3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
b'DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
2R0VA 4X2IA 2KTBB 5CU8A 5I1QA 2AN6A 4UIUA 2EGPA 4O64A 4NRBA 4BBQA 2GRCA 4Q6FA 1JSPB 4NUEA 2YT5A 4KV4A 4C66A 5C87A 5EGUA 5EU1A 5C89A 2Y1NA 3DPLR 4GB0A 4YBMA 5DYXA 5H9MA 4BHWA 2ECJA 2RSDA 4N4GA 3N9OA 1WEMA 4C67A 4QEUA 3JVKA 4ZUXU 4YC9A 5L98A 1K2FA 4LZ2A 3UVXA 3NG2A 5DYAA 2C2VS 1WFKA 5E0RA 5F61A 3UVWA 2VPDA 2RFJA 5KTWA 3UV2A 5I7YA 4OUFA 3C5KA 5E3DA 3JVMA 5I83A 1FBVA 5F2PA 1X4UA 3QZSA 2VJEA 4WHUA 1HYIA 2F6NA 1LDJB 5IGKA 4A9JA 4QR5A 5CQTA 1EQFA 3U5PA 1JM4B 4J1PA 3VK6A 4Y03A 4TQNA 2I7KA 2KFTA 4TS8A 1WESA 5LVQA 2C2LA 1XWHA 3RPGC 5HRVA 4Z6IA 5CFWA 3PURA 2DX8A 5B78A 5LJ0A 3IU5A 1CHCA 1X4JA 5DBMA 4GNFA 4QB3A 2JMJA 5G0FA 4CLBA 5E9IA 3U5KA 1WEVA 5EV9A 2LV9A 4I7BA 4TTEA 2OSSA 4XYAA 4A4BA 4AUQB 5B8DA 3GG3A 4XY9A 4TZ8A 4J0RA 4LYSA 4S3OB 5D0CA 2MD7B 3M62A 4AYCA 5D24A 3O70A 3ASLA 5CUAA 5E73A 4BW3A 5BT3A 3T6RA 2VJEB 5B75A 4AKNA 3S92A 5K29A 4HXMA 3HMEA 2PUYA 2VJFB 4R2YA 5CQ3A 5EISA 5EWWA 4W4UA 4YYIA 4HBWA 3UW9A 4PTBA 2XB1A 5ENEA 4NXJA 4QBMA 5C8GA 2D8SA 2KWNA 1WEUA 5D7XA 2FUIA 5EWCA 4YK0A 4QUUA 2LXPC 5ETBA 4NR6A 1FP0A 5C7NA 5BT4A 2ECTA 4LKAA 5DLZA 5DFCA 4O76A 3G0LA 4NYXA 2LGVA 2L75A 4CUSA 1IYMA 4AVXA 5DKCA 3U5MA 1WEOA 4YY4A 4Z1SA 3IHPA 5LVRA 1E6IA 3O36A 5TB6A 5E9MA 5D3SA 4NQMA 4PPEA 4CA1A 4FK5A 2LN0A 3P5OA 3KV6A 2R0SA 4IOQA 4TZ2A 5F1HA 2MJVB 2E6SA 2KWOA 2YQMA 1BORA 2ECIA 4MSXA 1N72A 3MQMA 2I8NA 1T1HA 5J0DA 2VPBA 4QYLA 4XI1A 4A9EA 3EB5A 1WIMA 4A9HA 4HXSA 4FO9A 3RPGB 3EB6A 5FE8A 2KE1A 4QSPA 3MUKA 5FE1A 2LRIC 2YQLA 5JWMA 5HQ7A 2M85A 3N9LA 4AP4A 5EPSA 5HM0A 4HXRA 4QZSA 2K4DA 1WEPA 3D7CA 5AD2A 3DQVR 5ENHA 3LQIA 4UP5A 3ZYUA 5FE4A 4CL9A 4IOOA 4BW4A 3ZVYA 4YADA 5A5SA 3O37A 3O33A 5FG4A 1N87A 2E7NA 4I7CA 1WE9A 2MUMA 2LGKA 3DAIA 1WUGA 4O77A 5DKHA 4V3KC 5C11A 2RI7A 4UI9B 5IG6A 3N9QA 4UIXA 4N4IA 4LDFA 5DFBA 2F42A 3FKMX 4QSVA 4UIVA 4XY8A 2N9GA 5KH7A 1G25A 4TYLA 3U5OA 4R8PK 3AADA 4LR6A 4LYIA 4NRAA 2JMDA 2WP1A 4O78A 1WENA 2ECGA 4Z1QA 4NUDA 5KH3A 5FH8A 4R7EA 4QEWA 2G4AA 5CY9A 5FFVA 4F3IA 1VD4A 5D3PA 5F25A 4LZSA 4A9MA 3HCUA 4FLPA 4ALGA 3HMFA 5CTLA 4O7EA 2K16A 5D26A 1JM7A 5HRWA 4MEOA 2L0BA 3MULA 4YH3A 4UYEA 4LK9A 4QF2A 4QNSA 4NR5A 5CP5A 3O7AA 2ECNA 5L97A 4IR4A 5D1LB 4PY6A 2E3KA 5DYUA 2CT2A 5II1A 1Z2QA 2KU3A 5F1LA 2YQDA 2H0DA 5FERA 2YUCA 4PKLA 2VPEA 3U5LA 5FG6A 3I2DA 2YEKA 3QZTA 3UVYA 4HXPA 2YDWA 3JVLA 3HCTA 2ECVA 3N9NA 5D3RA 2Y43A 2K17A 4ZDTA 3P1CA 5G4SA 3MB3A 5FEYA 5FB1A 5DX4A 2WP2A 3MHSA 4O71A 2L43A 5D3JA 5A83A 3N9PA 3LQJA 2RS9B 4YBSA 4HXOA 5D3LA 4A9LA 5LKUA 3ZTGA 4QSQA 4UIYA 3L1XA 4LJNA 4QSSA 4UITA 4QSUA 5JI8A 1LDKC 5I40A 1WEQA 2CSZA 2HDPA 2PNXA 4A9FA 5E7DA 4X3GA 3ZPV1 4YY6A 2E7OA 2LXHC 5G04B 2QICA 4IC2A 2YSMA 4LADB 2G43A 5A5OA 2NXBA 1VFYA 2KGIA 3S91A 4Q0OA 5D25A 5TABA 4UYGA 2IDAA 4F52B 5JG6A 5LJ2A 4PS5A 3UVDA 3AQAA 5EP7A 5I7XA 5IGNA 4GNGA 5F5ZA 2R10A 5I88A 5CUDA 4UYFA 4TU4A 2YW8A 4BW2A 2G45A 4YAXA 4NR9A 4HBVA 2MD8C 3M63A 1JOCA 1X4IA 4QSTA 3KQIA 2FSAA 5EM3A 3HTKC 1F62A 4HBYA 4MENA 2F6JA 4TT4A 5I89A 4A0CD 4B86C 5CUCA 5L8TA 4NRCA 4LC2A 4AYCB 5CQ8A 5ENFA 1WGMA 3LXJA 4QSRA 3MXFA 5A5RA 2LGLA 2YEMA 5HLSA 2L84A 3K2JA 4MVTA 4O7BA 4HXNA 2M6MA 1MM3A 4QY4A 3V43A 5G4RA 4FJCA 5A85A 5A81A 2MA6A 2KR4A 3PUQA 4CUTA 4LYWA 2DVVA 5HEMA 4NUCA 5CQ7A 4YYMA 2YU4A 2FUUA 2BAYA 2RNWA 2RO1A 5EWHA 5IGMA 5KHMA 4IC3A 4UYFB 2YELA 3NXBA 5ENIA 2KREA 4A4CA 4QEVA 2UZGA 1WILA 4YYHA 5LUUA 2ZETC 5C13A 2EA6A 5LKXA 2YW5A 5IGLA 4QUTA 5IBNA 2MIQA 2QJ0A 2YYRA 3SOUA 3N9MA 5BT5A 2KYUA 5LCWB 3I3JA 4J0SA 2RNYA 4WZ0A 1HYJA 5CQAA 2I50A 4QC1A 4CCGX 3JVJA 4UIWA 5F36A 2YHNA 1U6GB 4NYVA 5HJCA 5D1KB 1ZS5A 5DKDA 4QF3A 5G05B 3SOXA 5TBNA 5EYAF 5I80A 3SVFA 2YURA 4N3WA 3ZVZB 4CFKA 5AIUA 3UV5A 3SVHA 5FBXA 2ECWA 4GNDA 4WIVA 5FFWA 1RMDA 5L99A 5TCMA 5HELA 2VNFA 4NYWA 4UYHA 4O7CA 4YATA 5H1VA 2HYED 3SVGA 4QYDA 5CRMA 4BW1A 5E9VA 4GNEA 4B7YC 5FE7A 5EPBA 5FE2A 5A82A 4NR8A 1Z6UA 2L5UA 3C6WA 5A5QA 2MNZA 5A7CA 4OGIA 2KWJA 4YH4A 2OO1A 5EPRA 5L8UA 5F60A 2VP7A 5HRXA 4XUBA 4ALHA 4Q0NA 3TLPA 2DATA 3U5JA 4Z6HA 2CSYA 5EICA 4IORA 2E6RA 5II2A 5CGPA 2LDRA 3QZVA 3KNVA 4L7XA 5EWDA 2YYNA 4ZC9A 4YYDA 1DVPA 2JMIA 4LZRA 5EQ1A 4MR6A 5KU3A 3LRQA 4DONA 5CS8A 1F68A 1WEEA 4TT6A 4YYGA 4TT2A 4PCEA 5CZGA 4CFLA 4NN2A 2YHOA 3MHHA 3T7LA 5ENBA 4CUPA 4IR3A 3LJWA 2H60A 4A49A 2M3HA 4NR4A 2K1JA 4CURA 5EVAA 5EWVA 4YYJA 2XEUA 3GV4A 4QR3A 5AMEA 4KCXA 3O35A 4ZW1A 5FDZA 5A5PA 2VJFA 4TU6A 4FIPA 5CQ6A 1JM7B 5HQ6A 5DINA 2D82A 1V87A 2Y1MA 5FH6A 2DKWA 5CUGA 5A5NA 5DLXA 5COIA 5F62A 2MT5A 2YREA 5L96A 3RCWA 5HFQA 2YSJA 4TKPB 5E74A 3P1EA 3ONIA 2R0YA 5ENGA 2H0DB 3P1FA 4WZ3B 3Q2EA 4Z93A 4MEQA 4I7DA 5FE6A 1ZBDB 5TDRA 3UV4A 4BJXA 1E4UA 2RNXA 3PHDA 4HXLA 5DY7A 4YYKA 5KH9A 3O34A 5E9KA 4C9ZA 2L5EA 5KTXA 5D3HA 4A9NA 5LJ1A 5FFYA 4NQNA 4QR4A 2G6QA 4UYDA 2L80A 4XUAA 3ZNIA 5I3LA 1MM2A 4O7FA 5CQ4A 4CUQA 5IIDA 3RTRB 2NAAA 5E9LA 2QIZA 4QC3A 5H1TA 5CRZA 4RVRA 3DWYA 5H85A 3KV5A 5ETDA 3P1DA 5DKAA 3HCSA 5TDWA 5AD3A 5EK9A 4MR3A 3SOWA 2CKLA 5HCLA 4ZQLA 5J3XA 5AMFA 2KGGA 2MA5A 5DW2A 2KIZA 3Q2FA 5HENA 2DVSA 4UIZA 3M99A 4LRGA 5EI4A 5CQ5A 2L85A 3MB4A 4O70A 5F63A 2DVRA 4MR4A 3IU6A 4O72A 4O7AA 4OGJA 4WHWA 5DFDA 5FB0A 5EA1A 2M1RA 4N4HA 5HFRA 2LSPB 4P5OB 4A9KA 5B79A 5FE0A 4J3IA 5ENJA 4O74A 5ACYA 4NS5A 2OUOA 4YABA 5C85A 4KV1A 2VPGA 5C4QA 5DYCA 3ZPVE 1WEWA 5E3GA 5KO4A 4QSWA 4L58A 5AITA 4E96A 5CUEA 5D3TA 3ZYQA 4MR5A 3GL6A 5FE3A 2EODA 4O75A 3HMHA 4WZ2A 5HQ5A 3L11A 4MEPA 4V3LC 4GPJA 5ENCA 4YYNA 5I29A 1X0JA 5D3NA 4A9OA 4WA6A 5FH7A 4UP0A 2CKLB 5B77A 5F3AA 5CUBA 2D9EA 5TRBA 4PCIA 5H1UA 5E9YA 5FG5A 5B76A 3FL2A 4CUUA 2DVQA 2KWKA 4IR5A 3L1ZB 4S3OC 2LGGA 3LQHA 4IR6A 1Z60A 5LKTA 5CPEA 3G0JA 5DW1A 4YBTA 1VYXA 1WUMA 4N4FA 2DWWA 4QSXA 5FE9A 3SHBA 5LKZA 3U5NA 2MNYA 4HXKA 5D1MB 4LLBA 4HBXA 4A9IA 2JRJA 5I86A 2LQ6A 4NR7A 5KTUA 5FE5A 2OXQC
