3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
2LXPC 4TU4A 5CUBA 4BW4A 2YQLA 4QYLA 4FIPA 5FE4A 2E7OA 2RFJA 4QSSA 5LVRA 2C2VS 5E74A 5HLSA 5C85A 2I8NA 5FE9A 5KU3A 4O71A 5FH7A 1WEQA 5B79A 2IDAA 1VD4A 4PPEA 2YT5A 5ENJA 5HENA 4UIYA 4QNSA 5IGMA 4O7AA 5CQ4A 2LV9A 5CUCA 5ENCA 2MIQA 2PNXA 3U5JA 5FB1A 5HQ5A 5HM0A 5I7XA 3ZYQA 2EGPA 5EWDA 4X2IA 2YQDA 3GV4A 5HQ6A 5LUUA 2E6RA 4A9FA 5HEMA 1T1HA 4MSXA 4N3WA 3N9PA 4TT6A 5C8GA 5A82A 2KR4A 3N9MA 1E4UA 3S92A 1WEEA 5IGNA 5FE8A 5J0DA 5K29A 4NR6A 4L7XA 4LLBA 4A9HA 3D7CA 5I83A 2YURA 4A4BA 5ETBA 2VJFA 2WP1A 4A9NA 3I2DA 5TABA 4IOQA 5H1VA 5G4RA 4YYKA 5KTUA 4MEPA 5E73A 4CLBA 5A5PA 4TKPB 2LN0A 3FKMX 2FSAA 2CT2A 4QSQA 2YW8A 2VPBA 5IBNA 2L0BA 5DKHA 3U5MA 2CKLA 4HBWA 1F68A 5CFWA 2YW5A 4UYFB 4YY6A 3ZYUA 4UYFA 4CUUA 3MUKA 4NR5A 1WEWA 1JSPB 3ASLA 4CFLA 4XUAA 2N9GA 4V3KC 2MA6A 3P5OA 4QSVA 4AYCB 1N72A 5L99A 4PCIA 2DVRA 2FUUA 4C66A 2KYUA 3LQIA 4TYLA 4YAXA 2K4DA 2JRJA 5D1LB 1VYXA 2YQMA 2RNXA 3O37A 3LJWA 5EI4A 2ECIA 3GG3A 3O36A 2F6NA 4TT2A 4CUPA 5FB0A 5CGPA 4YBMA 4O72A 4TQNA 5EPSA 1WIMA 3IU6A 3V43A 2Y1NA 5KHMA 5ACYA 4TZ2A 3L1ZB 4L58A 4R7EA 5L8TA 4NQNA 3MULA 5C87A 4LJNA 5L8UA 3U5PA 4O7BA 4QR4A 5ENFA 2ECJA 2MD7B 5ENBA 1Z2QA 2HDPA 4PY6A 4A9JA 5C89A 1XWHA 5C4QA 5B78A 4HXSA 5HCLA 4GPJA 2M1RA 4YBTA 4GNEA 1JM7A 2G43A 5DYAA 2YDWA 4HXRA 4ALGA 5KTWA 2H60A 2QJ0A 2RS9B 5LKUA 2KIZA 3C6WA 4WZ0A 4BW3A 4YYDA 1IYMA 5A81A 3SOUA 4BBQA 5D1MB 4KV4A 1WENA 3ZNIA 4ZC9A 3LQJA 4RVRA 2QIZA 3AADA 3RPGB 4UP0A 3O35A 2D8SA 2JMJA 5CZGA 5TBNA 2L80A 4QF2A 2L5EA 4QZSA 4HBVA 4CL9A 4UYHA 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 5DBMA 5AMFA 5FG6A 4N4GA 4UYGA 1X0JA 4O7FA 4XY8A 2R0YA 4Y03A 5EVAA 2E6SA 5F1HA 2LXHC 2VJEB 4NS5A 4FK5A 4FJCA 4WA6A 5D3NA 4YYIA 5DLXA 2LGVA 1JM7B 4LYIA 5L98A 5AITA 5LKTA 5H1UA 5I86A 5DFDA 2YEMA 4N4FA 2I7KA 3MB3A 