSA 5F60A 4LJNA 5LCWB 2KWKA 1V87A 2YHNA 5D1MB 5FG4A 4ZW1A 2KWJA 4HBYA 3RPGC 3Q2EA 4MR3A 1N87A 2VP7A 5KTUA 4LADB 4UIWA 4N4IA 3UV4A 4CURA 2KE1A 4TYLA 4BHWA 4GB0A 4GNFA 3SVFA 5A85A 5EWVA 1RMDA 4PTBA 4YH4A 5DLXA 2K4DA 4QSUA 3K2JA 4J1PA 4J0RA 5CU8A 4PPEA 5D3RA 2R0VA 2R0YA 5KH7A 2GRCA 3V43A 5CQ4A 4A49A 2VNFA 2L5UA 5TDRA 5IBNA 2YHOA 2YELA 5C13A 3SOUA 4LZRA 4NR6A 4TTEA 5C89A 3O34A 5KTXA 5H9MA 4A9FA 5CQ3A 4C66A 3N9OA 4TZ8A 3LJWA 2YDWA 5DYCA 4A9MA 3UV5A 5F63A 4RVRA 4YK0A 5C85A 1DVPA 3RPGB 5HJCA 2ZETC 3ZYQA 2ECTA 3NG2A 2OSSA 3RCWA 5LKXA 2YQDA 4GNEA 5EK9A 4GNDA 5JG6A 3UW9A 1MM3A 3HTKC 3MB3A 3HMEA 4XY8A 4E96A 2M1RA 5E3GA 4YYKA 2XB1A 4IOQA 5F36A 3QZVA 5DYXA 5FE1A 4O78A 4NRBA 4QR4A 2DATA 4AUQB 5FE7A 3MUKA 4UI9B 2PUYA 1Z2QA 4V3KC 3UVXA 5HRXA 5ENGA 1WUMA 2RNWA 3MHSA 5F1LA 4AYCB 4ALHA 4YYIA 2RS9B 2RSDA 4S3OB 4A9EA 5C4QA 3LRQA 2RNXA 2D9EA 4A9JA 1WEPA 3L11A 4NRCA 4QUUA 5FE8A 4YYGA 5LKTA 2ECIA 4FK5A 5DFBA 5G05B 2YYNA 4QUTA 4MR6A 4YBTA 5C7NA 2FSAA 2R10A 4CA1A 5DKHA 1Z60A 4HXMA 4YYHA 4HXSA 4QEUA 2YUCA 3O37A 3O36A 2DKWA 4HXKA 5FG5A 2YREA 1G25A 1WUGA 4YABA 4X2IA 2NAAA 4IORA 4Q0NA 3JVKA 4P5OB 5KHMA 4KCXA 5F1HA 4WZ0A 4R7EA 5EWCA 2LN0A 2YT5A 1WEQA 1WEOA 2KREA 3N9QA 5FERA 3P1DA 4Q0OA 4YBSA 5L8UA 3P1FA 4L58A 2K17A 4ALGA 4LK9A 4KV1A 3PHDA 4LYWA 2KGIA 5DFCA 3I2DA 4O7FA 5I3LA 4QYDA 1WIMA 4TQNA 2G43A 5E9IA 5JI8A 2F6JA 2E6SA 3LQJA 5L97A 3L1ZB 3T7LA 3M99A 4O76A 5EV9A 5E3DA 2YYRA 2ECGA 1WFKA 4WHWA 4QY4A 1F62A 2FUUA 2YEKA 5I86A 4B86C 3S91A 5AMEA 4OGIA 4QSSA 3IU5A 5J3XA 5A5RA 5TBNA 5BT3A 5G4RA 4BW3A 3Q2FA 5HFRA 5KU3A 2JRJA 5F25A 3EB6A 4O77A 3DPLR 3LQHA 4AVXA 4J3IA 4MR4A 4PKLA 2DVQA 4MEOA 5EI4A 4TU4A 3VK6A 4O71A 1WE9A 5FE6A 5KO4A 5BT5A 5FB0A 2ECWA 3SHBA 5D25A 5CUDA 5FBXA 5FFWA 5LUUA 4NN2A 2MNZA 5EISA 3U5LA 5I88A 3KV5A 4MEQA 2LGVA 4QB3A 2XEUA 2LRIC 4CUUA 4LYSA 1FBVA 4QSRA 4BW1A 2YURA 4LRGA 5K29A 4NYWA 2JMDA 2VJFA 5AMFA 4QYLA 4YYNA 5HRVA 3KV6A 4FJCA 5DX4A 4Q6FA 4UIVA 4ZDTA 5J0DA 2EA6A 4NUCA 2RO1A 4YC9A 4ZC9A 5FE2A 4N3WA 2L80A 5D3SA 3ZPVE 4FIPA 4O7CA 2VPGA 2L0BA 4R2YA 4O7BA 1X0JA 3JVLA 3P1EA 4QZSA 5LVQA 2MA5A 1IYMA 4HBXA 5D3TA 4CFLA 5ENCA 4A9IA 5HLSA 1VFYA 5EP7A 3DWYA 5HM0A 2KYUA 2YEMA 3G0JA 3SVGA 3O7AA 4QSWA 5E7DA 5E9MA 3T6RA 4NYXA 4UYEA 4KV4A 2L85A 4HXOA 5A83A 2Y1MA 3PURA 5EICA 5II2A 5B78A 5FH6A 2I8NA 5HFQA 4AKNA 2E6RA 2G45A 2LXHC 3UVDA 4A9OA 5E9VA 5B75A 4Z6IA 2DVSA 2LGGA 4O72A 5CFWA 5CQAA 1JM4B 4QEWA 4LC2A 4FO9A 2MUMA 4OGJA 5EPRA 3U5MA 5A5OA 5I1QA 5I89A 4N4FA 4QSXA 4XUAA 1HYJA 5D24A 5IIDA 5FB1A 4A9HA 2LV9A 5L96A 3ZPV1 5I83A 4QEVA 4UYDA 3DQVR 5CZGA 5E9KA 3LQIA 5EM3A 5CRZA 3U5OA 4A9LA 2G6QA 3M62A 5B76A 3ZVZB 5AD2A 2DX8A 3N9PA 5D0CA 1WGMA 2MJVB 5CTLA 1E6IA 4O7AA 5ETDA 5F61A 2R0SA 4QC1A 5EQ1A 3QZSA 3ZTGA 4CL9A 5FDZA 5E73A 2YSJA 5FE4A 5EA1A 5KH9A 5D1KB 4O64A 2CSYA 5CQTA 4J0SA 3GG3A 2BAYA 1Z6UA 4GNGA 5HELA 4UP0A 2OXQC 3JVJA 3EB5A 3DAIA 2YW5A 4OUFA 1U6GB 5LKUA 3LXJA 3JVMA 4N4HA 5IGNA 4CUTA 4XI1A 2MNYA 2OUOA 2H60A 4TT6A 5A5SA 4CUPA 5TABA 4TT4A 4CUQA 2LSPB 4XYAA 5L98A 5F5ZA 3IHPA 2FUIA 4O7EA 3O70A 5A5NA 4Z1QA 4IR3A 5EVAA 4QSVA 5FE9A 3FL2A 4QF2A 4MR5A 2KU3A 5DLZA 5HQ6A 5LJ1A 5I80A 5DY7A 5C11A 1FP0A 5FE0A 5L99A 3MXFA 5F3AA 5AITA 1VYXA 5FH8A 2KGGA 4MENA 5DKDA 5LJ0A 4NR5A 4QR3A 5DBMA 2M85A 2I50A 3HCUA 3N9MA 4YYMA 5CQ6A 1X4JA 4WA6A 2YW8A 5L8TA 2DVRA 5CRMA 2Y1NA 4NXJA 5CQ7A 4CUSA 5DKAA 5DKCA 5G0FA 4UITA 5TRBA 3ZNIA 4MVTA 4TT2A 5HRWA 3ASLA 1JM7A 2EODA 4N4GA 5H1VA 2HYED 4YATA 2KFTA 2LGLA 4WZ2A 5LKZA 1WEWA 5B77A 5EWDA 5FE5A 2E7NA 4IR6A 4HXPA 4PCEA 2I7KA 5TDWA 5HCLA 2WP2A 4TKPB 4MEPA 5LJ2A 2IDAA 4WHUA 2QIZA 2F42A 2QJ0A 5FE3A 2VJEA 1LDKC 3HMHA 2KWOA 3L1XA 5D3JA 5ETBA 5DINA 5A82A 3HMFA 5FG6A 5EGUA 4PS5A 5LVRA 4B7YC 4F52B 5H85A 5AD3A 5BT4A 5ENEA 4NYVA 2MT5A 2PNXA 5ACYA 2ECVA 5IGLA 4QSPA 2VJEB 5EPBA 5I7YA 3KNVA 5CGPA 4Y03A 5E9YA 5D1LB 5E74A 5CP5A 1EQFA 4HBVA 3MULA 5HEMA 4NRAA 5EYAF 2D82A 4XUBA 4UIUA 5D26A 5DYUA 1WESA 4I7CA 4C9ZA 3U5JA 5ENIA 5HQ7A 3ONIA 1ZBDB 1WEVA 5AIUA 3N9NA 1WENA 1ZS5A 2CT2A 4NQNA 4X3GA 2VJFB 4NR9A 4BBQA 2KTBB 1XWHA 5KH3A 