chains in the Genus database with same CATH superfamily
2R0VA 4X2IA 2KTBB 5CU8A 5I1QA 2AN6A 4UIUA 2EGPA 4O64A 4NRBA 4BBQA 2GRCA 4Q6FA 1JSPB 4NUEA 2E61A 2YT5A 4KV4A 4C66A 5C87A 5EGUA 5EU1A 5C89A 2Y1NA 3DPLR 4GB0A 4YBMA 5DYXA 5H9MA 4BHWA 2ECJA 2RSDA 4N4GA 3N9OA 1WEMA 4C67A 4QEUA 3JVKA 4ZUXU 4YC9A 5L98A 1K2FA 4LZ2A 2CONA 2IQJA 3UVXA 2M13A 3NG2A 5DYAA 2C2VS 1WFKA 5E0RA 5F61A 3UVWA 2VPDA 4OGCA 2RFJA 5KTWA 3D1BA 3UV2A 5I7YA 2MKEA 4OUFA 3C5KA 5E3DA 3JVMA 5I83A 1FBVA 5F2PA 1X4UA 3QZSA 2VJEA 4WHUA 1HYIA 2F6NA 1LDJB 5IGKA 4A9JA 4QR5A 5CQTA 1EQFA 3U5PA 1JM4B 4J1PA 5SVXA 4Y03A 2KKYA 3VK6A 4TQNA 3LVQE 2I7KA 2KFTA 4TS8A 1WESA 5LVQA 2C2LA 1XWHA 3RPGC 5HRVA 4Z6IA 5CFWA 3PURA 2DX8A 5B78A 5LJ0A 3IU5A 1CHCA 3KDEC 1X4JA 5DBMA 4GNFA 4QB3A 2JMJA 5G0FA 4CLBA 5E9IA 3U5KA 1WEVA 5EV9A 2LV9A 2JUNA 4I7BA 4TTEA 2OSSA 4XYAA 4A4BA 4AUQB 5B8DA 3GG3A 4XY9A 4TZ8A 4J0RA 4LYSA 3DWDA 4S3OB 5D0CA 2MD7B 3M62A 4AYCA 5D24A 3O70A 3ASLA 5CUAA 5E73A 4BW3A 5BT3A 4AKHA 3T6RA 2VJEB 5B75A 4AKNA 3S92A 5K29A 2CRRA 4HXMA 3HMEA 2PUYA 2VJFB 4R2YA 5CQ3A 5EISA 5EWWA 4W4UA 4YYIA 4HBWA 3UW9A 4PTBA 2XB1A 5ENEA 4NXJA 4QBMA 5C8GA 2D8SA 2KWNA 1WEUA 5D7XA 2FUIA 5EWCA 4YK0A 4QUUA 2LXPC 5ETBA 4NR6A 3FAOA 1FP0A 5C7NA 5BT4A 2DJAA 2ECTA 4LKAA 5DLZA 5SVIA 5DFCA 4O76A 3G0LA 4NYXA 2LGVA 2L75A 3FANA 4CUSA 3PLWA 1IYMA 4AVXA 2OWAA 5DKCA 3U5MA 1WEOA 4YY4A 4Z1SA 2P57A 3IHPA 5LVRA 1E6IA 3O36A 5TB6A 5E9MA 5D3SA 4NQMA 4PPEA 4CA1A 4FK5A 2LN0A 3P5OA 3KV6A 2R0SA 4IOQA 4TZ2A 5F1HA 2MJVB 2E6SA 2KWOA 2LAUA 2YQMA 1BORA 2ECIA 4MSXA 5SVYA 1N72A 3MQMA 2I8NA 1T1HA 5J0DA 2VPBA 4QYLA 4XI1A 4A9EA 3EB5A 1WIMA 4A9HA 4HXSA 4FO9A 3RPGB 3EB6A 2EXUA 5FE8A 2KE1A 4QSPA 3MUKA 2XOZA 5FE1A 2LRIC 2YQLA 5JWMA 5HQ7A 2M85A 3N9LA 4AP4A 5EPSA 2EJNA 5HM0A 4HXRA 4QZSA 2K4DA 1WEPA 3D7CA 5AD2A 3DQVR 5ENHA 3LQIA 4UP5A 3ZYUA 5FE4A 4CL9A 4IOOA 4BW4A 3VKGA 2CSVA 3ZVYA 4YADA 5A5SA 3O37A 1PUOA 3O33A 5FG4A 2E7NA 1N87A 4I7CA 1WE9A 2MUMA 2LGKA 3DAIA 1WUGA 4O77A 5DKHA 4V3KC 5K3QA 5C11A 2RI7A 4UI9B 5IG6A 3N9QA 4UIXA 4N4IA 4LDFA 5DFBA 2F42A 3FKMX 4QSVA 4UIVA 4XY8A 2L7PA 2N9GA 5KH7A 1G25A 4TYLA 3U5OA 4R8PK 3AADA 4LR6A 4LYIA 4NRAA 2JMDA 4H9DA 2WP1A 4O78A 1WENA 2ECGA 4Z1QA 4NUDA 5KH3A 5FH8A 4R7EA 4QEWA 2G4AA 5CY9A 5FFVA 4F3IA 1VD4A 5D3PA 5F25A 4LZSA 4A9MA 3HCUA 4FLPA 4ALGA 3HMFA 5CTLA 4O7EA 2K16A 5D26A 2FFWA 1JM7A 5HRWA 4MEOA 2L0BA 3MULA 4YH3A 4UYEA 4LK9A 4QF2A 4QNSA 4NR5A 5CP5A 4AI6A 3O7AA 2ECNA 5L97A 4IR4A 5D1LB 4PY6A 2E3KA 5DYUA 2CT2A 5II1A 1Z2QA 2KU3A 5F1LA 2YQDA 2H0DA 5FERA 2YUCA 4PKLA 2VPEA 3U5LA 5FG6A 3O47A 3I2DA 2YEKA 3QZTA 3UVYA 4HXPA 2YDWA 3JVLA 3HCTA 2ECVA 3N9NA 5D3RA 2Y43A 2K17A 4ZDTA 3P1CA 5G4SA 3D1DA 3MB3A 5FEYA 5FB1A 5DX4A 2WP2A 3MHSA 4O71A 2L43A 5D3JA 5A83A 3N9PA 3LQJA 2RS9B 4YBSA 4HXOA 5D3LA 4A9LA 5LKUA 3ZTGA 4QSQA 4UIYA 3L1XA 4LJNA 3FEHA 4QSSA 4UITA 4QSUA 5JI8A 2CRWA 1LDKC 5I40A 1WEQA 2CSZA 2HDPA 2PNXA 4A9FA 5E7DA 4X3GA 2XP0A 3ZPV1 4O62A 4YY6A 2E7OA 2LXHC 5G04B 2QICA 4IC2A 2YSMA 4LADB 2G43A 5A5OA 2NXBA 4OGEA 3FM8C 1VFYA 2KGIA 3S91A 4Q0OA 5D25A 5TABA 4UYGA 2IDAA 4F52B 5JG6A 5LJ2A 4PS5A 3UVDA 3AQAA 5EP7A 5I7XA 5IGNA 4GNGA 5F5ZA 2R10A 5I88A 5CUDA 4UYFA 4TU4A 2YW8A 4BW2A 2G45A 4YAXA 4NR9A 2XOYA 4HBVA 2MD8C 3M63A 1JOCA 1X4IA 4QSTA 3KQIA 2FSAA 5EM3A 3HTKC 1F62A 4HBYA 4MENA 2F6JA 4TT4A 2EGMA 5I89A 4A0CD 4B86C 5CUCA 5L8TA 4NRCA 4LC2A 2XOCA 4AYCB 5CQ8A 5ENFA 1WGMA 3LXJA 4QSRA 3MXFA 3VKHA 5A5RA 2LGLA 2YEMA 5HLSA 2L84A 3K2JA 4MVTA 4O7BA 4HXNA 2M6MA 1MM3A 4QY4A 3V43A 5G4RA 4FJCA 5A85A 5A81A 2MA6A 2KR4A 3PUQA 4CUTA 4LYWA 2DVVA 5HEMA 4NUCA 5CQ7A 4YYMA 2YU4A 2FUUA 2BAYA 2RNWA 2RO1A 5EWHA 5IGMA 5KHMA 4IC3A 4UYFB 2YELA 3NXBA 5ENIA 2KREA 4A4CA 4QEVA 2UZGA 1WILA 5SVIB 4YYHA 5LUUA 2ZETC 5C13A 2EA6A 5LKXA 2YW5A 5IGLA 4QUTA 5IBNA 2MIQA 2QJ0A 2YYRA 3E2DA 3SOUA 3N9MA 5BT5A 2KYUA 5LCWB 3I3JA 4J0SA 2RNYA 4WZ0A 1HYJA 5CQAA 2I50A 4QC1A 4CCGX 3JVJA 4UIWA 5F36A 2YHNA 1U6GB 4NYVA 2DSMA 5HJCA 5D1KB 1ZS5A 5DKDA 4QF3A 5G05B 3SOXA 5TBNA 3M7KA 5EYAF 5I80A 3SVFA 2YURA 4N3WA 4Z0OA 3ZVZB 4CFKA 5AIUA 3UV5A 3SVHA 5FBXA 2ECWA 4GNDA 4WIVA 5FFWA 1RMDA 5L99A 5TCMA 5HELA 2VNFA 4NYWA 4UYHA 4O7CA 4YATA 5H1VA 2HYED 3SVGA 4QYDA 5CRMA 4BW1A 5E9VA 4GNEA 4B7YC 5FE7A 5EPBA 5FE2A 5A82A 4NR8A 1Z6UA 2L5UA 3C6WA 5A5QA 2MNZA 3LJUX 5A7CA 4OGIA 2KWJA 3SUBA 4YH4A 2OO1A 2KKXA 5EPRA 5L8UA 5F60A 2VP7A 2FD4A 5HRXA 4XUBA 4ALHA 4Q0NA 3TLPA 2DATA 3U5JA 4Z6HA 2CSYA 5EICA 4IORA 2E6RA 5II2A 5CGPA 2LDRA 3QZVA 3KNVA 4L7XA 5EWDA 2YYNA 4ZC9A 4YYDA 1DVPA 4QQ4A 2JMIA 4LZRA 5EQ1A 4MR6A 5KU3A 3LRQA 4DONA 3H7HA 3LDYA 5CS8A 1F68A 1WEEA 4TT6A 4YYGA 4TT2A 4PCEA 5CZGA 4CFLA 4NN2A 2YHOA 3MHHA 3T7LA 5ENBA 3FJUB 4CUPA 4IR3A 3LJWA 2D8UA 2H60A 4A49A 2M3HA 4NR4A 2K1JA 4CURA 5EVAA 5EWVA 4YYJA 2XEUA 3GV4A 4QR3A 5AMEA 4KCXA 3O35A 4ZW1A 5FDZA 5A5PA 2VJFA 4TU6A 4FIPA 5CQ6A 1JM7B 5HQ6A 5DINA 2D82A 1V87A 2Y1MA 3ERRA 5FH6A 2DKWA 5CUGA 5A5NA 5DLXA 5COIA 5F62A 2MT5A 2YREA 3JUEA 5L96A 3RCWA 5HFQA 2YSJA 4TKPB 5E74A 3P1EA 3ONIA 2R0YA 5ENGA 2H0DB 3P1FA 4WZ3B 3Q2EA 4Z93A 4MEQA 4I7DA 5FE6A 1ZBDB 4F1PA 5TDRA 3UV4A 4BJXA 1E4UA 2RNXA 3PHDA 4HXLA 5DY7A 4YYKA 3Q1DA 5KH9A 3O34A 5E9KA 4C9ZA 2L5EA 2B0OE 5KTXA 5D3HA 4A9NA 5LJ1A 5FFYA 4NQNA 4QR4A 2G6QA 4UYDA 2L80A 4XUAA 3ZNIA 5I3LA 1MM2A 4O7FA 5CQ4A 4CUQA 5IIDA 3RTRB 2NAAA 5E9LA 2QIZA 4QC3A 5H1TA 1ZKRA 5CRZA 4AKGA 4RVRA 3DWYA 4AKIA 5H85A 3KV5A 5ETDA 3P1DA 5DKAA 3HCSA 5TDWA 5AD3A 5EK9A 