5H85A 3JVJA 4LKAA 3PURA 3SVGA 4MR5A 4NYVA 5EICA 5FE0A 2YU4A 4J3IA 5FFYA 3S91A 2KWNA 5B8DA 4P5OB 2NXBA 5E9LA 1WGMA 4A49A 4QEVA 5JWMA 4O70A 2YHNA 4MEOA 5BT4A 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 5BT5A 2DVSA 4XI1A 2G6QA 2ECTA 5A5NA 3HCTA 5HRXA 2KWOA 4QY4A 2HYED 4WZ3B 3TLPA 4GNFA 5D7XA 5D3LA 5L97A 5A5SA 2Y1MA 3MB4A 5ENEA 3O34A 2YUCA 5E3DA 5CY9A 2VJEA 2YREA 3U5OA 3LXJA 5CRMA 2EA6A 4MR4A 2R0VA 5CQ7A 5LJ1A 2ECGA 5G4SA 3PHDA 5EM3A 2ECWA 4NN2A 5LJ0A 4CFKA 2MNYA 3MHHA 5I3LA 4Z6IA 5EV9A 4I7BA 2LGLA 1K2FA 5I7YA 3MXFA 5A83A 4LR6A 5FDZA 4A9LA 5D0CA 3P1FA 4HXMA 5HRWA 3NG2A 3M62A 4NRCA 3FL2A 3O7AA 5EPBA 4HBYA 3U5NA 5G05B 2K17A 2YHOA 2F6JA 4YH4A 2OXQC 4WZ2A 3MQMA 1X4IA 5COIA 1JOCA 2KREA 2M6MA 4J0SA 2PUYA 3SVHA 4FO9A 4O74A 4XYAA 5E9KA 4C9ZA 4YADA 4O7CA 4YC9A 4UP5A 4PS5A 3HMFA 4Q6FA 4QSPA 4OGJA 3UV5A 5LKZA 5HQ7A 2LGKA 2VPDA 2G4AA 5EYAF 5CQAA 4IR3A 4YYHA 4UYDA 4B86C 4Q0NA 4IORA 4LK9A 1FP0A 3DAIA 2YYRA 5I40A 5FFVA 4YATA 5C13A 2MJVB 4LC2A 1RMDA 4ZUXU 4NR4A 3ONIA 4WHUA 5DW1A 2YELA 3SHBA 4IOOA 3Q2FA 4NYXA 3UVXA 5G04B 2VP7A 4UIUA 3N9OA 5DX4A 4BJXA 5TB6A 1WESA 1MM2A 2YEKA 5DKDA 5DYUA 5FH8A 2LDRA 2DWWA 4QEUA 5KH9A 4QR3A 4Z93A 5F2PA 5I89A 1FBVA 5CUGA 4PKLA 2XEUA 4IR4A 3C5KA 5FE3A 3DQVR 1Z6UA 3RTRB 4QUUA 2ZETC 4UIXA 4TU6A 5I1QA 4HXOA 4GNDA 4NRAA 5D3SA 2L85A 5DFBA 5E3GA 4YYGA 4QR5A 4A9OA 4FLPA 3L1XA 4NR9A 4HXKA 5E0RA 5ENHA 5IGKA 1WILA 3RPGC 4AVXA 5D24A 4PTBA 5C7NA 2BAYA 4QF3A 5TRBA 4A9EA 4XY9A 4HXLA 5TCMA 5KH7A 5E9YA 5B76A 5H1TA 4UIWA 2WP2A 5EWCA 4E96A 4GB0A 5E9VA 4LZSA 1WEOA 2DATA 4TS8A 5A85A 4WIVA 4MEQA 3UV4A 5EWVA 4LZRA 5FBXA 4LDFA 4I7DA 5CUDA 3EB5A 4LADB 4GNGA 4F52B 2YSJA 3O70A 2VPGA 4QUTA 5G0FA 5HJCA 3ZPV1 5KTXA 5DFCA 1WEMA 5AMEA 5A7CA 2CKLB 5D3JA 4LRGA 4J1PA 2R0SA 5CRZA 1VFYA 2RI7A 5E9MA 4QC1A 1LDJB 2MUMA 2F42A 4NXJA 5F1LA 1HYJA 1WEPA 2KU3A 