2D8SA 2JMJA 5B79A 1WILA 5DW2A 2YSMA 4NUDA 5ENHA 2JMIA 4LDFA 2DVVA 2RNYA 5IG6A 5CY9A 4HXRA 4A9KA 4QC3A 5CS8A 3TLPA 4F3IA 4IC3A 4TS8A 3ZVYA 5IGKA 3IU6A 5FFYA 1JOCA 3SOXA 3P5OA 4R8PK 2ECJA 3N9LA 2DWWA 2KR4A 4C67A 2UZGA 3HCTA 5DW1A 5ENBA 2L5EA 5F2PA 1CHCA 5I29A 5CUBA 4NS5A 4O70A 3C6WA 4S3OC 4LZ2A 4O74A 4QSTA 5G4SA 5FFVA 5D3LA 4CLBA 5D3HA 4IR4A 4HXLA 4NQMA 5A5QA 4YAXA 4BW2A 2Y43A 4YH3A 4V3LC 4A4BA 4Z6HA 3U5KA 2E7OA 3UV2A 2N9GA 2WP1A 5CUAA 5CUEA 4NR8A 4BJXA 5H1UA 2RFJA 2VPDA 5EWHA 5G04B 1WEEA 5FEYA 4NR4A 2MA6A 2YQMA 4TU6A 4YYJA 4A4CA 5E0RA 2MD7B 5CQ5A 4W4UA 4HXNA 5D3NA 1K2FA 4LR6A 2NXBA 5D3PA 2RI7A 5I40A 5B8DA 4A9NA 4UP5A 4QSQA 4Z93A 1VD4A 4GPJA 2L84A 4WZ3B 4AYCA 4LZSA 2KIZA 3SVHA 4UIZA 1BORA 3QZTA 2LQ6A 4YBMA 1LDJB 3MHHA 4A0CD 3MB4A 1JSPB 2CKLA 5FH7A 1T1HA 4NUEA 4IR5A 3P1CA 2C2LA 5HENA 4NR7A 2M6MA 1E4UA 4I7BA 4YADA 3HCSA 3C5KA 5TB6A 1MM2A 4UYFA 4IOOA 4AP4A 2G4AA 4UYGA 3SOWA 2CKLB 2K1JA 3M63A 2L43A 2LGKA 4XY9A 5CPEA 4LLBA 3GV4A 2C2VS 4UYFB 2H0DA 2VPBA 5KTWA 1N72A 5COIA 5H1TA 4L7XA 3ZYUA 5CUGA 5TCMA 4ZUXU 2YQLA 5HQ5A 3AADA 4O75A 4HBWA 5C87A 5IGMA 4PY6A 5CUCA 4YY4A 1WEUA 2YU4A 2MD8C 2H0DB 3I3JA 4UYHA 2OO1A 2ECNA 3G0LA 5D7XA 4QBMA 4TZ2A 3S92A 4MSXA 1HYIA 5A7CA 5C8GA 4CFKA 1F68A 3RTRB 4UIXA 3KQIA 5E9LA 4CCGX 4PCIA 5DFDA 1JM7B 2LDRA 1X4IA 4I7DA 3U5NA 1WEMA 5A81A 2EGPA 1X4UA 4UIYA 2KWNA 5CQ8A 2AN6A 5ENJA 4BW4A 3NXBA 4DONA 4YY6A 4ZQLA 5EU1A 4YYDA 3D7CA 2QICA 2MIQA 3AQAA 5DYAA 4QR5A 3O35A 3MQMA 5II1A 4Z1SA 5A5PA 5F62A 3UVWA 5EWWA 4FLPA 3O33A 3FKMX 2F6NA 5I7XA 4WIVA 2CSZA 3UVYA 2LXPC 5EPSA 4IC2A 2HDPA 2M3HA 3PUQA 5JWMA 2K16A 3U5PA 4QF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LKA A;  3GL6 A;  2VPE A;  2L75 A;  5ENF A;  4LYI A;  2E3K A;  4QNS A;  5F60 A;  4LJN A;  5LCW B;  2KWK A;  1V87 A;  2YHN A;  5D1M B;  5FG4 A;  4ZW1 A;  2KWJ A;  4HBY A;  3RPG C;  3Q2E A;  4MR3 A;  1N87 A;  2VP7 A;  5KTU A;  4LAD B;  4UIW A;  4N4I A;  3UV4 A;  4CUR A;  2KE1 A;  4TYL A;  4BHW A;  4GB0 A;  4GNF A;  3SVF A;  5A85 A;  5EWV A;  1RMD A;  4PTB A;  4YH4 A;  5DLX A;  2K4D A;  4QSU A;  3K2J A;  4J1P A;  4J0R A;  5CU8 A;  4PPE A;  5D3R A;  2R0V A;  2R0Y A;  5KH7 A;  2GRC A;  3V43 A;  5CQ4 A;  4A49 A;  2VNF A;  2L5U A;  5TDR A;  5IBN A;  2YHO A;  2YEL A;  5C13 A;  3SOU A;  4LZR A;  4NR6 A;  4TTE A;  5C89 A;  3O34 A;  5KTX A;  5H9M A;  4A9F A;  5CQ3 A;  4C66 A;  3N9O A;  4TZ8 A;  3LJW A;  2YDW A;  5DYC A;  4A9M A;  3UV5 A;  5F63 A;  4RVR A;  4YK0 A;  5C85 A;  1DVP A;  3RPG B;  5HJC A;  2ZET C;  3ZYQ A;  2ECT A;  3NG2 A;  2OSS A;  3RCW A;  5LKX A;  2YQD A;  4GNE A;  5EK9 A;  4GND A;  5JG6 A;  3UW9 A;  1MM3 A;  3HTK C;  3MB3 A;  3HME A;  4XY8 A;  4E96 A;  2M1R A;  5E3G A;  4YYK A;  2XB1 A;  4IOQ A;  5F36 A;  3QZV A;  5DYX A;  5FE1 A;  4O78 A;  4NRB A;  4QR4 A;  2DAT A;  4AUQ B;  5FE7 A;  3MUK A;  4UI9 B;  2PUY A;  1Z2Q A;  4V3K C;  3UVX A;  5HRX A;  5ENG A;  1WUM A;  2RNW A;  3MHS A;  5F1L A;  4AYC B;  4ALH A;  4YYI A;  2RS9 B;  2RSD A;  4S3O B;  4A9E A;  5C4Q A;  3LRQ A;  2RNX A;  2D9E A;  4A9J A;  1WEP A;  3L11 A;  4NRC A;  4QUU A;  5FE8 A;  4YYG A;  5LKT A;  2ECI A;  4FK5 A;  5DFB A;  5G05 B;  2YYN A;  4QUT A;  4MR6 A;  4YBT A;  5C7N A;  2FSA A;  2R10 A;  4CA1 A;  5DKH A;  1Z60 A;  4HXM A;  4YYH A;  4HXS A;  4QEU A;  2YUC A;  3O37 A;  3O36 A;  2DKW A;  4HXK A;  5FG5 A;  2YRE A;  1G25 A;  1WUG A;  4YAB A;  4X2I A;  2NAA A;  4IOR A;  4Q0N A;  3JVK A;  4P5O B;  5KHM A;  4KCX A;  5F1H A;  4WZ0 A;  4R7E A;  5EWC A;  2LN0 A;  2YT5 A;  1WEQ A;  1WEO A;  2KRE A;  3N9Q A;  5FER A;  3P1D A;  4Q0O A;  4YBS A;  5L8U A;  3P1F A;  4L58 A;  2K17 A;  4ALG A;  4LK9 A;  4KV1 A;  3PHD A;  4LYW A;  2KGI A;  5DFC A;  3I2D A;  4O7F A;  5I3L A;  4QYD A;  1WIM A;  4TQN A;  2G43 A;  5E9I A;  5JI8 A;  2F6J A;  2E6S A;  3LQJ A;  5L97 A;  3L1Z B;  3T7L A;  3M99 A;  4O76 A;  5EV9 A;  5E3D A;  2YYR A;  2ECG A;  1WFK A;  4WHW A;  4QY4 A;  1F62 A;  2FUU A;  2YEK A;  5I86 A;  4B86 C;  3S91 A;  5AME A;  4OGI A;  4QSS A;  3IU5 A;  5J3X A;  5A5R