4MR3A 3SOWA 2CKLA 5HCLA 4ZQLA 2RR4A 5J3XA 5AMFA 2KGGA 2MA5A 5DW2A 2KIZA 3Q2FA 5HENA 2DVSA 4UIZA 3M99A 4LRGA 5EI4A 5CQ5A 2L85A 3MB4A 4O70A 5F63A 2DVRA 4MR4A 3IU6A 4O72A 4O7AA 4OGJA 4WHWA 5DFDA 5FB0A 3LVRE 5EA1A 2M1RA 4N4HA 5HFRA 2LSPB 4P5OB 4A9KA 5B79A 5FE0A 4J3IA 5ENJA 4O74A 5ACYA 1DCQA 4NS5A 2OUOA 4YABA 3T9KA 5C85A 4KV1A 2VPGA 5C4QA 5DYCA 3ZPVE 1WEWA 4Z0RA 5E3GA 5KO4A 4QSWA 4L58A 5AITA 4E96A 5CUEA 5D3TA 3ZYQA 4MR5A 3GL6A 5FE3A 2EODA 4O75A 2YVRA 3HMHA 4WZ2A 5HQ5A 3L11A 1MBMA 4MEPA 4V3LC 4GPJA 5ENCA 4YYNA 5I29A 3DDTA 1X0JA 5D3NA 4A9OA 3MDBC 4WA6A 5FH7A 4UP0A 2CKLB 5B77A 5F3AA 5CUBA 2D9EA 5TRBA 4PCIA 5H1UA 5E9YA 5FG5A 2JM3A 5B76A 3FL2A 4CUUA 2DVQA 2KWKA 4IR5A 3L1ZB 4S3OC 2LGGA 3LQHA 4IR6A 1Z60A 5LKTA 5CPEA 3G0JA 5DW1A 4YBTA 1VYXA 1WUMA 4N4FA 2DWWA 4QSXA 5FE9A 3SHBA 5LKZA 3U5NA 2MNYA 4HXKA 5D1MB 4LLBA 4HBXA 4A9IA 2JRJA 5I86A 2LQ6A 4NR7A 5KTUA 5FE5A 2OXQC
chains in the Genus database with same CATH topology
2R0VA 4X2IA 2KTBB 5CU8A 5I1QA 2AN6A 4UIUA 2EGPA 4O64A 4NRBA 4BBQA 2GRCA 4Q6FA 1JSPB 4NUEA 2YT5A 4KV4A 4C66A 5C87A 5EGUA 5EU1A 5C89A 2Y1NA 3DPLR 4GB0A 4YBMA 5DYXA 5H9MA 4BHWA 2ECJA 2RSDA 4N4GA 3N9OA 1WEMA 4C67A 4QEUA 3JVKA 4ZUXU 4YC9A 5L98A 1K2FA 4LZ2A 3UVXA 3NG2A 5DYAA 2C2VS 1WFKA 5E0RA 5F61A 3UVWA 2VPDA 2RFJA 5KTWA 3UV2A 5I7YA 4OUFA 3C5KA 5E3DA 3JVMA 5I83A 1FBVA 5F2PA 1X4UA 3QZSA 2VJEA 4WHUA 1HYIA 2F6NA 1LDJB 5IGKA 4A9JA 4QR5A 5CQTA 1EQFA 3U5PA 1JM4B 4J1PA 3VK6A 4Y03A 4TQNA 2I7KA 2KFTA 4TS8A 1WESA 5LVQA 2C2LA 1XWHA 3RPGC 5HRVA 4Z6IA 5CFWA 3PURA 2DX8A 5B78A 5LJ0A 3IU5A 1CHCA 1X4JA 5DBMA 4GNFA 4QB3A 2JMJA 5G0FA 4CLBA 5E9IA 3U5KA 1WEVA 5EV9A 2LV9A 4I7BA 4TTEA 2OSSA 4XYAA 4A4BA 4AUQB 5B8DA 3GG3A 4XY9A 4TZ8A 4J0RA 4LYSA 4S3OB 5D0CA 2MD7B 3M62A 4AYCA 5D24A 3O70A 3ASLA 5CUAA 5E73A 4BW3A 5BT3A 3T6RA 2VJEB 5B75A 4AKNA 3S92A 5K29A 4HXMA 3HMEA 2PUYA 2VJFB 4R2YA 5CQ3A 5EISA 5EWWA 4W4UA 4YYIA 4HBWA 3UW9A 4PTBA 2XB1A 5ENEA 4NXJA 4QBMA 5C8GA 2D8SA 2KWNA 1WEUA 5D7XA 2FUIA 5EWCA 4YK0A 4QUUA 2LXPC 5ETBA 4NR6A 1FP0A 5C7NA 5BT4A 2ECTA 4LKAA 5DLZA 5DFCA 4O76A 3G0LA 4NYXA 2LGVA 2L75A 4CUSA 1IYMA 4AVXA 5DKCA 3U5MA 1WEOA 4YY4A 4Z1SA 3IHPA 5LVRA 1E6IA 3O36A 5TB6A 5E9MA 5D3SA 4NQMA 4PPEA 4CA1A 4FK5A 2LN0A 3P5OA 3KV6A 2R0SA 4IOQA 4TZ2A 5F1HA 2MJVB 2E6SA 2KWOA 2YQMA 1BORA 2ECIA 4MSXA 1N72A 3MQMA 2I8NA 1T1HA 5J0DA 2VPBA 4QYLA 4XI1A 4A9EA 3EB5A 1WIMA 4A9HA 4HXSA 4FO9A 3RPGB 3EB6A 5FE8A 2KE1A 4QSPA 3MUKA 5FE1A 2LRIC 2YQLA 5JWMA 5HQ7A 2M85A 3N9LA 4AP4A 5EPSA 5HM0A 4HXRA 4QZSA 2K4DA 1WEPA 3D7CA 5AD2A 3DQVR 5ENHA 3LQIA 4UP5A 3ZYUA 5FE4A 4CL9A 4IOOA 4BW4A 3ZVYA 4YADA 5A5SA 3O37A 3O33A 5FG4A 1N87A 2E7NA 4I7CA 1WE9A 2MUMA 2LGKA 3DAIA 1WUGA 4O77A 5DKHA 4V3KC 5C11A 2RI7A 4UI9B 5IG6A 3N9QA 4UIXA 4N4IA 4LDFA 5DFBA 2F42A 3FKMX 4QSVA 4UIVA 4XY8A 2N9GA 5KH7A 1G25A 4TYLA 3U5OA 4R8PK 3AADA 4LR6A 4LYIA 4NRAA 2JMDA 2WP1A 4O78A 1WENA 2ECGA 4Z1QA 4NUDA 5KH3A 5FH8A 4R7EA 4QEWA 2G4AA 5CY9A 5FFVA 4F3IA 1VD4A 5D3PA 5F25A 4LZSA 4A9MA 3HCUA 4FLPA 4ALGA 3HMFA 5CTLA 4O7EA 2K16A 5D26A 1JM7A 5HRWA 4MEOA 2L0BA 3MULA 4YH3A 4UYEA 4LK9A 4QF2A 4QNSA 4NR5A 5CP5A 3O7AA 2ECNA 5L97A 4IR4A 5D1LB 4PY6A 2E3KA 5DYUA 2CT2A 5II1A 1Z2QA 2KU3A 5F1LA 2YQDA 2H0DA 5FERA 2YUCA 4PKLA 2VPEA 3U5LA 5FG6A 3I2DA 2YEKA 3QZTA 3UVYA 4HXPA 2YDWA 3JVLA 3HCTA 2ECVA 3N9NA 5D3RA 2Y43A 2K17A 4ZDTA 3P1CA 5G4SA 3MB3A 5FEYA 5FB1A 5DX4A 2WP2A 3MHSA 4O71A 2L43A 5D3JA 5A83A 3N9PA 3LQJA 2RS9B 4YBSA 4HXOA 5D3LA 4A9LA 5LKUA 3ZTGA 4QSQA 4UIYA 3L1XA 4LJNA 4QSSA 4UITA 4QSUA 5JI8A 1LDKC 5I40A 1WEQA 2CSZA 2HDPA 2PNXA 4A9FA 5E7DA 4X3GA 3ZPV1 4YY6A 2E7OA 2LXHC 5G04B 2QICA 4IC2A 2YSMA 4LADB 2G43A 5A5OA 2NXBA 1VFYA 2KGIA 3S91A 4Q0OA 5D25A 5TABA 4UYGA 2IDAA 4F52B 5JG6A 5LJ2A 4PS5A 3UVDA 3AQAA 5EP7A 5I7XA 5IGNA 4GNGA 5F5ZA 2R10A 5I88A 5CUDA 4UYFA 4TU4A 2YW8A 4BW2A 2G45A 4YAXA 4NR9A 4HBVA 2MD8C 3M63A 1JOCA 1X4IA 4QSTA 3KQIA 2FSAA 5EM3A 3HTKC 1F62A 4HBYA 4MENA 2F6JA 4TT4A 5I89A 4A0CD 4B86C 5CUCA 5L8TA 4NRCA 4LC2A 4AYCB 5CQ8A 5ENFA 1WGMA 3LXJA 4QSRA 3MXFA 5A5RA 2LGLA 2YEMA 5HLSA 2L84A 3K2JA 4MVTA 4O7BA 4HXNA 2M6MA 1MM3A 4QY4A 3V43A 5G4RA 4FJCA 5A85A 5A81A 2MA6A 2KR4A 3PUQA 4CUTA 4LYWA 2DVVA 5HEMA 4NUCA 5CQ7A 4YYMA 2YU4A 2FUUA 2BAYA 2RNWA 2RO1A 5EWHA 5IGMA 5KHMA 4IC3A 4UYFB 2YELA 3NXBA 5ENIA 2KREA 4A4CA 4QEVA 2UZGA 1WILA 4YYHA 5LUUA 2ZETC 5C13A 2EA6A 5LKXA 2YW5A 5IGLA 4QUTA 5IBNA 2MIQA 2QJ0A 2YYRA 3SOUA 3N9MA 5BT5A 2KYUA 5LCWB 3I3JA 4J0SA 2RNYA 4WZ0A 1HYJA 5CQAA 2I50A 4QC1A 4CCGX 3JVJA 4UIWA 5F36A 2YHNA 1U6GB 4NYVA 5HJCA 5D1KB 1ZS5A 5DKDA 4QF3A 5G05B 3SOXA 5TBNA 5EYAF 5I80A 3SVFA 2YURA 4N3WA 3ZVZB 4CFKA 5AIUA 3UV5A 3SVHA 5FBXA 2ECWA 4GNDA 4WIVA 5FFWA 1RMDA 5L99A 5TCMA 5HELA 2VNFA 4NYWA 4UYHA 4O7CA 4YATA 5H1VA 2HYED 3SVGA 4QYDA 5CRMA 4BW1A 5E9VA 4GNEA 4B7YC 5FE7A 5EPBA 5FE2A 5A82A 4NR8A 1Z6UA 2L5UA 3C6WA 5A5QA 2MNZA 5A7CA 4OGIA 2KWJA 4YH4A 2OO1A 5EPRA 5L8UA 5F60A 2VP7A 5HRXA 4XUBA 4ALHA 4Q0NA 3TLPA 2DATA 3U5JA 4Z6HA 2CSYA 5EICA 4IORA 2E6RA 5II2A 5CGPA 2LDRA 3QZVA 3KNVA 4L7XA 5EWDA 2YYNA 4ZC9A 4YYDA 1DVPA 2JMIA 4LZRA 5EQ1A 4MR6A 5KU3A 3LRQA 4DONA 5CS8A 1F68A 1WEEA 4TT6A 4YYGA 4TT2A 4PCEA 5CZGA 4CFLA 4NN2A 2YHOA 3MHHA 3T7LA 5ENBA 4CUPA 4IR3A 3LJWA 2H60A 4A49A 2M3HA 4NR4A 2K1JA 4CURA 5EVAA 5EWVA 4YYJA 2XEUA 3GV4A 4QR3A 5AMEA 4KCXA 3O35A 4ZW1A 5FDZA 5A5PA 2VJFA 4TU6A 4FIPA 5CQ6A 1JM7B 5HQ6A 5DINA 2D82A 1V87A 2Y1MA 5FH6A 2DKWA 5CUGA 5A5NA 5DLXA 5COIA 5F62A 2MT5A 2YREA 5L96A 3RCWA 5HFQA 2YSJA 4TKPB 5E74A 3P1EA 3ONIA 2R0YA 5ENGA 2H0DB 3P1FA 4WZ3B 3Q2EA 4Z93A 4MEQA 4I7DA 5FE6A 1ZBDB 5TDRA 3UV4A 4BJXA 1E4UA 2RNXA 3PHDA 4HXLA 5DY7A 4YYKA 5KH9A 3O34A 5E9KA 4C9ZA 