2RSDA 5ETDA 5F62A 2AN6A 4AYCA 5CQ8A 4QB3A 5DINA 5D25A 2KFTA 1LDKC 3N9LA 4N4IA 5DKCA 3QZTA 3U5KA 4CURA 4UIZA 5F61A 5EWWA 5FH6A 5I80A 2E7NA 4PCEA 3P1DA 5II1A 5B75A 5KO4A 5CQ3A 2LQ6A 2RNWA 3GL6A 5KH3A 5DY7A 5EA1A 2KGIA 4R8PK 4I7CA 2M3HA 1WUGA 3NXBA 3UW9A 3P1CA 5CTLA 4Z1SA 4CUTA 5HFRA 5AD3A 5EQ1A 5I88A 1WUMA 2DX8A 1BORA 3HCUA 4S3OB 4F3IA 5CQ6A 4QSWA 2ECVA 2LGGA 3Q2EA 3KNVA 3M99A 4CUSA 4Z1QA 5D1KB 5CPEA 5FE1A 5EWHA 4MENA 5F5ZA 5C11A 2QICA 5IGLA 2KE1A 3HMHA 2E3KA 4A9IA 1WEUA 2Y43A 4IR6A 2DKWA 3ZVYA 4YYNA 2MA5A 2I50A 2OO1A 5II2A 5E7DA 3JVLA 4NUCA 5I29A 1WEVA 2DVQA 4UI9B 3KV6A 5FE5A 3T7LA 5CS8A 5AIUA 5IIDA 5FE2A 1ZBDB 4Z6HA 5F25A 5A5OA 5ENGA 4BW1A 2L5UA 2JMIA 2LRIC 5F36A 5D3RA 4BHWA 3JVMA 4CUQA 5BT3A 4NUEA 4O78A 2EODA 4J0RA 4O64A 5F60A 2R10A 4WHWA 3L11A 5DYCA 4IR5A 3HTKC 4MR6A 1JM4B 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 5L96A 5D26A 5DW2A 4AP4A 4ZQLA 3QZSA 3HCSA 4R2YA 5E9IA 4A9MA 5D3HA 4ALHA 1E6IA 2KGGA 1U6GB 3G0JA 5FFWA 2VJFB 3G0LA 5LVQA 3LQHA 4AUQB 4HBXA 1MM3A 4MVTA 2L84A 4QSRA 4TT4A 1X4UA 5EU1A 4YABA 4YH3A 1DVPA 3PUQA 5AD2A 3DWYA 2XB1A 2G45A 2UZGA 4KCXA 5EGUA 2NAAA 4CCGX 2ECNA 2K1JA 5FG4A 2RO1A 4CA1A 2OUOA 3KV5A 2KWJA 3UV2A 1X4JA 4QYDA 3KQIA 4B7YC 5EK9A 5LJ2A 3N9NA 4UYEA 5FERA 4TTEA 4A4CA 2YSMA 3SVFA 3M63A 5CU8A 4AKNA 2VNFA 3N9QA 4A0CD 4XUBA 4O75A 3DPLR 4QSUA 4YYJA 4O76A 5FEYA 3VK6A 5EP7A 2MT5A 4QSTA 2C2LA 3LRQA 3ZPVE 2D82A 4YK0A 4KV1A 4LYWA 3HMEA 4N4HA 4YBSA 2H0DA 2YYNA 4ZDTA 3I3JA 3P1EA 4IC2A 5HFQA 5F63A 4YY4A 5ENIA 5CUAA 4YYMA 5LKXA 4DONA 5DLZA 2GRCA 4TZ8A 2D9EA 5JI8A 5H9MA 3IHPA 4HXNA 4QC3A 2CSYA 2KWKA 4IC3A 3JVKA 4NQMA 4QSXA 5FG5A 2L43A 2RNYA 5D3TA 5CQTA 3UVWA 4HXPA 4UITA 1G25A 4NR7A 3U5LA 4LYSA 4A9KA 1N87A 1ZS5A 4QEWA 4OGIA 5A5RA 3UVDA 3IU5A 4O77A 1WE9A 5D3PA 3ZVZB 5FE6A 4S3OC 4QBMA 4Q0OA 3O33A 4BW2A 3ZTGA 4OUFA 