A;  5TBN A;  5BT3 A;  5G4R A;  4BW3 A;  3Q2F A;  5HFR A;  5KU3 A;  2JRJ A;  5F25 A;  3EB6 A;  4O77 A;  3DPL R;  3LQH A;  4AVX A;  4J3I A;  4MR4 A;  4PKL A;  2DVQ A;  4MEO A;  5EI4 A;  4TU4 A;  3VK6 A;  4O71 A;  1WE9 A;  5FE6 A;  5KO4 A;  5BT5 A;  5FB0 A;  2ECW A;  3SHB A;  5D25 A;  5CUD A;  5FBX A;  5FFW A;  5LUU A;  4NN2 A;  2MNZ A;  5EIS A;  3U5L A;  5I88 A;  3KV5 A;  4MEQ A;  2LGV A;  4QB3 A;  2XEU A;  2LRI C;  4CUU A;  4LYS A;  1FBV A;  4QSR A;  4BW1 A;  2YUR A;  4LRG A;  5K29 A;  4NYW A;  2JMD A;  2VJF A;  5AMF A;  4QYL A;  4YYN A;  5HRV A;  3KV6 A;  4FJC A;  5DX4 A;  4Q6F A;  4UIV A;  4ZDT A;  5J0D A;  2EA6 A;  4NUC A;  2RO1 A;  4YC9 A;  4ZC9 A;  5FE2 A;  4N3W A;  2L80 A;  5D3S A;  3ZPV E;  4FIP A;  4O7C A;  2VPG A;  2L0B A;  4R2Y A;  4O7B A;  1X0J A;  3JVL A;  3P1E A;  4QZS A;  5LVQ A;  2MA5 A;  1IYM A;  4HBX A;  5D3T A;  4CFL A;  5ENC A;  4A9I A;  5HLS A;  1VFY A;  5EP7 A;  3DWY A;  5HM0 A;  2KYU A;  2YEM A;  3G0J A;  3SVG A;  3O7A A;  4QSW A;  5E7D A;  5E9M A;  3T6R A;  4NYX A;  4UYE A;  4KV4 A;  2L85 A;  4HXO A;  5A83 A;  2Y1M A;  3PUR A;  5EIC A;  5II2 A;  5B78 A;  5FH6 A;  2I8N A;  5HFQ A;  4AKN A;  2E6R A;  2G45 A;  2LXH C;  3UVD A;  4A9O A;  5E9V A;  5B75 A;  4Z6I A;  2DVS A;  2LGG A;  4O72 A;  5CFW A;  5CQA A;  1JM4 B;  4QEW A;  4LC2 A;  4FO9 A;  2MUM A;  4OGJ A;  5EPR A;  3U5M A;  5A5O A;  5I1Q A;  5I89 A;  4N4F A;  4QSX A;  4XUA A;  1HYJ A;  5D24 A;  5IID A;  5FB1 A;  4A9H A;  2LV9 A;  5L96 A;  3ZPV 1;  5I83 A;  4QEV A;  4UYD A;  3DQV R;  5CZG A;  5E9K A;  3LQI A;  5EM3 A;  5CRZ A;  3U5O A;  4A9L A;  2G6Q A;  3M62 A;  5B76 A;  3ZVZ B;  5AD2 A;  2DX8 A;  3N9P A;  5D0C A;  1WGM A;  2MJV B;  5CTL A;  1E6I A;  4O7A A;  5ETD A;  5F61 A;  2R0S A;  4QC1 A;  5EQ1 A;  3QZS A;  3ZTG A;  4CL9 A;  5FDZ A;  5E73 A;  2YSJ A;  5FE4 A;  5EA1 A;  5KH9 A;  5D1K B;  4O64 A;  2CSY A;  5CQT A;  4J0S A;  3GG3 A;  2BAY A;  1Z6U A;  4GNG A;  5HEL A;  4UP0 A;  2OXQ C;  3JVJ A;  3EB5 A;  3DAI A;  2YW5 A;  4OUF A;  1U6G B;  5LKU A;  3LXJ A;  3JVM A;  4N4H A;  5IGN A;  4CUT A;  4XI1 A;  2MNY A;  2OUO A;  2H60 A;  4TT6 A;  5A5S A;  4CUP A;  5TAB A;  4TT4 A;  4CUQ A;  2LSP B;  4XYA A;  5L98 A;  5F5Z A;  3IHP A;  2FUI A;  4O7E A;  3O70 A;  5A5N A;  4Z1Q A;  4IR3 A;  5EVA A;  4QSV A;  5FE9 A;  3FL2 A;  4QF2 A;  4MR5 A;  2KU3 A;  5DLZ A;  5HQ6 A;  5LJ1 A;  5I80 A;  5DY7 A;  5C11 A;  1FP0 A;  5FE0 A;  5L99 A;  3MXF A;  5F3A A;  5AIT A;  1VYX A;  5FH8 A;  2KGG A;  4MEN A;  5DKD A;  5LJ0 A;  4NR5 A;  4QR3 A;  5DBM A;  2M85 A;  2I50 A;  3HCU A;  3N9M A;  4YYM A;  5CQ6 A;  1X4J A;  4WA6 A;  2YW8 A;  5L8T A;  2DVR A;  5CRM A;  2Y1N A;  4NXJ A;  5CQ7 A;  4CUS A;  5DKA A;  5DKC A;  5G0F A;  4UIT A;  5TRB A;  3ZNI A;  4MVT A;  4TT2 A;  5HRW A;  3ASL A;  1JM7 A;  2EOD A;  4N4G A;  5H1V A;  2HYE D;  4YAT A;  2KFT A;  2LGL A;  4WZ2 A;  5LKZ A;  1WEW A;  5B77 A;  5EWD A;  5FE5 A;  2E7N A;  4IR6 A;  4HXP A;  4PCE A;  2I7K A;  5TDW A;  5HCL A;  2WP2 A;  4TKP B;  4MEP A;  5LJ2 A;  2IDA A;  4WHU A;  2QIZ A;  2F42 A;  2QJ0 A;  5FE3 A;  2VJE A;  1LDK C;  3HMH A;  2KWO A;  3L1X A;  5D3J A;  5ETB A;  5DIN A;  5A82 A;  3HMF A;  5FG6 A;  5EGU A;  4PS5 A;  5LVR A;  4B7Y C;  4F52 B;  5H85 A;  5AD3 A;  5BT4 A;  5ENE A;  4NYV A;  2MT5 A;  2PNX A;  5ACY A;  2ECV A;  5IGL A;  4QSP A;  2VJE B;  5EPB A;  5I7Y A;  3KNV A;  5CGP A;  4Y03 A;  5E9Y A;  5D1L B;  5E74 A;  5CP5 A;  1EQF A;  4HBV A;  3MUL A;  5HEM A;  4NRA A;  5EYA F;  2D82 A;  4XUB A;  4UIU A;  5D26 A;  5DYU A;  1WES A;  4I7C A;  4C9Z A;  3U5J A;  5ENI A;  5HQ7 A;  3ONI A;  1ZBD B;  1WEV A;  5AIU A;  3N9N A;  1WEN A;  1ZS5 A;  2CT2 A;  4NQN A;  4X3G A;  2VJF B;  4NR9 A;  4BBQ A;  2KTB B;  1XWH A;  5KH3 A;  2D8S A;  2JMJ A;  5B79 A;  1WIL A;  5DW2 A;  2YSM A;  4NUD A;  5ENH A;  2JMI A;  4LDF A;  2DVV A;  2RNY A;  5IG6 A;  5CY9 A;  4HXR A;  4A9K A;  4QC3 A;  5CS8 A;  3TLP A;  4F3I A;  4IC3 A;  4TS8 A;  3ZVY A;  5IGK A;  3IU6 A;  5FFY A;  1JOC A;  3SOX A;  3P5O A;  4R8P