2L5EA 5KTXA 5D3HA 4A9NA 5LJ1A 5FFYA 4NQNA 4QR4A 2G6QA 4UYDA 2L80A 4XUAA 3ZNIA 5I3LA 1MM2A 4O7FA 5CQ4A 4CUQA 5IIDA 3RTRB 2NAAA 5E9LA 2QIZA 4QC3A 5H1TA 5CRZA 4RVRA 3DWYA 5H85A 3KV5A 5ETDA 3P1DA 5DKAA 3HCSA 5TDWA 5AD3A 5EK9A 4MR3A 3SOWA 2CKLA 5HCLA 4ZQLA 5J3XA 5AMFA 2KGGA 2MA5A 5DW2A 2KIZA 3Q2FA 5HENA 2DVSA 4UIZA 3M99A 4LRGA 5EI4A 5CQ5A 2L85A 3MB4A 4O70A 5F63A 2DVRA 4MR4A 3IU6A 4O72A 4O7AA 4OGJA 4WHWA 5DFDA 5FB0A 5EA1A 2M1RA 4N4HA 5HFRA 2LSPB 4P5OB 4A9KA 5B79A 5FE0A 4J3IA 5ENJA 4O74A 5ACYA 4NS5A 2OUOA 4YABA 5C85A 4KV1A 2VPGA 5C4QA 5DYCA 3ZPVE 1WEWA 5E3GA 5KO4A 4QSWA 4L58A 5AITA 4E96A 5CUEA 5D3TA 3ZYQA 4MR5A 3GL6A 5FE3A 2EODA 4O75A 3HMHA 4WZ2A 5HQ5A 3L11A 4MEPA 4V3LC 4GPJA 5ENCA 4YYNA 5I29A 1X0JA 5D3NA 4A9OA 4WA6A 5FH7A 4UP0A 2CKLB 5B77A 5F3AA 5CUBA 2D9EA 5TRBA 4PCIA 5H1UA 5E9YA 5FG5A 5B76A 3FL2A 4CUUA 2DVQA 2KWKA 4IR5A 3L1ZB 4S3OC 2LGGA 3LQHA 4IR6A 1Z60A 5LKTA 5CPEA 3G0JA 5DW1A 4YBTA 1VYXA 1WUMA 4N4FA 2DWWA 4QSXA 5FE9A 3SHBA 5LKZA 3U5NA 2MNYA 4HXKA 5D1MB 4LLBA 4HBXA 4A9IA 2JRJA 5I86A 2LQ6A 4NR7A 5KTUA 5FE5A 2OXQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0V A;  4X2I A;  2KTB B;  5CU8 A;  5I1Q A;  2AN6 A;  4UIU A;  2EGP A;  4O64 A;  4NRB A;  4BBQ A;  2GRC A;  4Q6F A;  1JSP B;  4NUE A;  2YT5 A;  4KV4 A;  4C66 A;  5C87 A;  5EGU A;  5EU1 A;  5C89 A;  2Y1N A;  3DPL R;  4GB0 A;  4YBM A;  5DYX A;  5H9M A;  4BHW A;  2ECJ A;  2RSD A;  4N4G A;  3N9O A;  1WEM A;  4C67 A;  4QEU A;  3JVK A;  4ZUX U;  4YC9 A;  5L98 A;  1K2F A;  4LZ2 A;  3UVX A;  3NG2 A;  5DYA A;  2C2V S;  1WFK A;  5E0R A;  5F61 A;  3UVW A;  2VPD A;  2RFJ A;  5KTW A;  3UV2 A;  5I7Y A;  4OUF A;  3C5K A;  5E3D A;  3JVM A;  5I83 A;  1FBV A;  5F2P A;  1X4U A;  3QZS A;  2VJE A;  4WHU A;  1HYI A;  2F6N A;  1LDJ B;  5IGK A;  4A9J A;  4QR5 A;  5CQT A;  1EQF A;  3U5P A;  1JM4 B;  4J1P A;  3VK6 A;  4Y03 A;  4TQN A;  2I7K A;  2KFT A;  4TS8 A;  1WES A;  5LVQ A;  2C2L A;  1XWH A;  3RPG C;  5HRV A;  4Z6I A;  5CFW A;  3PUR A;  2DX8 A;  5B78 A;  5LJ0 A;  3IU5 A;  1CHC A;  1X4J A;  5DBM A;  4GNF A;  4QB3 A;  2JMJ A;  5G0F A;  4CLB A;  5E9I A;  3U5K A;  1WEV A;  5EV9 A;  2LV9 A;  4I7B A;  4TTE A;  2OSS A;  4XYA A;  4A4B A;  4AUQ B;  5B8D A;  3GG3 A;  4XY9 A;  4TZ8 A;  4J0R A;  4LYS A;  4S3O B;  5D0C A;  2MD7 B;  3M62 A;  4AYC A;  5D24 A;  3O70 A;  3ASL A;  5CUA A;  5E73 A;  4BW3 A;  5BT3 A;  3T6R A;  2VJE B;  5B75 A;  4AKN A;  3S92 A;  5K29 A;  4HXM A;  3HME A;  2PUY A;  2VJF B;  4R2Y A;  5CQ3 A;  5EIS A;  5EWW A;  4W4U A;  4YYI A;  4HBW A;  3UW9 A;  4PTB A;  2XB1 A;  5ENE A;  4NXJ A;  4QBM A;  5C8G A;  2D8S A;  2KWN A;  1WEU A;  5D7X A;  2FUI A;  5EWC A;  4YK0 A;  4QUU A;  2LXP C;  5ETB A;  4NR6 A;  1FP0 A;  5C7N A;  5BT4 A;  2ECT A;  4LKA A;  5DLZ A;  5DFC A;  4O76 A;  3G0L A;  4NYX A;  2LGV A;  2L75 A;  4CUS A;  1IYM A;  4AVX A;  5DKC A;  3U5M A;  1WEO A;  4YY4 A;  4Z1S A;  3IHP A;  5LVR A;  1E6I A;  3O36 A;  5TB6 A;  5E9M A;  5D3S A;  4NQM A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3P5O A;  3KV6 A;  2R0S A;  4IOQ A;  4TZ2 A;  5F1H A;  2MJV B;  2E6S A;  2KWO A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  1N72 A;  3MQM A;  2I8N A;  1T1H A;  5J0D A;  2VPB A;  4QYL A;  4XI1 A;  4A9E A;  3EB5 A;  1WIM A;  4A9H A;  4HXS A;  4FO9 A;  3RPG B;  3EB6 A;  5FE8 A;  2KE1 A;  4QSP A;  3MUK A;  5FE1 A;  2LRI C;  2YQL A;  5JWM A;  5HQ7 A;  2M85 A;  3N9L A;  4AP4 A;  5EPS A;  5HM0 A;  4HXR A;  4QZS A;  2K4D A;  1WEP A;  3D7C A;  5AD2 A;  3DQV R;  5ENH A;  3LQI A;  4UP5 A;  3ZYU A;  5FE4 A;  4CL9 A;  4IOO A;  4BW4 A;  3ZVY A;  4YAD A;  5A5S A;  3O37 A;  3O33 A;  5FG4 A;  1N87 A;  2E7N A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  3DAI A;  1WUG A;  4O77 A;  5DKH A;  4V3K C;  5C11 A;  2RI7 A;  4UI9 B;  5IG6 A;  3N9Q A;  4UIX A;  4N4I A;  4LDF A;  5DFB A;  2F42 A;  3FKM X;  4QSV A;  4UIV A;  4XY8 A;  2N9G A;  5KH7 A;  1G25 A;  4TYL A;  3U5O A;  4R8P K;  3AAD A;  4LR6 A;  4LYI A;  4NRA A;  2JMD A;  2WP1 A;  4O78 A;  1WEN A;  2ECG A;  4Z1Q A;  4NUD A;  5KH3 A;  5FH8 A;  4R7E A;  4QEW A;  2G4A A;  5CY9 A;  5FFV A;  4F3I A;  1VD4 A;  5D3P A;  5F25 A;  4LZS A;  4A9M A;  3HCU A;  4FLP A;  4ALG A;  3HMF A;  5CTL A;  4O7E A;  2K16 A;  5D26 A;  1JM7 A;  5HRW A;  4MEO A;  2L0B A;  3MUL A;  4YH3 A;  4UYE A;  4LK9 A;  4QF2 A;  4QNS A;  4NR5 A;  5CP5 A;  3O7A A;  2ECN A;  5L97 A;  4IR4 A;  5D1L B;  4PY6 A;  2E3K A;  5DYU A;  2CT2 A;  5II1 A;  1Z2Q A;  2KU3 A;  5F1L A;  2YQD A;  2H0D A;  5FER A;  2YUC A;  4PKL A;  2VPE A;  3U5L A;  5FG6 A;  3I2D A;  2YEK A;  3QZT A;  3UVY A;  4HXP A;  2YDW A;  3JVL A;  3HCT A;  2ECV A;  3N9N A;  5D3R A;  2Y43 A;  2K17 A;  4ZDT A;  3P1C A;  5G4S A;  3MB3 A;  5FEY A;  5FB1 A;  5DX4 A;  2WP2 A;  3MHS A;  4O71 A;  2L43 A;  5D3J A;  5A83 A;  3N9P A;  3LQJ A;  2RS9 B;  4YBS A;  4HXO A;  5D3L A;  4A9L A;  5LKU A;  3ZTG A;  4QSQ A;  4UIY A;  3L1X A;  4LJN A;  4QSS A;  4UIT A;  4QSU A;  5JI8 A;  1LDK C;  5I40 A;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4A9F A;  5E7D A;  4X3G A;  3ZPV 1;  4YY6 A;  2E7O A;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  2YSM A;  4LAD B;  2G43 A;  5A5O A;  2NXB A;  1VFY A;  2KGI A;  3S91 A;  4Q0O A;  5D25 A;  5TAB A;  4UYG A;  2IDA A;  4F52 B;  5JG6 A;  5LJ2 A;  4PS5 A;  3UVD A;  3AQA A;  5EP7 A;  5I7X A;  5IGN A;  4GNG A;  5F5Z A;  2R10 A;  5I88 A;  5CUD A;  4UYF A;  4TU4 A;  2YW8 A;  4BW2 A;  2G45 A;  4YAX A;  4NR9 A;  4HBV A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  4QST A;  3KQI A;  2FSA A;  5EM3 A;  3HTK