5HRVA 5EPRA 4NRBA 4MR3A 1CHCA 1WFKA 2LSPB 4O7EA 2MNZA 5EISA 2H0DB 2OSSA 3K2JA 4NUDA 1V87A 1EQFA 2JMDA 5LCWB 2L75A 3UVYA 4C67A 3RCWA 5F3AA 5A5QA 5FE7A 2CSZA 2VPEA 4NYWA 3MHSA 4X3GA 5CQ5A 5CP5A 5CUEA 2M85A 4UIVA 5HELA 3SOXA 5B77A 2DVVA 2KTBB 3T6RA 4ZW1A 5IG6A 3AQAA 4LZ2A 4NR8A 5DYXA 1Z60A
chains in the Genus database with same CATH superfamily
2LXPC 4TU4A 5CUBA 4BW4A 2YQLA 4QYLA 3D1DA 4FIPA 5FE4A 2E7OA 2RFJA 3PLWA 4QSSA 5LVRA 2C2VS 5E74A 5HLSA 5C85A 2I8NA 5FE9A 5KU3A 4O71A 5FH7A 1WEQA 5B79A 2IDAA 2B0OE 5SVIA 1VD4A 4PPEA 2YT5A 5ENJA 5HENA 4UIYA 4QNSA 5IGMA 4O7AA 5CQ4A 2LV9A 5CUCA 5ENCA 2MIQA 2PNXA 3U5JA 3M7KA 5FB1A 5HQ5A 5SVYA 2CONA 5HM0A 2XP0A 5I7XA 4H9DA 3ZYQA 2EGPA 5EWDA 4X2IA 2YQDA 3GV4A 5HQ6A 5LUUA 2E6RA 4A9FA 5HEMA 1T1HA 4MSXA 4N3WA 3N9PA 4TT6A 5C8GA 5A82A 2KR4A 3N9MA 1E4UA 3S92A 1WEEA 5IGNA 5FE8A 5J0DA 5K29A 4NR6A 4L7XA 4LLBA 5K3QA 4A9HA 3D7CA 5I83A 2YURA 4A4BA 5ETBA 2VJFA 2WP1A 4A9NA 2XOCA 3I2DA 2FFWA 5TABA 4IOQA 2CRWA 5H1VA 5G4RA 4YYKA 5KTUA 4MEPA 5E73A 4CLBA 5A5PA 2FD4A 4TKPB 2LN0A 3FKMX 2FSAA 2CT2A 4QSQA 2YW8A 2VPBA 5IBNA 2L0BA 5DKHA 3U5MA 4Z0RA 2CKLA 4HBWA 1F68A 5CFWA 2YW5A 4UYFB 4YY6A 3ZYUA 4UYFA 4CUUA 3MUKA 4NR5A 1WEWA 1JSPB 3ASLA 4CFLA 4XUAA 2N9GA 4V3KC 2MA6A 3E2DA 3P5OA 4QSVA 4AYCB 3SUBA 1N72A 5L99A 4PCIA 2DVRA 2EJNA 4C66A 2FUUA 3LQIA 4TYLA 4YAXA 2K4DA 2JRJA 2KYUA 3H7HA 1VYXA 5D1LB 2IQJA 2YQMA 2RNXA 3O37A 3LJWA 5EI4A 2ECIA 3GG3A 3O36A 2F6NA 4TT2A 4CUPA 5FB0A 5CGPA 4YBMA 4O72A 4TQNA 3O47A 5EPSA 1WIMA 3IU6A 3V43A 2Y1NA 3FM8C 5KHMA 5ACYA 4TZ2A 3L1ZB 4L58A 4R7EA 5L8TA 4Z0OA 4NQNA 3MULA 5C87A 4LJNA 5L8UA 3U5PA 4O7BA 4QR4A 5ENFA 2ECJA 2MD7B 5ENBA 1Z2QA 2HDPA 4PY6A 4A9JA 5C89A 1XWHA 5C4QA 5B78A 4HXSA 5HCLA 4GPJA 2M1RA 4YBTA 4GNEA 1JM7A 2G43A 5DYAA 2YDWA 4HXRA 4ALGA 5KTWA 3T9KA 2H60A 2QJ0A 2RS9B 5LKUA 2KIZA 3C6WA 4WZ0A 4BW3A 