K;  2ECJ A;  3N9L A;  2DWW A;  2KR4 A;  4C67 A;  2UZG A;  3HCT A;  5DW1 A;  5ENB A;  2L5E A;  5F2P A;  1CHC A;  5I29 A;  5CUB A;  4NS5 A;  4O70 A;  3C6W A;  4S3O C;  4LZ2 A;  4O74 A;  4QST A;  5G4S A;  5FFV A;  5D3L A;  4CLB A;  5D3H A;  4IR4 A;  4HXL A;  4NQM A;  5A5Q A;  4YAX A;  4BW2 A;  2Y43 A;  4YH3 A;  4V3L C;  4A4B A;  4Z6H A;  3U5K A;  2E7O A;  3UV2 A;  2N9G A;  2WP1 A;  5CUA A;  5CUE A;  4NR8 A;  4BJX A;  5H1U A;  2RFJ A;  2VPD A;  5EWH A;  5G04 B;  1WEE A;  5FEY A;  4NR4 A;  2MA6 A;  2YQM A;  4TU6 A;  4YYJ A;  4A4C A;  5E0R A;  2MD7 B;  5CQ5 A;  4W4U A;  4HXN A;  5D3N A;  1K2F A;  4LR6 A;  2NXB A;  5D3P A;  2RI7 A;  5I40 A;  5B8D A;  4A9N A;  4UP5 A;  4QSQ A;  4Z93 A;  1VD4 A;  4GPJ A;  2L84 A;  4WZ3 B;  4AYC A;  4LZS A;  2KIZ A;  3SVH A;  4UIZ A;  1BOR A;  3QZT A;  2LQ6 A;  4YBM A;  1LDJ B;  3MHH A;  4A0C D;  3MB4 A;  1JSP B;  2CKL A;  5FH7 A;  1T1H A;  4NUE A;  4IR5 A;  3P1C A;  2C2L A;  5HEN A;  4NR7 A;  2M6M A;  1E4U A;  4I7B A;  4YAD A;  3HCS A;  3C5K A;  5TB6 A;  1MM2 A;  4UYF A;  4IOO A;  4AP4 A;  2G4A A;  4UYG A;  3SOW A;  2CKL B;  2K1J A;  3M63 A;  2L43 A;  2LGK A;  4XY9 A;  5CPE A;  4LLB A;  3GV4 A;  2C2V S;  4UYF B;  2H0D A;  2VPB A;  5KTW A;  1N72 A;  5COI A;  5H1T A;  4L7X A;  3ZYU A;  5CUG A;  5TCM A;  4ZUX U;  2YQL A;  5HQ5 A;  3AAD A;  4O75 A;  4HBW A;  5C87 A;  5IGM A;  4PY6 A;  5CUC A;  4YY4 A;  1WEU A;  2YU4 A;  2MD8 C;  2H0D B;  3I3J A;  4UYH A;  2OO1 A;  2ECN A;  3G0L A;  5D7X A;  4QBM A;  4TZ2 A;  3S92 A;  4MSX A;  1HYI A;  5A7C A;  5C8G A;  4CFK A;  1F68 A;  3RTR B;  4UIX A;  3KQI A;  5E9L A;  4CCG X;  4PCI A;  5DFD A;  1JM7 B;  2LDR A;  1X4I A;  4I7D A;  3U5N A;  1WEM A;  5A81 A;  2EGP A;  1X4U A;  4UIY A;  2KWN A;  5CQ8 A;  2AN6 A;  5ENJ A;  4BW4 A;  3NXB A;  4DON A;  4YY6 A;  4ZQL A;  5EU1 A;  4YYD A;  3D7C A;  2QIC A;  2MIQ A;  3AQA A;  5DYA A;  4QR5 A;  3O35 A;  3MQM A;  5II1 A;  4Z1S A;  5A5P A;  5F62 A;  3UVW A;  5EWW A;  4FLP A;  3O33 A;  3FKM X;  2F6N A;  5I7X A;  4WIV A;  2CSZ A;  3UVY A;  2LXP C;  5EPS A;  4IC2 A;  2HDP A;  2M3H A;  3PUQ A;  5JWM A;  2K16 A;  3U5P A;  4QF3 A; 
#chains in the Genus database with same CATH topology
 4LKA A;  3GL6 A;  2VPE A;  2L75 A;  5ENF A;  4LYI A;  2E3K A;  4QNS A;  5F60 A;  4LJN A;  5LCW B;  2KWK A;  1V87 A;  2YHN A;  5D1M B;  5FG4 A;  4ZW1 A;  2KWJ A;  4HBY A;  3RPG C;  3Q2E A;  4MR3 A;  1N87 A;  1PUO A;  5KTU A;  2VP7 A;  4UIW A;  4LAD B;  4N4I A;  3UV4 A;  2FD4 A;  4CUR A;  2KE1 A;  4TYL A;  4BHW A;  4GB0 A;  4GNF A;  3SVF A;  5A85 A;  5EWV A;  5K3Q A;  1RMD A;  4PTB A;  4YH4 A;  5DLX A;  2K4D A;  4QSU A;  3FEH A;  3K2J A;  4J1P A;  4J0R A;  5CU8 A;  3DDT A;  4PPE A;  5D3R A;  2R0V A;  2R0Y A;  5KH7 A;  2GRC A;  3D1B A;  3V43 A;  5CQ4 A;  4A49 A;  2VNF A;  3DWD A;  2L5U A;  5TDR A;  5IBN A;  2YHO A;  2YEL A;  5C13 A;  3JUE A;  4AKG A;  3SOU A;  4LZR A;  4NR6 A;  4TTE A;  5C89 A;  3O34 A;  5KTX A;  5H9M A;  4A9F A;  5CQ3 A;  4C66 A;  4AI6 A;  4TZ8 A;  3LJW A;  2YDW A;  5DYC A;  4A9M A;  3N9O A;  3UV5 A;  5F63 A;  4RVR A;  4YK0 A;  5C85 A;  1DVP A;  3RPG B;  5HJC A;  2ZET C;  3ZYQ A;  2ECT A;  3NG2 A;  2OSS A;  3RCW A;  5LKX A;  2YQD A;  4GNE A;  5EK9 A;  4GND A;  5JG6 A;  3UW9 A;  1MM3 A;  3HTK C;  3MB3 A;  3HME A;  4XY8 A;  4E96 A;  2M1R A;  5E3G A;  4YYK A;  2XB1 A;  4IOQ A;  5F36 A;  3QZV A;  5DYX A;  5FE1 A;  4O78 A;  4NRB A;  4QR4 A;  2DAT A;  4AUQ B;  5FE7 A;  3MUK A;  4UI9 B;  2PUY A;  1Z2Q A;  4V3K C;  3UVX A;  5HRX A;  5ENG A;  1WUM A;  2RNW A;  3MHS A;  5F1L A;  4AYC B;  4ALH A;  4YYI A;  2RS9 B;  2RSD A;  4S3O B;  4A9E A;  3MDB C;  5C4Q A;  2FFW A;  3LRQ A;  2RNX A;  2D9E A;  4A9J A;  1WEP A;  3L11 A;  4NRC A;  4QUU A;  5FE8 A;  4YYG A;  5LKT A;  2ECI A;  4FK5 A;  3E2D A;  5DFB A;  5G05 B;  2YYN A;  4QUT A;  4MR6 A;  2LAU A;  3SUB A;  4YBT A;  5C7N A;  2FSA A;  2R10 A;  4CA1 A;  5DKH A;  1Z60 A;  4HXM A;  4YYH A;  4HXS A;  4QEU A;  2YUC A;  3O37 A;  3O36 A;  1DCQ A;  2DKW A;  4HXK A;  