C;  1F62 A;  4HBY A;  4MEN A;  2F6J A;  4TT4 A;  5I89 A;  4A0C D;  4B86 C;  5CUC A;  5L8T A;  4NRC A;  4LC2 A;  4AYC B;  5CQ8 A;  5ENF A;  1WGM A;  3LXJ A;  4QSR A;  3MXF A;  5A5R A;  2LGL A;  2YEM A;  5HLS A;  2L84 A;  3K2J A;  4MVT A;  4O7B A;  4HXN A;  2M6M A;  1MM3 A;  4QY4 A;  3V43 A;  5G4R A;  4FJC A;  5A85 A;  5A81 A;  2MA6 A;  2KR4 A;  3PUQ A;  4CUT A;  4LYW A;  2DVV A;  5HEM A;  4NUC A;  5CQ7 A;  4YYM A;  2YU4 A;  2FUU A;  2BAY A;  2RNW A;  2RO1 A;  5EWH A;  5IGM A;  5KHM A;  4IC3 A;  4UYF B;  2YEL A;  3NXB A;  5ENI A;  2KRE A;  4A4C A;  4QEV A;  2UZG A;  1WIL A;  4YYH A;  5LUU A;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  2YW5 A;  5IGL A;  4QUT A;  5IBN A;  2MIQ A;  2QJ0 A;  2YYR A;  3SOU A;  3N9M A;  5BT5 A;  2KYU A;  5LCW B;  3I3J A;  4J0S A;  2RNY A;  4WZ0 A;  1HYJ A;  5CQA A;  2I50 A;  4QC1 A;  4CCG X;  3JVJ A;  4UIW A;  5F36 A;  2YHN A;  1U6G B;  4NYV A;  5HJC A;  5D1K B;  1ZS5 A;  5DKD A;  4QF3 A;  5G05 B;  3SOX A;  5TBN A;  5EYA F;  5I80 A;  3SVF A;  2YUR A;  4N3W A;  3ZVZ B;  4CFK A;  5AIU A;  3UV5 A;  3SVH A;  5FBX A;  2ECW A;  4GND A;  4WIV A;  5FFW A;  1RMD A;  5L99 A;  5TCM A;  5HEL A;  2VNF A;  4NYW A;  4UYH A;  4O7C A;  4YAT A;  5H1V A;  2HYE D;  3SVG A;  4QYD A;  5CRM A;  4BW1 A;  5E9V A;  4GNE A;  4B7Y C;  5FE7 A;  5EPB A;  5FE2 A;  5A82 A;  4NR8 A;  1Z6U A;  2L5U A;  3C6W A;  5A5Q A;  2MNZ A;  5A7C A;  4OGI A;  2KWJ A;  4YH4 A;  2OO1 A;  5EPR A;  5L8U A;  5F60 A;  2VP7 A;  5HRX A;  4XUB A;  4ALH A;  4Q0N A;  3TLP A;  2DAT A;  3U5J A;  4Z6H A;  2CSY A;  5EIC A;  4IOR A;  2E6R A;  5II2 A;  5CGP A;  2LDR A;  3QZV A;  3KNV A;  4L7X A;  5EWD A;  2YYN A;  4ZC9 A;  4YYD A;  1DVP A;  2JMI A;  4LZR A;  5EQ1 A;  4MR6 A;  5KU3 A;  3LRQ A;  4DON A;  5CS8 A;  1F68 A;  1WEE A;  4TT6 A;  4YYG A;  4TT2 A;  4PCE A;  5CZG A;  4CFL A;  4NN2 A;  2YHO A;  3MHH A;  3T7L A;  5ENB A;  4CUP A;  4IR3 A;  3LJW A;  2H60 A;  4A49 A;  2M3H A;  4NR4 A;  2K1J A;  4CUR A;  5EVA A;  5EWV A;  4YYJ A;  2XEU A;  3GV4 A;  4QR3 A;  5AME A;  4KCX A;  3O35 A;  4ZW1 A;  5FDZ A;  5A5P A;  2VJF A;  4TU6 A;  4FIP A;  5CQ6 A;  1JM7 B;  5HQ6 A;  5DIN A;  2D82 A;  1V87 A;  2Y1M A;  5FH6 A;  2DKW A;  5CUG A;  5A5N A;  5DLX A;  5COI A;  5F62 A;  2MT5 A;  2YRE A;  5L96 A;  3RCW A;  5HFQ A;  2YSJ A;  4TKP B;  5E74 A;  3P1E A;  3ONI A;  2R0Y A;  5ENG A;  2H0D B;  3P1F A;  4WZ3 B;  3Q2E A;  4Z93 A;  4MEQ A;  4I7D A;  5FE6 A;  1ZBD B;  5TDR A;  3UV4 A;  4BJX A;  1E4U A;  2RNX A;  3PHD A;  4HXL A;  5DY7 A;  4YYK A;  5KH9 A;  3O34 A;  5E9K A;  4C9Z A;  2L5E A;  5KTX A;  5D3H A;  4A9N A;  5LJ1 A;  5FFY A;  4NQN A;  4QR4 A;  2G6Q A;  4UYD A;  2L80 A;  4XUA A;  3ZNI A;  5I3L A;  1MM2 A;  4O7F A;  5CQ4 A;  4CUQ A;  5IID A;  3RTR B;  2NAA A;  5E9L A;  2QIZ A;  4QC3 A;  5H1T A;  5CRZ A;  4RVR A;  3DWY A;  5H85 A;  3KV5 A;  5ETD A;  3P1D A;  5DKA A;  3HCS A;  5TDW A;  5AD3 A;  5EK9 A;  4MR3 A;  3SOW A;  2CKL A;  5HCL A;  4ZQL A;  5J3X A;  5AMF A;  2KGG A;  2MA5 A;  5DW2 A;  2KIZ A;  3Q2F A;  5HEN A;  2DVS A;  4UIZ A;  3M99 A;  4LRG A;  5EI4 A;  5CQ5 A;  2L85 A;  3MB4 A;  4O70 A;  5F63 A;  2DVR A;  4MR4 A;  3IU6 A;  4O72 A;  4O7A A;  4OGJ A;  4WHW A;  5DFD A;  5FB0 A;  5EA1 A;  2M1R A;  4N4H A;  5HFR A;  2LSP B;  4P5O B;  4A9K A;  5B79 A;  5FE0 A;  4J3I A;  5ENJ A;  4O74 A;  5ACY A;  4NS5 A;  2OUO A;  4YAB A;  5C85 A;  4KV1 A;  2VPG A;  5C4Q A;  5DYC A;  3ZPV E;  1WEW A;  5E3G A;  5KO4 A;  4QSW A;  4L58 A;  5AIT A;  4E96 A;  5CUE A;  5D3T A;  3ZYQ A;  4MR5 A;  3GL6 A;  5FE3 A;  2EOD A;  4O75 A;  3HMH A;  4WZ2 A;  5HQ5 A;  3L11 A;  4MEP A;  4V3L C;  4GPJ A;  5ENC A;  4YYN A;  5I29 A;  1X0J A;  5D3N A;  4A9O A;  4WA6 A;  5FH7 A;  4UP0 A;  2CKL B;  5B77 A;  5F3A A;  5CUB A;  2D9E A;  5TRB A;  4PCI A;  5H1U A;  5E9Y A;  5FG5 A;  5B76 A;  3FL2 A;  4CUU A;  2DVQ A;  2KWK A;  4IR5 A;  3L1Z B;  4S3O C;  2LGG A;  3LQH A;  4IR6 A;  1Z60 A;  5LKT A;  5CPE A;  3G0J A;  5DW1 A;  4YBT A;  1VYX A;  1WUM A;  4N4F A;  2DWW A;  4QSX A;  5FE9 A;  3SHB A;  5LKZ A;  3U5N A;  2MNY A;  4HXK A;  5D1M B;  4LLB A;  4HBX A;  4A9I A;  2JRJ A;  5I86 A;  2LQ6 A;  4NR7 A;  5KTU A;  5FE5 A;  2OXQ C; 
#chains in the Genus database with same CATH topology
 2R0V A;  4X2I A;  2KTB B;  5CU8 A;  5I1Q A;  2AN6 A;  4UIU A;  2EGP A;  4O64 A;  4NRB A;  4BBQ A;  2GRC A;  4Q6F A;  1JSP B;  4NUE A;  2E61 A;  2YT5 A;  4KV4 A;  4C66 A;  5C87 A;  5EGU A;  5EU1 A;  5C89 A;  2Y1N A;  3DPL R;  4GB0 A;  4YBM A;  5DYX A;  5H9M A;  4BHW A;  2ECJ A;  2RSD A;  4N4G A;  3N9O A;  1WEM A;  4C67 A;  4QEU A;  3JVK A;  4ZUX U;  4YC9 A;  5L98 A;  1K2F A;  4LZ2 A;  2CON A;  2IQJ A;  3UVX A;  2M13 A;  3NG2 A;  5DYA A;  2C2V S;  1WFK A;  5E0R A;  5F61 A;  3UVW A;  2VPD A;  4OGC A;  2RFJ A;  5KTW A;  3D1B A;  3UV2 A;  5I7Y A;  2MKE A;  4OUF A;  3C5K A;  5E3D A;  3JVM A;  5I83 A;  1FBV A;  5F2P A;  1X4U A;  3QZS A;  2VJE A;  4WHU A;  1HYI A;  2F6N A;  1LDJ B;  5IGK A;  4A9J A;  4QR5 A;  5CQT A;  1EQF A;  3U5P A;  1JM4 B;  4J1P A;  5SVX A;  4Y03 A;  2KKY A;  3VK6 A;  4TQN A;  3LVQ E;  2I7K A;  2KFT A;  4TS8 A;  1WES A;  5LVQ A;  2C2L A;  1XWH A;  3RPG C;  5HRV A;  4Z6I A;  5CFW A;  3PUR A;  2DX8 A;  5B78 A;  5LJ0 A;  3IU5 A;  1CHC A;  3KDE C;  1X4J A;  5DBM A;  4GNF A;  4QB3 A;  2JMJ A;  5G0F A;  4CLB A;  5E9I A;  3U5K A;  1WEV A;  5EV9 A;  2LV9 A;  2JUN A;  4I7B A;  4TTE A;  2OSS A;  4XYA A;  4A4B A;  4AUQ B;  5B8D A;  3GG3 A;  4XY9 A;  4TZ8 A;  4J0R A;  4LYS A;  3DWD A;  4S3O B;  5D0C A;  2MD7 B;  3M62 A;  4AYC A;  5D24 A;  