4YYDA 1IYMA 5A81A 3SOUA 4BBQA 5D1MB 4KV4A 1WENA 3ZNIA 4ZC9A 3LQJA 4RVRA 2QIZA 3AADA 3RPGB 4UP0A 3O35A 2D8SA 2JMJA 5SVIB 5CZGA 5TBNA 2L80A 3DDTA 4QF2A 2L5EA 4QZSA 4HBVA 4CL9A 4UYHA 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 5DBMA 5AMFA 4OGEA 5FG6A 4N4GA 4UYGA 1X0JA 4O7FA 4XY8A 2R0YA 4Y03A 5EVAA 2E6SA 5F1HA 2LXHC 2VJEB 4NS5A 4FK5A 4FJCA 4WA6A 5D3NA 4YYIA 5DLXA 2LGVA 1JM7B 4LYIA 5L98A 5AITA 5LKTA 2P57A 5H1UA 5I86A 5DFDA 2YEMA 4N4FA 2I7KA 3MB3A 5H85A 3JVJA 4LKAA 3PURA 3SVGA 4MR5A 4NYVA 5EICA 5FE0A 2YU4A 4J3IA 5FFYA 3S91A 2KWNA 5B8DA 4P5OB 2NXBA 5E9LA 1WGMA 4A49A 4QEVA 5JWMA 4O70A 2YHNA 2MKEA 2CSVA 4MEOA 5BT4A 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 5BT5A 2DVSA 2JUNA 4XI1A 2G6QA 2ECTA 5A5NA 3HCTA 5HRXA 2JM3A 2KWOA 2RR4A 4QY4A 2HYED 4WZ3B 3TLPA 1ZKRA 4GNFA 5D7XA 5D3LA 5L97A 5A5SA 2Y1MA 3MB4A 5ENEA 3O34A 2YUCA 5E3DA 5CY9A 2VJEA 2YREA 3U5OA 3LXJA 5CRMA 2EA6A 1DCQA 4MR4A 2R0VA 5CQ7A 5LJ1A 2ECGA 5G4SA 3PHDA 1PUOA 5EM3A 2ECWA 5LJ0A 4CFKA 2MNYA 3MHHA 4NN2A 5I3LA 3Q1DA 4Z6IA 5EV9A 4I7BA 2LGLA 1K2FA 5I7YA 3MXFA 5A83A 4LR6A 5FDZA 4A9LA 5D0CA 3P1FA 4HXMA 5HRWA 3NG2A 2KKYA 3M62A 4NRCA 3FL2A 3O7AA 5EPBA 4HBYA 3U5NA 5G05B 2K17A 2YHOA 2F6JA 4YH4A 2OXQC 4WZ2A 3MQMA 1X4IA 5COIA 1JOCA 2KREA 2M6MA 4J0SA 2PUYA 3SVHA 4FO9A 4O74A 4XYAA 5E9KA 3VKHA 2LAUA 4YADA 4C9ZA 4O7CA 4YC9A 4UP5A 4PS5A 3HMFA 4Q6FA 4QSPA 4OGJA 3UV5A 5LKZA 5HQ7A 2LGKA 2VPDA 2G4AA 5EYAF 5CQAA 4IR3A 4YYHA 4UYDA 4B86C 4Q0NA 4IORA 4LK9A 1FP0A 3DAIA 2YYRA 5I40A 5FFVA 4YATA 5C13A 2MJVB 4LC2A 1RMDA 4ZUXU 4NR4A 3ONIA 4WHUA 5DW1A 2YELA 3SHBA 4IOOA 3Q2FA 4NYXA 3UVXA 5G04B 2VP7A 4UIUA 3N9OA 5DX4A 3FAOA 4BJXA 5TB6A 1WESA 1MM2A 2YEKA 5DKDA 5DYUA 5FH8A 2LDRA 2L7PA 2DWWA 4QEUA 5KH9A 4QR3A 4Z93A 5F2PA 5I89A 1FBVA 5CUGA 4PKLA 2XEUA 4IR4A 3C5KA 5FE3A 3DQVR 1Z6UA 3RTRB 4QUUA 3FEHA 