5FG5 A;  2YRE A;  1G25 A;  1WUG A;  2CON A;  4YAB A;  4X2I A;  2NAA A;  4IOR A;  4Q0N A;  3JVK A;  4P5O B;  5KHM A;  4AKH A;  1MBM A;  4KCX A;  5F1H A;  2XOC A;  4WZ0 A;  4R7E A;  5EWC A;  2LN0 A;  2YT5 A;  1WEQ A;  1WEO A;  2KRE A;  3N9Q A;  5FER A;  3P1D A;  3VKG A;  4Q0O A;  4YBS A;  5L8U A;  3P1F A;  4L58 A;  2K17 A;  2KKX A;  4ALG A;  4LK9 A;  4KV1 A;  3PHD A;  4Z0R A;  4LYW A;  2KGI A;  5DFC A;  3I2D A;  4O7F A;  5I3L A;  4QYD A;  1WIM A;  4TQN A;  2G43 A;  5E9I A;  5JI8 A;  2F6J A;  2E6S A;  3LQJ A;  5L97 A;  3L1Z B;  3T7L A;  3M99 A;  4O76 A;  5EV9 A;  3FM8 C;  5E3D A;  2YYR A;  2ECG A;  1WFK A;  4WHW A;  2D8U A;  4QY4 A;  1F62 A;  2FUU A;  2YEK A;  5I86 A;  5SVY A;  4B86 C;  3S91 A;  3FJU B;  5AME A;  4OGI A;  4QSS A;  3IU5 A;  5J3X A;  5A5R A;  2E61 A;  5TBN A;  5BT3 A;  5G4R A;  4BW3 A;  3Q2F A;  5HFR A;  5KU3 A;  2JRJ A;  5F25 A;  3EB6 A;  4O77 A;  3DPL R;  3LQH A;  4AVX A;  4J3I A;  4MR4 A;  4PKL A;  2DVQ A;  4MEO A;  5EI4 A;  4TU4 A;  3VK6 A;  4O71 A;  1WE9 A;  5FE6 A;  5KO4 A;  2EGM A;  5BT5 A;  5FB0 A;  2ECW A;  3SHB A;  5D25 A;  5CUD A;  5FBX A;  5FFW A;  5LUU A;  4NN2 A;  2MNZ A;  5EIS A;  3U5L A;  3FAO A;  5I88 A;  3KV5 A;  4MEQ A;  2LGV A;  4QB3 A;  2XEU A;  2EXU A;  4CUU A;  4LYS A;  1FBV A;  2LRI C;  2XP0 A;  4QSR A;  2EJN A;  4BW1 A;  2YUR A;  4LRG A;  5K29 A;  4NYW A;  2JUN A;  2JMD A;  2VJF A;  5AMF A;  4QYL A;  2DSM A;  4YYN A;  5HRV A;  3KV6 A;  4FJC A;  5DX4 A;  4Q6F A;  4UIV A;  4ZDT A;  5J0D A;  2EA6 A;  4NUC A;  2RO1 A;  4YC9 A;  4ZC9 A;  5FE2 A;  4N3W A;  2L80 A;  5D3S A;  3O47 A;  4FIP A;  4O7C A;  3ZPV E;  2VPG A;  2L0B A;  4R2Y A;  4O7B A;  1X0J A;  3JVL A;  3M7K A;  2XOY A;  3P1E A;  4QZS A;  5LVQ A;  2MA5 A;  1IYM A;  4HBX A;  5D3T A;  4CFL A;  5ENC A;  4A9I A;  5HLS A;  1VFY A;  5EP7 A;  3DWY A;  5HM0 A;  2KYU A;  2YEM A;  3G0J A;  3SVG A;  3O7A A;  4QSW A;  5E7D A;  2OWA A;  5E9M A;  3T6R A;  4NYX A;  4UYE A;  4KV4 A;  2L85 A;  4HXO A;  5A83 A;  2Y1M A;  5SVX A;  3PUR A;  5EIC A;  5II2 A;  5B78 A;  5FH6 A;  2I8N A;  5HFQ A;  4AKN A;  2E6R A;  2G45 A;  2LXH C;  2KKY A;  3KDE C;  3UVD A;  4A9O A;  5E9V A;  5B75 A;  4Z6I A;  2DVS A;  2LGG A;  4O72 A;  5CFW A;  5CQA A;  1JM4 B;  4QEW A;  4LC2 A;  4FO9 A;  2MUM A;  4OGJ A;  5EPR A;  3U5M A;  5A5O A;  5I1Q A;  5I89 A;  4N4F A;  4QSX A;  4XUA A;  1HYJ A;  5D24 A;  5IID A;  5FB1 A;  4A9H A;  2LV9 A;  5L96 A;  3ZPV 1;  5I83 A;  2XOZ A;  4QEV A;  4UYD A;  3DQV R;  5CZG A;  5E9K A;  3LQI A;  5EM3 A;  5CRZ A;  3U5O A;  4A9L A;  2G6Q A;  3M62 A;  5B76 A;  3ZVZ B;  5AD2 A;  2DX8 A;  3N9P A;  5D0C A;  1WGM A;  2MJV B;  5CTL A;  1E6I A;  4O7A A;  5ETD A;  5F61 A;  2R0S A;  4QC1 A;  5EQ1 A;  5SVI A;  3QZS A;  3ZTG A;  4CL9 A;  5FDZ A;  5E73 A;  2YSJ A;  5FE4 A;  5EA1 A;  5KH9 A;  3LVR E;  5D1K B;  4O62 A;  4O64 A;  2B0O E;  2CSY A;  5CQT A;  4J0S A;  3GG3 A;  2BAY A;  1Z6U A;  4GNG A;  5HEL A;  4UP0 A;  3H7H A;  5SVI B;  2OXQ C;  3JVJ A;  3EB5 A;  3DAI A;  2YW5 A;  4OUF A;  1U6G B;  5LKU A;  3LXJ A;  3D1D A;  3JVM A;  4N4H A;  4CUT A;  5IGN A;  4XI1 A;  4Z0O A;  2MNY A;  2OUO A;  2H60 A;  4TT6 A;  5A5S A;  4QQ4 A;  4CUP A;  5TAB A;  4TT4 A;  4CUQ A;  2LSP B;  4XYA A;  5L98 A;  5F5Z A;  3IHP A;  3T9K A;  2FUI A;  4O7E A;  3O70 A;  5A5N A;  4Z1Q A;  4IR3 A;  5EVA A;  4QSV A;  5FE9 A;  3FL2 A;  4QF2 A;  4MR5 A;  4AKI A;  2KU3 A;  5DLZ A;  3LJU X;  5HQ6 A;  5LJ1 A;  5I80 A;  5DY7 A;  5C11 A;  1FP0 A;  5FE0 A;  5L99 A;  3MXF A;  5F3A A;  5AIT A;  1VYX A;  5FH8 A;  2KGG A;  4MEN A;  5DKD A;  5LJ0 A;  4NR5 A;  4QR3 A;  5DBM A;  2CRR A;  2M85 A;  2I50 A;  3HCU A;  3N9M A;  4YYM A;  5CQ6 A;  1X4J A;  4WA6 A;  2YW8 A;  5L8T A;  2DVR A;  5CRM A;  2Y1N A;  4NXJ A;  5CQ7 A;  4CUS A;  5DKA A;  5DKC A;  5G0F A;  4UIT A;  5TRB A;  3ZNI A;  4MVT A;  4TT2 A;  5HRW A;  3ASL A;  1JM7 A;  2EOD A;  4N4G A;  5H1V A;  2HYE D;  4YAT A;  2KFT A;  2LGL A;  4WZ2 A;  5LKZ A;  1WEW A;  5B77 A;  5EWD A;  5FE5 A;  2E7N A;  4IR6 A;  4HXP A;  