3O70 A;  3ASL A;  5CUA A;  5E73 A;  4BW3 A;  5BT3 A;  4AKH A;  3T6R A;  2VJE B;  5B75 A;  4AKN A;  3S92 A;  5K29 A;  2CRR A;  4HXM A;  3HME A;  2PUY A;  2VJF B;  4R2Y A;  5CQ3 A;  5EIS A;  5EWW A;  4W4U A;  4YYI A;  4HBW A;  3UW9 A;  4PTB A;  2XB1 A;  5ENE A;  4NXJ A;  4QBM A;  5C8G A;  2D8S A;  2KWN A;  1WEU A;  5D7X A;  2FUI A;  5EWC A;  4YK0 A;  4QUU A;  2LXP C;  5ETB A;  4NR6 A;  3FAO A;  1FP0 A;  5C7N A;  5BT4 A;  2DJA A;  2ECT A;  4LKA A;  5DLZ A;  5SVI A;  5DFC A;  4O76 A;  3G0L A;  4NYX A;  2LGV A;  2L75 A;  3FAN A;  4CUS A;  3PLW A;  1IYM A;  4AVX A;  2OWA A;  5DKC A;  3U5M A;  1WEO A;  4YY4 A;  4Z1S A;  2P57 A;  3IHP A;  5LVR A;  1E6I A;  3O36 A;  5TB6 A;  5E9M A;  5D3S A;  4NQM A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3P5O A;  3KV6 A;  2R0S A;  4IOQ A;  4TZ2 A;  5F1H A;  2MJV B;  2E6S A;  2KWO A;  2LAU A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  5SVY A;  1N72 A;  3MQM A;  2I8N A;  1T1H A;  5J0D A;  2VPB A;  4QYL A;  4XI1 A;  4A9E A;  3EB5 A;  1WIM A;  4A9H A;  4HXS A;  4FO9 A;  3RPG B;  3EB6 A;  2EXU A;  5FE8 A;  2KE1 A;  4QSP A;  3MUK A;  2XOZ A;  5FE1 A;  2LRI C;  2YQL A;  5JWM A;  5HQ7 A;  2M85 A;  3N9L A;  4AP4 A;  5EPS A;  2EJN A;  5HM0 A;  4HXR A;  4QZS A;  2K4D A;  1WEP A;  3D7C A;  5AD2 A;  3DQV R;  5ENH A;  3LQI A;  4UP5 A;  3ZYU A;  5FE4 A;  4CL9 A;  4IOO A;  4BW4 A;  3VKG A;  2CSV A;  3ZVY A;  4YAD A;  5A5S A;  3O37 A;  1PUO A;  3O33 A;  5FG4 A;  2E7N A;  1N87 A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  3DAI A;  1WUG A;  4O77 A;  5DKH A;  4V3K C;  5K3Q A;  5C11 A;  2RI7 A;  4UI9 B;  5IG6 A;  3N9Q A;  4UIX A;  4N4I A;  4LDF A;  5DFB A;  2F42 A;  3FKM X;  4QSV A;  4UIV A;  4XY8 A;  2L7P A;  2N9G A;  5KH7 A;  1G25 A;  4TYL A;  3U5O A;  4R8P K;  3AAD A;  4LR6 A;  4LYI A;  4NRA A;  2JMD A;  4H9D A;  2WP1 A;  4O78 A;  1WEN A;  2ECG A;  4Z1Q A;  4NUD A;  5KH3 A;  5FH8 A;  4R7E A;  4QEW A;  2G4A A;  5CY9 A;  5FFV A;  4F3I A;  1VD4 A;  5D3P A;  5F25 A;  4LZS A;  4A9M A;  3HCU A;  4FLP A;  4ALG A;  3HMF A;  5CTL A;  4O7E A;  2K16 A;  5D26 A;  2FFW A;  1JM7 A;  5HRW A;  4MEO A;  2L0B A;  3MUL A;  4YH3 A;  4UYE A;  4LK9 A;  4QF2 A;  4QNS A;  4NR5 A;  5CP5 A;  4AI6 A;  3O7A A;  2ECN A;  5L97 A;  4IR4 A;  5D1L B;  4PY6 A;  2E3K A;  5DYU A;  2CT2 A;  5II1 A;  1Z2Q A;  2KU3 A;  5F1L A;  2YQD A;  2H0D A;  5FER A;  2YUC A;  4PKL A;  2VPE A;  3U5L A;  5FG6 A;  3O47 A;  3I2D A;  2YEK A;  3QZT A;  3UVY A;  4HXP A;  2YDW A;  3JVL A;  3HCT A;  2ECV A;  3N9N A;  5D3R A;  2Y43 A;  2K17 A;  4ZDT A;  3P1C A;  5G4S A;  3D1D A;  3MB3 A;  5FEY A;  5FB1 A;  5DX4 A;  2WP2 A;  3MHS A;  4O71 A;  2L43 A;  5D3J A;  5A83 A;  3N9P A;  3LQJ A;  2RS9 B;  4YBS A;  4HXO A;  5D3L A;  4A9L A;  5LKU A;  3ZTG A;  4QSQ A;  4UIY A;  3L1X A;  4LJN A;  3FEH A;  4QSS A;  4UIT A;  4QSU A;  5JI8 A;  2CRW A;  1LDK C;  5I40 A;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4A9F A;  5E7D A;  4X3G A;  2XP0 A;  3ZPV 1;  4O62 A;  4YY6 A;  2E7O A;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  2YSM A;  4LAD B;  2G43 A;  5A5O A;  2NXB A;  4OGE A;  3FM8 C;  1VFY A;  2KGI A;  3S91 A;  4Q0O A;  5D25 A;  5TAB A;  4UYG A;  2IDA A;  4F52 B;  5JG6 A;  5LJ2 A;  4PS5 A;  3UVD A;  3AQA A;  5EP7 A;  5I7X A;  5IGN A;  4GNG A;  5F5Z A;  2R10 A;  5I88 A;  5CUD A;  4UYF A;  4TU4 A;  2YW8 A;  4BW2 A;  2G45 A;  4YAX A;  4NR9 A;  2XOY A;  4HBV A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  4QST A;  3KQI A;  2FSA A;  5EM3 A;  3HTK C;  1F62 A;  4HBY A;  4MEN A;  2F6J A;  4TT4 A;  2EGM A;  5I89 A;  4A0C D;  4B86 C;  5CUC A;  5L8T A;  4NRC A;  4LC2 A;  2XOC A;  4AYC B;  5CQ8 A;  5ENF A;  1WGM A;  3LXJ A;  4QSR A;  3MXF A;  3VKH A;  5A5R A;  2LGL A;  2YEM A;  5HLS A;  2L84 A;  3K2J A;  4MVT A;  4O7B A;  4HXN A;  2M6M A;  1MM3 A;  4QY4 A;  3V43 A;  5G4R A;  4FJC A;  5A85 A;  5A81 A;  2MA6 A;  2KR4 A;  3PUQ A;  4CUT A;  4LYW A;  2DVV A;  5HEM A;  4NUC A;  5CQ7 A;  4YYM A;  2YU4 A;  2FUU A;  2BAY A;  2RNW A;  2RO1 A;  5EWH A;  5IGM A;  5KHM A;  4IC3 A;  4UYF B;  2YEL A;  3NXB A;  5ENI A;  2KRE A;  4A4C A;  4QEV A;  2UZG A;  1WIL A;  5SVI B;  4YYH A;  5LUU A;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  2YW5 A;  5IGL A;  4QUT A;  5IBN A;  2MIQ A;  2QJ0 A;  2YYR A;  3E2D A;  3SOU A;  3N9M A;  5BT5 A;  2KYU A;  5LCW B;  3I3J A;  4J0S A;  2RNY A;  4WZ0 A;  1HYJ A;  5CQA A;  2I50 A;  4QC1 A;  4CCG X;  3JVJ A;  4UIW A;  5F36 A;  2YHN A;  1U6G B;  4NYV A;  2DSM A;  5HJC A;  5D1K B;  1ZS5 A;  5DKD A;  4QF3 A;  5G05 B;  3SOX A;  5TBN A;  3M7K A;  5EYA F;  5I80 A;  3SVF A;  2YUR A;  4N3W A;  4Z0O A;  3ZVZ B;  4CFK A;  5AIU A;  3UV5 A;  3SVH A;  5FBX A;  2ECW A;  4GND A;  4WIV A;  5FFW A;  1RMD A;  5L99 A;  5TCM A;  5HEL A;  2VNF A;  4NYW A;  4UYH A;  4O7C A;  4YAT A;  5H1V A;  2HYE D;  3SVG A;  4QYD A;  5CRM A;  4BW1 A;  5E9V A;  4GNE A;  4B7Y C;  5FE7 A;  5EPB A;  5FE2 A;  5A82 A;  4NR8 A;  1Z6U A;  2L5U A;  3C6W A;  5A5Q A;  2MNZ A;  3LJU X;  5A7C A;  4OGI A;  2KWJ A;  3SUB A;  4YH4 A;  2OO1 A;  2KKX A;  5EPR A;  5L8U A;  5F60 A;  2VP7 A;  2FD4 A;  5HRX A;  4XUB A;  4ALH A;  4Q0N A;  3TLP A;  2DAT A;  3U5J A;  4Z6H A;  2CSY A;  5EIC A;  4IOR A;  2E6R A;  5II2 A;  5CGP A;  2LDR A;  3QZV A;  3KNV A;  4L7X A;  5EWD A;  2YYN A;  4ZC9 A;  4YYD A;  1DVP A;  4QQ4 A;  2JMI A;  4LZR A;  5EQ1 A;  4MR6 A;  5KU3 A;  3LRQ A;  4DON A;  3H7H A;  3LDY A;  5CS8 A;  1F68 A;  1WEE A;  4TT6 A;  4YYG A;  4TT2 A;  4PCE A;  5CZG A;  4CFL A;  4NN2 A;  2YHO A;  