3KDEC 2ZETC 4UIXA 4TU6A 5I1QA 4HXOA 4AKGA 4GNDA 4NRAA 5D3SA 2L85A 5DFBA 5E3GA 4YYGA 4QR5A 4A9OA 4FLPA 3L1XA 4NR9A 4HXKA 5E0RA 5ENHA 5IGKA 1WILA 3RPGC 4AVXA 5D24A 4PTBA 5C7NA 2BAYA 4QF3A 3LDYA 5TRBA 4A9EA 4XY9A 4HXLA 5TCMA 5KH7A 5E9YA 5B76A 5H1TA 4UIWA 2WP2A 5EWCA 4E96A 4GB0A 5E9VA 4LZSA 1WEOA 2DATA 4TS8A 5A85A 3LJUX 4WIVA 4MEQA 3UV4A 5EWVA 4LZRA 5FBXA 4LDFA 4I7DA 5CUDA 3EB5A 4LADB 4GNGA 4F52B 2M13A 2YSJA 2VPGA 4QUTA 3O70A 5G0FA 5HJCA 3ZPV1 5KTXA 5DFCA 1WEMA 5AMEA 3MDBC 5A7CA 2CKLB 5D3JA 4LRGA 4J1PA 2D8UA 2R0SA 5CRZA 1VFYA 2RI7A 5E9MA 4QC1A 1LDJB 2MUMA 2F42A 4NXJA 5F1LA 1HYJA 1WEPA 3LVQE 2KU3A 2RSDA 5ETDA 5F62A 2AN6A 4AYCA 5CQ8A 4QB3A 4QQ4A 5D25A 2KFTA 5DINA 1LDKC 3N9LA 4N4IA 5DKCA 3QZTA 3U5KA 4CURA 4UIZA 5F61A 4O62A 5EWWA 5FH6A 5I80A 2E7NA 4PCEA 3P1DA 5II1A 5B75A 5KO4A 5CQ3A 2LQ6A 2RNWA 3GL6A 5KH3A 5DY7A 5EA1A 2KGIA 4R8PK 4I7CA 4AKIA 2M3HA 1WUGA 3NXBA 3UW9A 3P1CA 4OGCA 5CTLA 4Z1SA 4CUTA 5HFRA 5AD3A 5EQ1A 5I88A 1WUMA 2DX8A 1BORA 3HCUA 4S3OB 4F3IA 3JUEA 5CQ6A 4QSWA 2ECVA 2LGGA 3Q2EA 3KNVA 3M99A 4CUSA 4Z1QA 5D1KB 5CPEA 5FE1A 5EWHA 4MENA 5F5ZA 5C11A 2QICA 5IGLA 2KE1A 3HMHA 2E3KA 4A9IA 1WEUA 2Y43A 4IR6A 2DKWA 3ZVYA 4YYNA 3DWDA 2MA5A 2I50A 2KKXA 3LVRE 2OO1A 5II2A 5E7DA 3JVLA 4NUCA 5I29A 1WEVA 2DVQA 4UI9B 3KV6A 2DSMA 5FE5A 3T7LA 5CS8A 5AIUA 5IIDA 5FE2A 1ZBDB 4Z6HA 5F25A 5A5OA 5ENGA 4BW1A 2L5UA 2JMIA 2LRIC 5F36A 5D3RA 4BHWA 3JVMA 4CUQA 5BT3A 4NUEA 4O78A 2DJAA 2EODA 4J0RA 4O64A 5F60A 2R10A 4WHWA 3L11A 5DYCA 4IR5A 3HTKC 4MR6A 1JM4B 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 5L96A 5D26A 5DW2A 3FJUB 4AP4A 2XOYA 4ZQLA 3QZSA 3HCSA 4R2YA 5E9IA 4A9MA 5D3HA 4ALHA 1E6IA 2KGGA 1U6GB 3G0JA 5FFWA 2VJFB 3G0LA 5LVQA 3LQHA 4AUQB 4HBXA 1MM3A 2EGMA 4MVTA 2L84A 4QSRA 4TT4A 1X4UA 5EU1A 4YABA 4YH3A 1DVPA 3PUQA 5AD2A 3DWYA 2XB1A 2G45A 2UZGA 4KCXA 5EGUA 