4PCE A;  2I7K A;  5TDW A;  5HCL A;  2WP2 A;  4TKP B;  4MEP A;  5LJ2 A;  2IDA A;  4WHU A;  2QIZ A;  2F42 A;  2QJ0 A;  5FE3 A;  2VJE A;  1LDK C;  3HMH A;  2KWO A;  3L1X A;  5D3J A;  5ETB A;  5DIN A;  5A82 A;  3HMF A;  5FG6 A;  5EGU A;  4PS5 A;  5LVR A;  4B7Y C;  4F52 B;  5H85 A;  5AD3 A;  5BT4 A;  2RR4 A;  5ENE A;  4NYV A;  2MT5 A;  2PNX A;  5ACY A;  2ECV A;  5IGL A;  4QSP A;  2VJE B;  5EPB A;  4H9D A;  5I7Y A;  3KNV A;  2M13 A;  5CGP A;  4Y03 A;  5E9Y A;  5D1L B;  5E74 A;  5CP5 A;  1EQF A;  4HBV A;  3MUL A;  5HEM A;  4NRA A;  5EYA F;  2D82 A;  4XUB A;  4UIU A;  5D26 A;  5DYU A;  1WES A;  4I7C A;  4C9Z A;  3U5J A;  5ENI A;  5HQ7 A;  3ONI A;  1ZBD B;  2YVR A;  1WEV A;  5AIU A;  3N9N A;  1WEN A;  1ZS5 A;  2CT2 A;  4NQN A;  3Q1D A;  4X3G A;  2VJF B;  4NR9 A;  2L7P A;  4BBQ A;  2KTB B;  1XWH A;  5KH3 A;  2D8S A;  2JMJ A;  5B79 A;  1WIL A;  3LDY A;  5DW2 A;  2YSM A;  4NUD A;  5ENH A;  3ERR A;  2JMI A;  4LDF A;  2DVV A;  2RNY A;  5IG6 A;  5CY9 A;  4HXR A;  4A9K A;  4QC3 A;  5CS8 A;  3TLP A;  4F3I A;  4IC3 A;  4TS8 A;  3ZVY A;  5IGK A;  3IU6 A;  5FFY A;  1JOC A;  3SOX A;  3P5O A;  4R8P K;  2ECJ A;  3N9L A;  2DWW A;  2KR4 A;  4C67 A;  2UZG A;  3HCT A;  5DW1 A;  5ENB A;  2DJA A;  2L5E A;  5F2P A;  1CHC A;  5I29 A;  5CUB A;  4NS5 A;  4O70 A;  3C6W A;  4S3O C;  4LZ2 A;  4O74 A;  4QST A;  5G4S A;  5FFV A;  5D3L A;  4CLB A;  5D3H A;  4IR4 A;  4HXL A;  4NQM A;  5A5Q A;  3FAN A;  4YAX A;  4BW2 A;  2Y43 A;  4YH3 A;  4V3L C;  4A4B A;  4Z6H A;  3U5K A;  2E7O A;  3UV2 A;  2N9G A;  2WP1 A;  5CUA A;  5CUE A;  4NR8 A;  4BJX A;  5H1U A;  2RFJ A;  2VPD A;  5EWH A;  5G04 B;  1WEE A;  5FEY A;  4NR4 A;  2MA6 A;  2YQM A;  4TU6 A;  4YYJ A;  4A4C A;  5E0R A;  2MD7 B;  2MKE A;  5CQ5 A;  4W4U A;  4HXN A;  5D3N A;  1K2F A;  4LR6 A;  2NXB A;  5D3P A;  2RI7 A;  5I40 A;  5B8D A;  4A9N A;  4UP5 A;  4QSQ A;  4Z93 A;  1VD4 A;  4GPJ A;  2L84 A;  4WZ3 B;  4AYC A;  4LZS A;  2KIZ A;  3SVH A;  4UIZ A;  1BOR A;  3QZT A;  2LQ6 A;  3PLW A;  4YBM A;  1LDJ B;  3MHH A;  4A0C D;  3MB4 A;  1JSP B;  2CKL A;  5FH7 A;  1T1H A;  4NUE A;  4IR5 A;  3P1C A;  2C2L A;  5HEN A;  4NR7 A;  2M6M A;  1E4U A;  4I7B A;  4OGE A;  4YAD A;  2JM3 A;  3C5K A;  3HCS A;  5TB6 A;  1MM2 A;  4UYF A;  4IOO A;  4AP4 A;  2G4A A;  4UYG A;  3SOW A;  2CKL B;  2K1J A;  3M63 A;  2L43 A;  2LGK A;  3VKH A;  4XY9 A;  5CPE A;  4LLB A;  3GV4 A;  2C2V S;  4UYF B;  2H0D A;  2VPB A;  5KTW A;  1N72 A;  5COI A;  5H1T A;  4L7X A;  3ZYU A;  5CUG A;  5TCM A;  4ZUX U;  2YQL A;  5HQ5 A;  3AAD A;  4O75 A;  4HBW A;  5C87 A;  5IGM A;  4PY6 A;  5CUC A;  4YY4 A;  1WEU A;  2YU4 A;  2MD8 C;  2H0D B;  3I3J A;  4UYH A;  2OO1 A;  2IQJ A;  2ECN A;  3G0L A;  5D7X A;  4QBM A;  4TZ2 A;  3S92 A;  4MSX A;  1HYI A;  5A7C A;  5C8G A;  4CFK A;  1F68 A;  3RTR B;  4UIX A;  3KQI A;  5E9L A;  4CCG X;  2P57 A;  4PCI A;  5DFD A;  1JM7 B;  2LDR A;  1X4I A;  4I7D A;  3U5N A;  1WEM A;  5A81 A;  2CSV A;  2EGP A;  1X4U A;  4UIY A;  2KWN A;  5CQ8 A;  2AN6 A;  5ENJ A;  4BW4 A;  1ZKR A;  3NXB A;  4DON A;  4YY6 A;  3LVQ E;  4ZQL A;  5EU1 A;  4YYD A;  3D7C A;  2QIC A;  4OGC A;  2MIQ A;  3AQA A;  5DYA A;  4QR5 A;  3O35 A;  3MQM A;  5II1 A;  4Z1S A;  2CRW A;  5A5P A;  5F62 A;  3UVW A;  5EWW A;  4FLP A;  3O33 A;  3FKM X;  2F6N A;  5I7X A;  4WIV A;  2CSZ A;  3UVY A;  2LXP C;  5EPS A;  4IC2 A;  2HDP A;  2M3H A;  3PUQ A;  4F1P A;  5JWM A;  2K16 A;  3U5P A;  4QF3 A; 
#chains in the Genus database with same CATH homology