3MHH A;  3T7L A;  5ENB A;  3FJU B;  4CUP A;  4IR3 A;  3LJW A;  2D8U A;  2H60 A;  4A49 A;  2M3H A;  4NR4 A;  2K1J A;  4CUR A;  5EVA A;  5EWV A;  4YYJ A;  2XEU A;  3GV4 A;  4QR3 A;  5AME A;  4KCX A;  3O35 A;  4ZW1 A;  5FDZ A;  5A5P A;  2VJF A;  4TU6 A;  4FIP A;  5CQ6 A;  1JM7 B;  5HQ6 A;  5DIN A;  2D82 A;  1V87 A;  2Y1M A;  3ERR A;  5FH6 A;  2DKW A;  5CUG A;  5A5N A;  5DLX A;  5COI A;  5F62 A;  2MT5 A;  2YRE A;  3JUE A;  5L96 A;  3RCW A;  5HFQ A;  2YSJ A;  4TKP B;  5E74 A;  3P1E A;  3ONI A;  2R0Y A;  5ENG A;  2H0D B;  3P1F A;  4WZ3 B;  3Q2E A;  4Z93 A;  4MEQ A;  4I7D A;  5FE6 A;  1ZBD B;  4F1P A;  5TDR A;  3UV4 A;  4BJX A;  1E4U A;  2RNX A;  3PHD A;  4HXL A;  5DY7 A;  4YYK A;  3Q1D A;  5KH9 A;  3O34 A;  5E9K A;  4C9Z A;  2L5E A;  2B0O E;  5KTX A;  5D3H A;  4A9N A;  5LJ1 A;  5FFY A;  4NQN A;  4QR4 A;  2G6Q A;  4UYD A;  2L80 A;  4XUA A;  3ZNI A;  5I3L A;  1MM2 A;  4O7F A;  5CQ4 A;  4CUQ A;  5IID A;  3RTR B;  2NAA A;  5E9L A;  2QIZ A;  4QC3 A;  5H1T A;  1ZKR A;  5CRZ A;  4AKG A;  4RVR A;  3DWY A;  4AKI A;  5H85 A;  3KV5 A;  5ETD A;  3P1D A;  5DKA A;  3HCS A;  5TDW A;  5AD3 A;  5EK9 A;  4MR3 A;  3SOW A;  2CKL A;  5HCL A;  4ZQL A;  2RR4 A;  5J3X A;  5AMF A;  2KGG A;  2MA5 A;  5DW2 A;  2KIZ A;  3Q2F A;  5HEN A;  2DVS A;  4UIZ A;  3M99 A;  4LRG A;  5EI4 A;  5CQ5 A;  2L85 A;  3MB4 A;  4O70 A;  5F63 A;  2DVR A;  4MR4 A;  3IU6 A;  4O72 A;  4O7A A;  4OGJ A;  4WHW A;  5DFD A;  5FB0 A;  3LVR E;  5EA1 A;  2M1R A;  4N4H A;  5HFR A;  2LSP B;  4P5O B;  4A9K A;  5B79 A;  5FE0 A;  4J3I A;  5ENJ A;  4O74 A;  5ACY A;  1DCQ A;  4NS5 A;  2OUO A;  4YAB A;  3T9K A;  5C85 A;  4KV1 A;  2VPG A;  5C4Q A;  5DYC A;  3ZPV E;  1WEW A;  4Z0R A;  5E3G A;  5KO4 A;  4QSW A;  4L58 A;  5AIT A;  4E96 A;  5CUE A;  5D3T A;  3ZYQ A;  4MR5 A;  3GL6 A;  5FE3 A;  2EOD A;  4O75 A;  2YVR A;  3HMH A;  4WZ2 A;  5HQ5 A;  3L11 A;  1MBM A;  4MEP A;  4V3L C;  4GPJ A;  5ENC A;  4YYN A;  5I29 A;  3DDT A;  1X0J A;  5D3N A;  4A9O A;  3MDB C;  4WA6 A;  5FH7 A;  4UP0 A;  2CKL B;  5B77 A;  5F3A A;  5CUB A;  2D9E A;  5TRB A;  4PCI A;  5H1U A;  5E9Y A;  5FG5 A;  2JM3 A;  5B76 A;  3FL2 A;  4CUU A;  2DVQ A;  2KWK A;  4IR5 A;  3L1Z B;  4S3O C;  2LGG A;  3LQH A;  4IR6 A;  1Z60 A;  5LKT A;  5CPE A;  3G0J A;  5DW1 A;  4YBT A;  1VYX A;  1WUM A;  4N4F A;  2DWW A;  4QSX A;  5FE9 A;  3SHB A;  5LKZ A;  3U5N A;  2MNY A;  4HXK A;  5D1M B;  4LLB A;  4HBX A;  4A9I A;  2JRJ A;  5I86 A;  2LQ6 A;  4NR7 A;  5KTU A;  5FE5 A;  2OXQ C; 
#chains in the Genus database with same CATH homology
 2R0V A;  4X2I A;  2KTB B;  5CU8 A;  5I1Q A;  2AN6 A;  4UIU A;  2EGP A;  4O64 A;  4NRB A;  4BBQ A;  2GRC A;  4Q6F A;  1JSP B;  4NUE A;  2YT5 A;  4KV4 A;  4C66 A;  5C87 A;  5EGU A;  5EU1 A;  5C89 A;  2Y1N A;  3DPL R;  4GB0 A;  4YBM A;  5DYX A;  5H9M A;  4BHW A;  2ECJ A;  2RSD A;  4N4G A;  3N9O A;  1WEM A;  4C67 A;  4QEU A;  3JVK A;  4ZUX U;  4YC9 A;  5L98 A;  1K2F A;  4LZ2 A;  3UVX A;  3NG2 A;  5DYA A;  2C2V S;  1WFK A;  5E0R A;  5F61 A;  3UVW A;  2VPD A;  2RFJ A;  5KTW A;  3UV2 A;  5I7Y A;  4OUF A;  3C5K A;  5E3D A;  3JVM A;  5I83 A;  1FBV A;  5F2P A;  1X4U A;  3QZS A;  2VJE A;  4WHU A;  1HYI A;  2F6N A;  1LDJ B;  5IGK A;  4A9J A;  4QR5 A;  5CQT A;  1EQF A;  3U5P A;  1JM4 B;  4J1P A;  3VK6 A;  4Y03 A;  4TQN A;  2I7K A;  2KFT A;  4TS8 A;  1WES A;  5LVQ A;  2C2L A;  1XWH A;  3RPG C;  5HRV A;  4Z6I A;  5CFW A;  3PUR A;  2DX8 A;  5B78 A;  5LJ0 A;  3IU5 A;  1CHC A;  1X4J A;  5DBM A;  4GNF A;  4QB3 A;  2JMJ A;  5G0F A;  4CLB A;  5E9I A;  3U5K A;  1WEV A;  5EV9 A;  2LV9 A;  4I7B A;  4TTE A;  2OSS A;  4XYA A;  4A4B A;  4AUQ B;  5B8D A;  3GG3 A;  4XY9 A;  4TZ8 A;  4J0R A;  4LYS A;  4S3O B;  5D0C A;  2MD7 B;  3M62 A;  4AYC A;  5D24 A;  3O70 A;  3ASL A;  5CUA A;  5E73 A;  4BW3 A;  5BT3 A;  3T6R A;  2VJE B;  5B75 A;  4AKN A;  3S92 A;  5K29 A;  4HXM A;  3HME A;  2PUY A;  2VJF B;  4R2Y A;  5CQ3 A;  5EIS A;  5EWW A;  4W4U A;  4YYI A;  4HBW A;  3UW9 A;  4PTB A;  2XB1 A;  5ENE A;  4NXJ A;  4QBM A;  5C8G A;  2D8S A;  2KWN A;  1WEU A;  5D7X A;  2FUI A;  5EWC A;  4YK0 A;  4QUU A;  2LXP C;  5ETB A;  4NR6 A;  1FP0 A;  5C7N A;  5BT4 A;  2ECT A;  4LKA A;  5DLZ A;  5DFC A;  4O76 A;  3G0L A;  4NYX A;  2LGV A;  2L75 A;  4CUS A;  1IYM A;  4AVX A;  5DKC A;  3U5M A;  1WEO A;  4YY4 A;  4Z1S A;  3IHP A;  5LVR A;  1E6I A;  3O36 A;  5TB6 A;  5E9M A;  5D3S A;  4NQM A;  4PPE A;  4CA1 A;  4FK5 A;  2LN0 A;  3P5O A;  3KV6 A;  2R0S A;  4IOQ A;  4TZ2 A;  5F1H A;  2MJV B;  2E6S A;  2KWO A;  2YQM A;  1BOR A;  2ECI A;  4MSX A;  1N72 A;  3MQM A;  2I8N A;  1T1H A;  5J0D A;  2VPB A;  4QYL A;  4XI1 A;  4A9E A;  3EB5 A;  1WIM A;  4A9H A;  4HXS A;  4FO9 A;  3RPG B;  3EB6 A;  5FE8 A;  2KE1 A;  4QSP A;  3MUK A;  5FE1 A;  2LRI C;  2YQL A;  5JWM A;  5HQ7 A;  2M85 A;  3N9L A;  4AP4 A;  5EPS A;  5HM0 A;  4HXR A;  4QZS A;  2K4D A;  1WEP A;  3D7C A;  5AD2 A;  3DQV R;  5ENH A;  3LQI A;  4UP5 A;  3ZYU A;  5FE4 A;  4CL9 A;  4IOO A;  4BW4 A;  3ZVY A;  4YAD A;  5A5S A;  3O37 A;  3O33 A;  5FG4 A;  1N87 A;  2E7N A;  4I7C A;  1WE9 A;  2MUM A;  2LGK A;  3DAI A;  1WUG A;  4O77 A;  5DKH A;  4V3K C;  5C11 A;  2RI7 A;  4UI9 B;  5IG6 A;  3N9Q A;  4UIX A;  4N4I A;  4LDF A;  5DFB A;  2F42 A;  3FKM X;  4QSV A;  4UIV A;  4XY8 A;  2N9G A;  5KH7 A;  1G25 A;  4TYL A;  3U5O A;  4R8P K;  3AAD A;  4LR6 A;  4LYI A;  4NRA A;  2JMD A;  2WP1 A;  4O78 A;  1WEN A;  2ECG A;  4Z1Q A;  4NUD A;  5KH3 A;  5FH8 A;  4R7E A;  4QEW A;  2G4A A;  5CY9 A;  5FFV A;  4F3I A;  1VD4 A;  5D3P A;  5F25 A;  4LZS A;  4A9M A;  3HCU A;  4FLP A;  4ALG A;  3HMF A;  5CTL A;  4O7E A;  2K16 A;  5D26 A;  1JM7 A;  5HRW A;  4MEO A;  2L0B A;  3MUL A;  4YH3 A;  4UYE A;  4LK9 A;  4QF2 A;  4QNS A;  4NR5 A;  5CP5 A;  3O7A A;  2ECN A;  5L97 A;  4IR4 A;  5D1L B;  4PY6 A;  2E3K A;  5DYU A;  2CT2 A;  5II1 A;  1Z2Q A;  2KU3 A;  5F1L A;  2YQD A;  2H0D A;  5FER A;  2YUC A;  4PKL A;  2VPE A;  3U5L A;  5FG6 A;  3I2D A;  2YEK A;  3QZT A;  3UVY A;  4HXP A;  2YDW A;  3JVL A;  3HCT A;  2ECV A;  3N9N A;  5D3R A;  2Y43 A;  2K17 A;  4ZDT A;  3P1C A;  5G4S A;  3MB3 A;  5FEY A;  5FB1 A;  5DX4 A;  2WP2 A;  3MHS A;  4O71 A;  2L43 A;  5D3J A;  5A83 A;  3N9P A;  3LQJ A;  2RS9 B;  4YBS A;  4HXO A;  5D3L A;  4A9L A;  5LKU A;  3ZTG A;  4QSQ A;  4UIY A;  3L1X A;  4LJN A;  4QSS A;  4UIT A;  4QSU A;  5JI8 A;  1LDK C;  5I40 A;  1WEQ A;  2CSZ A;  2HDP A;  2PNX A;  4A9F A;  5E7D A;  4X3G A;  3ZPV 1;  4YY6 A;  2E7O A;  2LXH C;  5G04 B;  2QIC A;  4IC2 A;  2YSM A;  4LAD B;  2G43 A;  5A5O A;  2NXB A;  1VFY A;  2KGI A;  3S91 A;  4Q0O A;  5D25 A;  5TAB A;  4UYG A;  2IDA A;  4F52 B;  5JG6 A;  5LJ2 A;  4PS5 A;  3UVD A;  3AQA A;  5EP7 A;  5I7X A;  5IGN A;  4GNG A;  5F5Z A;  2R10 A;  5I88 A;  5CUD A;  4UYF A;  4TU4 A;  2YW8 A;  4BW2 A;  2G45 A;  4YAX A;  4NR9 A;  4HBV A;  2MD8 C;  3M63 A;  1JOC A;  1X4I A;  4QST A;  3KQI A;  2FSA A;  5EM3 A;  3HTK C;  1F62 A;  4HBY A;  4MEN A;  2F6J A;  4TT4 A;  5I89 A;  4A0C D;  4B86 C;  5CUC A;  5L8T A;  4NRC A;  4LC2 A;  4AYC B;  5CQ8 A;  5ENF A;  1WGM A;  3LXJ A;  4QSR A;  3MXF A;  5A5R A;  2LGL A;  2YEM A;  5HLS A;  2L84 A;  3K2J A;  4MVT A;  4O7B A;  4HXN A;  2M6M A;  1MM3 A;  4QY4 A;  3V43 A;  5G4R A;  4FJC A;  5A85 A;  5A81 A;  2MA6 A;  2KR4 A;  3PUQ A;  4CUT A;  4LYW A;  2DVV A;  5HEM A;  4NUC A;  5CQ7 A;  4YYM A;  2YU4 A;  2FUU A;  2BAY A;  2RNW A;  2RO1 A;  5EWH A;  5IGM A;  5KHM A;  4IC3 A;  4UYF B;  2YEL A;  3NXB A;  5ENI A;  2KRE A;  4A4C A;  4QEV A;  2UZG A;  1WIL A;  4YYH A;  5LUU A;  2ZET C;  5C13 A;  2EA6 A;  5LKX A;  2YW5 A;  5IGL A;  4QUT A;  5IBN A;  2MIQ A;  2QJ0 A;  2YYR A;  3SOU A;  3N9M A;  5BT5 A;  2KYU A;  5LCW B;  3I3J A;  4J0S A;  2RNY A;  4WZ0 A;  1HYJ A;  5CQA A;  2I50 A;  4QC1 A;  4CCG X;  3JVJ A;  4UIW A;  5F36 A;  2YHN A;  1U6G B;  4NYV A;  5HJC A;  5D1K B;  1ZS5 A;  5DKD A;  4QF3 A;  5G05 B;  3SOX A;  5TBN A;  5EYA F;  5I80 A;  3SVF A;  2YUR A;  4N3W A;  3ZVZ B;  4CFK A;  5AIU A;  3UV5 A;  3SVH A;  5FBX A;  2ECW A;  4GND A;  4WIV A;  5FFW A;  1RMD A;  5L99 A;  5TCM A;  5HEL A;  2VNF A;  4NYW A;  4UYH A;  4O7C A;  4YAT A;  5H1V A;  2HYE D;  3SVG A;  4QYD A;  5CRM A;  4BW1 A;  5E9V A;  4GNE A;  4B7Y C;  5FE7 A;  5EPB A;  5FE2 A;  5A82 A;  4NR8 A;  1Z6U A;  2L5U A;  3C6W A;  5A5Q A;  2MNZ A;  5A7C A;  4OGI A;  2KWJ A;  4YH4 A;  2OO1 A;  5EPR A;  5L8U A;  5F60 A;  2VP7 A;  5HRX A;  4XUB A;  4ALH A;  4Q0N A;  3TLP A;  2DAT A;  3U5J A;  4Z6H A;  2CSY A;  5EIC A;  4IOR A;  2E6R A;  5II2 A;  5CGP A;  2LDR A;  3QZV A;  3KNV A;  4L7X A;  5EWD A;  2YYN A;  4ZC9 A;  4YYD A;  1DVP A;  2JMI A;  4LZR A;  5EQ1 A;  4MR6 A;  5KU3 A;  3LRQ A;  4DON A;  5CS8 A;  1F68 A;  1WEE A;  4TT6 A;  4YYG A;  4TT2 A;  4PCE A;  5CZG A;  4CFL A;  4NN2 A;  2YHO A;  3MHH A;  3T7L A;  5ENB A;  4CUP A;  4IR3 A;  3LJW A;  2H60 A;  4A49 A;  2M3H A;  4NR4 A;  2K1J A;  4CUR A;  5EVA A;  5EWV A;  4YYJ A;  2XEU A;  3GV4 A;  4QR3 A;  5AME A;  4KCX A;  3O35 A;  4ZW1 A;  5FDZ A;  5A5P A;  2VJF A;  4TU6 A;  4FIP A;  5CQ6 A;  1JM7 B;  5HQ6 A;  5DIN A;  2D82 A;  1V87 A;  2Y1M A;  5FH6 A;  2DKW A;  5CUG A;  5A5N A;  5DLX A;  5COI A;  5F62 A;  2MT5 A;  2YRE A;  5L96 A;  3RCW A;  5HFQ A;  2YSJ A;  4TKP B;  5E74 A;  3P1E A;  3ONI A;  2R0Y A;  5ENG A;  2H0D B;  3P1F A;  4WZ3 B;  3Q2E A;  4Z93 A;  4MEQ A;  4I7D A;  5FE6 A;  1ZBD B;  5TDR A;  3UV4 A;  4BJX A;  1E4U A;  2RNX A;  3PHD A;  4HXL A;  5DY7 A;  4YYK A;  5KH9 A;  3O34 A;  5E9K A;  4C9Z A;  2L5E A;  5KTX A;  5D3H A;  4A9N A;  5LJ1 A;  5FFY A;  4NQN A;  4QR4 A;  2G6Q A;  4UYD A;  2L80 A;  4XUA A;  3ZNI A;  5I3L A;  1MM2 A;  4O7F A;  5CQ4 A;  4CUQ A;  5IID A;  3RTR B;  2NAA A;  5E9L A;  2QIZ A;  4QC3 A;  5H1T A;  5CRZ A;  4RVR A;  3DWY A;  5H85 A;  3KV5 A;  5ETD A;  3P1D A;  5DKA A;  3HCS A;  5TDW A;  5AD3 A;  5EK9 A;  4MR3 A;  3SOW A;  2CKL A;  5HCL A;  4ZQL A;  5J3X A;  5AMF A;  2KGG A;  2MA5 A;  5DW2 A;  2KIZ A;  3Q2F A;  5HEN A;  2DVS A;  4UIZ A;  3M99 A;  4LRG A;  5EI4 A;  5CQ5 A;  2L85 A;  3MB4 A;  4O70 A;  5F63 A;  2DVR A;  4MR4 A;  3IU6 A;  4O72 A;  4O7A A;  4OGJ A;  4WHW A;  5DFD A;  5FB0 A;  5EA1 A;  2M1R A;  4N4H A;  5HFR A;  2LSP B;  4P5O B;  4A9K A;  5B79 A;  5FE0 A;  4J3I A;  5ENJ A;  4O74 A;  5ACY A;  4NS5 A;  2OUO A;  4YAB A;  5C85 A;  4KV1 A;  2VPG A;  5C4Q A;  5DYC A;  3ZPV E;  1WEW A;  5E3G A;  5KO4 A;  4QSW A;  4L58 A;  5AIT A;  4E96 A;  5CUE A;  5D3T A;  3ZYQ A;  4MR5 A;  3GL6 A;  5FE3 A;  2EOD A;  4O75 A;  3HMH A;  4WZ2 A;  5HQ5 A;  3L11 A;  4MEP A;  4V3L C;  4GPJ A;  5ENC A;  4YYN A;  5I29 A;  1X0J A;  5D3N A;  4A9O A;  4WA6 A;  5FH7 A;  4UP0 A;  2CKL B;  5B77 A;  5F3A A;  5CUB A;  2D9E A;  5TRB A;  4PCI A;  5H1U A;  5E9Y A;  5FG5 A;  5B76 A;  3FL2 A;  4CUU A;  2DVQ A;  2KWK A;  4IR5 A;  3L1Z B;  4S3O C;  2LGG A;  3LQH A;  4IR6 A;  1Z60 A;  5LKT A;  5CPE A;  3G0J A;  5DW1 A;  4YBT A;  1VYX A;  1WUM A;  4N4F A;  2DWW A;  4QSX A;  5FE9 A;  3SHB A;  5LKZ A;  3U5N A;  2MNY A;  4HXK A;  5D1M B;  4LLB A;  4HBX A;  4A9I A;  2JRJ A;  5I86 A;  2LQ6 A;  4NR7 A;  5KTU A;  5FE5 A;  2OXQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...