 4LKA A;  3GL6 A;  2VPE A;  2L75 A;  5ENF A;  4LYI A;  2E3K A;  4QNS A;  5F60 A;  4LJN A;  5LCW B;  2KWK A;  1V87 A;  2YHN A;  5D1M B;  5FG4 A;  4ZW1 A;  2KWJ A;  4HBY A;  3RPG C;  3Q2E A;  4MR3 A;  1N87 A;  2VP7 A;  5KTU A;  4LAD B;  4UIW A;  4N4I A;  3UV4 A;  4CUR A;  2KE1 A;  4TYL A;  4BHW A;  4GB0 A;  4GNF A;  3SVF A;  5A85 A;  5EWV A;  1RMD A;  4PTB A;  4YH4 A;  5DLX A;  2K4D A;  4QSU A;  3K2J A;  4J1P A;  4J0R A;  5CU8 A;  4PPE A;  5D3R A;  2R0V A;  2R0Y A;  5KH7 A;  2GRC A;  3V43 A;  5CQ4 A;  4A49 A;  2VNF A;  2L5U A;  5TDR A;  5IBN A;  2YHO A;  2YEL A;  5C13 A;  3SOU A;  4LZR A;  4NR6 A;  4TTE A;  5C89 A;  3O34 A;  5KTX A;  5H9M A;  4A9F A;  5CQ3 A;  4C66 A;  3N9O A;  4TZ8 A;  3LJW A;  2YDW A;  5DYC A;  4A9M A;  3UV5 A;  5F63 A;  4RVR A;  4YK0 A;  5C85 A;  1DVP A;  3RPG B;  5HJC A;  2ZET C;  3ZYQ A;  2ECT A;  3NG2 A;  2OSS A;  3RCW A;  5LKX A;  2YQD A;  4GNE A;  5EK9 A;  4GND A;  5JG6 A;  3UW9 A;  1MM3 A;  3HTK C;  3MB3 A;  3HME A;  4XY8 A;  4E96 A;  2M1R A;  5E3G A;  4YYK A;  2XB1 A;  4IOQ A;  5F36 A;  3QZV A;  5DYX A;  5FE1 A;  4O78 A;  4NRB A;  4QR4 A;  2DAT A;  4AUQ B;  5FE7 A;  3MUK A;  4UI9 B;  2PUY A;  1Z2Q A;  4V3K C;  3UVX A;  5HRX A;  5ENG A;  1WUM A;  2RNW A;  3MHS A;  5F1L A;  4AYC B;  4ALH A;  4YYI A;  2RS9 B;  2RSD A;  4S3O B;  4A9E A;  5C4Q A;  3LRQ A;  2RNX A;  2D9E A;  4A9J A;  1WEP A;  3L11 A;  4NRC A;  4QUU A;  5FE8 A;  4YYG A;  5LKT A;  2ECI A;  4FK5 A;  5DFB A;  5G05 B;  2YYN A;  4QUT A;  4MR6 A;  4YBT A;  5C7N A;  2FSA A;  2R10 A;  4CA1 A;  5DKH A;  1Z60 A;  4HXM A;  4YYH A;  4HXS A;  4QEU A;  2YUC A;  3O37 A;  3O36 A;  2DKW A;  4HXK A;  5FG5 A;  2YRE A;  1G25 A;  1WUG A;  4YAB A;  4X2I A;  2NAA A;  4IOR A;  4Q0N A;  3JVK A;  4P5O B;  5KHM A;  4KCX A;  5F1H A;  4WZ0 A;  4R7E A;  5EWC A;  2LN0 A;  2YT5 A;  1WEQ A;  1WEO A;  2KRE A;  3N9Q A;  5FER A;  3P1D A;  4Q0O A;  4YBS A;  5L8U A;  3P1F A;  4L58 A;  2K17 A;  4ALG A;  4LK9 A;  4KV1 A;  3PHD A;  4LYW A;  2KGI A;  5DFC A;  3I2D A;  4O7F A;  5I3L A;  4QYD A;  1WIM A;  4TQN A;  2G43 A;  5E9I A;  5JI8 A;  2F6J A;  2E6S A;  3LQJ A;  5L97 A;  3L1Z B;  3T7L A;  3M99 A;  4O76 A;  5EV9 A;  5E3D A;  2YYR A;  2ECG A;  1WFK A;  4WHW A;  4QY4 A;  1F62 A;  2FUU A;  2YEK A;  5I86 A;  4B86 C;  3S91 A;  5AME A;  4OGI A;  4QSS A;  3IU5 A;  5J3X A;  5A5R A;  5TBN A;  5BT3 A;  5G4R A;  4BW3 A;  3Q2F A;  5HFR A;  5KU3 A;  2JRJ A;  5F25 A;  3EB6 A;  4O77 A;  3DPL R;  3LQH A;  4AVX A;  4J3I A;  4MR4 A;  4PKL A;  2DVQ A;  4MEO A;  5EI4 A;  4TU4 A;  3VK6 A;  4O71 A;  1WE9 A;  5FE6 A;  5KO4 A;  5BT5 A;  5FB0 A;  2ECW A;  3SHB A;  5D25 A;  5CUD A;  5FBX A;  5FFW A;  5LUU A;  4NN2 A;  2MNZ A;  5EIS A;  3U5L A;  5I88 A;  3KV5 A;  4MEQ A;  2LGV A;  4QB3 A;  2XEU A;  2LRI C;  4CUU A;  4LYS A;  1FBV A;  4QSR A;  4BW1 A;  2YUR A;  4LRG A;  5K29 A;  4NYW A;  2JMD A;  2VJF A;  5AMF A;  4QYL A;  4YYN A;  5HRV A;  3KV6 A;  4FJC A;  5DX4 A;  4Q6F A;  4UIV A;  4ZDT A;  5J0D A;  2EA6 A;  4NUC A;  2RO1 A;  4YC9 A;  4ZC9 A;  5FE2 A;  4N3W A;  2L80 A;  5D3S A;  3ZPV E;  4FIP A;  4O7C A;  2VPG A;  2L0B A;  4R2Y A;  4O7B A;  1X0J A;  3JVL A;  3P1E A;  4QZS A;  5LVQ A;  2MA5 A;  1IYM A;  4HBX A;  5D3T A;  4CFL A;  5ENC A;  4A9I A;  5HLS A;  1VFY A;  5EP7 A;  3DWY A;  5HM0 A;  2KYU A;  2YEM A;  3G0J A;  3SVG A;  3O7A A;  4QSW A;  5E7D A;  5E9M A;  3T6R A;  4NYX A;  4UYE A;  4KV4 A;  2L85 A;  4HXO A;  5A83 A;  2Y1M A;  3PUR A;  5EIC A;  5II2 A;  5B78 A;  5FH6 A;  2I8N A;  5HFQ A;  4AKN A;  2E6R A;  2G45 A;  2LXH C;  3UVD A;  4A9O A;  5E9V A;  5B75 A;  4Z6I A;  2DVS A;  2LGG A;  4O72 A;  5CFW A;  5CQA A;  1JM4 B;  4QEW A;  4LC2 A;  4FO9 A;  2MUM A;  4OGJ A;  5EPR A;  3U5M A;  5A5O A;  5I1Q A;  5I89 A;  4N4F A;  4QSX A;  4XUA A;  1HYJ A;  5D24 A;  5IID A;  5FB1 A;  4A9H A;  2LV9 A;  5L96 A;  3ZPV 1;  5I83 A;  4QEV A;  4UYD A;  3DQV R;  5CZG A;  5E9K A;  3LQI A;  5EM3 A;  5CRZ A;  3U5O A;  4A9L A;  2G6Q A;  3M62 A;  5B76 A;  3ZVZ B;  5AD2 A;  2DX8 A;  3N9P A;  5D0C A;  1WGM A;  2MJV B;  5CTL A;  1E6I A;  4O7A A;  5ETD A;  5F61 A;  2R0S A;  4QC1 A;  5EQ1 A;  3QZS A;  3ZTG A;  4CL9 A;  5FDZ A;  5E73 A;  2YSJ A;  5FE4 A;  5EA1 A;  5KH9 A;  5D1K B;  4O64 A;  2CSY A;  5CQT A;  4J0S A;  3GG3 A;  2BAY A;  1Z6U A;  4GNG A;  5HEL A;  4UP0 A;  2OXQ C;  3JVJ A;  3EB5 A;  3DAI A;  2YW5 A;  4OUF A;  1U6G B;  5LKU A;  3LXJ A;  3JVM A;  4N4H A;  5IGN A;  4CUT A;  4XI1 A;  2MNY A;  2OUO A;  2H60 A;  4TT6 A;  5A5S A;  4CUP A;  5TAB A;  4TT4 A;  4CUQ A;  2LSP B;  4XYA A;  5L98 A;  5F5Z A;  3IHP A;  2FUI A;  4O7E A;  3O70 A;  5A5N A;  4Z1Q A;  4IR3 A;  5EVA A;  4QSV A;  5FE9 A;  3FL2 A;  4QF2 A;  4MR5 A;  2KU3 A;  5DLZ A;  5HQ6 A;  5LJ1 A;  5I80 A;  5DY7 A;  5C11 A;  1FP0 A;  5FE0 A;  5L99 A;  3MXF A;  5F3A A;  5AIT A;  1VYX A;  5FH8 A;  2KGG A;  4MEN A;  5DKD A;  5LJ0 A;  4NR5 A;  4QR3 A;  5DBM A;  2M85 A;  2I50 A;  3HCU A;  3N9M A;  4YYM A;  5CQ6 A;  1X4J A;  4WA6 A;  2YW8 A;  5L8T A;  2DVR A;  5CRM A;  2Y1N A;  4NXJ A;  5CQ7 A;  4CUS A;  5DKA A;  5DKC A;  5G0F A;  4UIT A;  5TRB A;  3ZNI A;  4MVT A;  4TT2 A;  5HRW A;  3ASL A;  1JM7 A;  2EOD A;  4N4G A;  5H1V A;  2HYE D;  4YAT A;  2KFT A;  2LGL A;  4WZ2 A;  5LKZ A;  1WEW A;  5B77 A;  5EWD A;  5FE5 A;  2E7N A;  4IR6 A;  4HXP A;  4PCE A;  2I7K A;  5TDW A;  5HCL A;  2WP2 A;  4TKP B;  4MEP A;  5LJ2 A;  2IDA A;  4WHU A;  2QIZ A;  2F42 A;  2QJ0 A;  5FE3 A;  2VJE A;  1LDK C;  3HMH A;  2KWO A;  3L1X A;  5D3J A;  5ETB A;  5DIN A;  5A82 A;  3HMF A;  5FG6 A;  5EGU A;  4PS5 A;  5LVR A;  4B7Y C;  4F52 B;  5H85 A;  5AD3 A;  5BT4 A;  5ENE A;  4NYV A;  2MT5 A;  2PNX A;  5ACY A;  2ECV A;  5IGL A;  4QSP A;  2VJE B;  5EPB A;  5I7Y A;  3KNV A;  5CGP A;  4Y03 A;  5E9Y A;  5D1L B;  5E74 A;  5CP5 A;  1EQF A;  4HBV A;  3MUL A;  5HEM A;  4NRA A;  5EYA F;  2D82 A;  4XUB A;  4UIU A;  5D26 A;  5DYU A;  1WES A;  4I7C A;  4C9Z A;  3U5J A;  5ENI A;  5HQ7 A;  3ONI A;  1ZBD B;  1WEV A;  5AIU A;  3N9N A;  1WEN A;  1ZS5 A;  2CT2 A;  4NQN A;  4X3G A;  2VJF B;  4NR9 A;  4BBQ A;  2KTB B;  1XWH A;  5KH3 A;  2D8S A;  2JMJ A;  5B79 A;  1WIL A;  5DW2 A;  2YSM A;  4NUD A;  5ENH A;  2JMI A;  4LDF A;  2DVV A;  2RNY A;  5IG6 A;  5CY9 A;  4HXR A;  4A9K A;  4QC3 A;  5CS8 A;  3TLP A;  4F3I A;  4IC3 A;  4TS8 A;  3ZVY A;  5IGK A;  3IU6 A;  5FFY A;  1JOC A;  3SOX A;  3P5O A;  4R8P K;  2ECJ A;  3N9L A;  2DWW A;  2KR4 A;  4C67 A;  2UZG A;  3HCT A;  5DW1 A;  5ENB A;  2L5E A;  5F2P A;  1CHC A;  5I29 A;  5CUB A;  4NS5 A;  4O70 A;  3C6W A;  4S3O C;  4LZ2 A;  4O74 A;  4QST A;  5G4S A;  5FFV A;  5D3L A;  4CLB A;  5D3H A;  4IR4 A;  4HXL A;  4NQM A;  5A5Q A;  4YAX A;  4BW2 A;  2Y43 A;  4YH3 A;  4V3L C;  4A4B A;  4Z6H A;  3U5K A;  2E7O A;  3UV2 A;  2N9G A;  2WP1 A;  5CUA A;  5CUE A;  4NR8 A;  4BJX A;  5H1U A;  2RFJ A;  2VPD A;  5EWH A;  5G04 B;  1WEE A;  5FEY A;  4NR4 A;  2MA6 A;  2YQM A;  4TU6 A;  4YYJ A;  4A4C A;  5E0R A;  2MD7 B;  5CQ5 A;  4W4U A;  4HXN A;  5D3N A;  1K2F A;  4LR6 A;  2NXB A;  5D3P A;  2RI7 A;  5I40 A;  5B8D A;  4A9N A;  4UP5 A;  4QSQ A;  4Z93 A;  1VD4 A;  4GPJ A;  2L84 A;  4WZ3 B;  4AYC A;  4LZS A;  2KIZ A;  3SVH A;  4UIZ A;  1BOR A;  3QZT A;  2LQ6 A;  4YBM A;  1LDJ B;  3MHH A;  4A0C D;  3MB4 A;  1JSP B;  2CKL A;  5FH7 A;  1T1H A;  4NUE A;  4IR5 A;  3P1C A;  2C2L A;  5HEN A;  4NR7 A;  2M6M A;  1E4U A;  4I7B A;  4YAD A;  3HCS A;  3C5K A;  5TB6 A;  1MM2 A;  4UYF A;  4IOO A;  4AP4 A;  2G4A A;  4UYG A;  3SOW A;  2CKL B;  2K1J A;  3M63 A;  2L43 A;  2LGK A;  4XY9 A;  5CPE A;  4LLB A;  3GV4 A;  2C2V S;  4UYF B;  2H0D A;  2VPB A;  5KTW A;  1N72 A;  5COI A;  5H1T A;  4L7X A;  3ZYU A;  5CUG A;  5TCM A;  4ZUX U;  2YQL A;  5HQ5 A;  3AAD A;  4O75 A;  4HBW A;  5C87 A;  5IGM A;  4PY6 A;  5CUC A;  4YY4 A;  1WEU A;  2YU4 A;  2MD8 C;  2H0D B;  3I3J A;  4UYH A;  2OO1 A;  2ECN A;  3G0L A;  5D7X A;  4QBM A;  4TZ2 A;  3S92 A;  4MSX A;  1HYI A;  5A7C A;  5C8G A;  4CFK A;  1F68 A;  3RTR B;  4UIX A;  3KQI A;  5E9L A;  4CCG X;  4PCI A;  5DFD A;  1JM7 B;  2LDR A;  1X4I A;  4I7D A;  3U5N A;  1WEM A;  5A81 A;  2EGP A;  1X4U A;  4UIY A;  2KWN A;  5CQ8 A;  2AN6 A;  5ENJ A;  4BW4 A;  3NXB A;  4DON A;  4YY6 A;  4ZQL A;  5EU1 A;  4YYD A;  3D7C A;  2QIC A;  2MIQ A;  3AQA A;  5DYA A;  4QR5 A;  3O35 A;  3MQM A;  5II1 A;  4Z1S A;  5A5P A;  5F62 A;  3UVW A;  5EWW A;  4FLP A;  3O33 A;  3FKM X;  2F6N A;  5I7X A;  4WIV A;  2CSZ A;  3UVY A;  2LXP C;  5EPS A;  4IC2 A;  2HDP A;  2M3H A;  3PUQ A;  5JWM A;  2K16 A;  3U5P A;  4QF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...