2NAAA 4CCGX 2ECNA 2K1JA 5FG4A 2RO1A 4CA1A 2OUOA 2CRRA 3KV5A 2KWJA 3UV2A 1X4JA 4QYDA 3KQIA 4B7YC 5EK9A 5LJ2A 3N9NA 4UYEA 5FERA 4TTEA 4A4CA 2YSMA 3SVFA 3M63A 5CU8A 4AKNA 2VNFA 3N9QA 4A0CD 4XUBA 4O75A 3DPLR 4QSUA 4YYJA 4O76A 5FEYA 3VK6A 5EP7A 2MT5A 4QSTA 2C2LA 3LRQA 3ZPVE 4AKHA 2D82A 2YVRA 4YK0A 4KV1A 4LYWA 3ERRA 3HMEA 4N4HA 4YBSA 2H0DA 2YYNA 4ZDTA 3I3JA 3P1EA 4IC2A 5HFQA 5F63A 4YY4A 5ENIA 5CUAA 4YYMA 5LKXA 4DONA 5DLZA 2GRCA 4TZ8A 2D9EA 5JI8A 5H9MA 3IHPA 4HXNA 4QC3A 2CSYA 2KWKA 3FANA 3JVKA 4IC3A 4NQMA 4QSXA 3D1BA 5FG5A 2E61A 2L43A 2RNYA 5D3TA 5CQTA 3UVWA 4HXPA 4UITA 1G25A 2OWAA 4NR7A 3U5LA 4LYSA 4A9KA 1N87A 2XOZA 1ZS5A 4QEWA 4OGIA 5A5RA 3UVDA 3IU5A 4O77A 1WE9A 5D3PA 3ZVZB 5FE6A 4S3OC 4QBMA 4Q0OA 3O33A 4BW2A 3ZTGA 4OUFA 5HRVA 5EPRA 4NRBA 4MR3A 1CHCA 1WFKA 2LSPB 4O7EA 2MNZA 4F1PA 5EISA 2H0DB 2OSSA 3K2JA 4NUDA 1V87A 1EQFA 4AI6A 2JMDA 2L75A 5LCWB 2EXUA 3UVYA 4C67A 3RCWA 5F3AA 5A5QA 5FE7A 2CSZA 2VPEA 4NYWA 3MHSA 4X3GA 5CQ5A 5CP5A 5CUEA 2M85A 4UIVA 5HELA 5SVXA 1MBMA 3SOXA 3VKGA 5B77A 2DVVA 2KTBB 3T6RA 4ZW1A 5IG6A 3AQAA 4LZ2A 4NR8A 5DYXA 1Z60A
chains in the Genus database with same CATH topology
2LXPC 4TU4A 5CUBA 4BW4A 2YQLA 4QYLA 4FIPA 5FE4A 2E7OA 2RFJA 4QSSA 5LVRA 2C2VS 5E74A 5HLSA 5C85A 2I8NA 5FE9A 5KU3A 4O71A 5FH7A 1WEQA 5B79A 2IDAA 1VD4A 4PPEA 2YT5A 5ENJA 5HENA 4UIYA 4QNSA 5IGMA 4O7AA 5CQ4A 2LV9A 5CUCA 5ENCA 2MIQA 2PNXA 3U5JA 5FB1A 5HQ5A 5HM0A 5I7XA 3ZYQA 2EGPA 5EWDA 4X2IA 2YQDA 3GV4A 5HQ6A 5LUUA 2E6RA 4A9FA 5HEMA 1T1HA 4MSXA 4N3WA 3N9PA 4TT6A 5C8GA 5A82A 2KR4A 3N9MA 1E4UA 3S92A 1WEEA 5IGNA 5FE8A 5J0DA 5K29A 4NR6A 4L7XA 4LLBA 4A9HA 3D7CA 5I83A 2YURA 4A4BA 5ETBA 2VJFA 2WP1A 4A9NA 3I2DA 5TABA 4IOQA 5H1VA 5G4RA 4YYKA 5KTUA 4MEPA 5E73A 4CLBA 5A5PA 4TKPB 2LN0A 3FKMX 2FSAA 2CT2A 4QSQA 2YW8A 2VPBA 5IBNA 2L0BA 5DKHA 3U5MA 2CKLA 4HBWA 1F68A 5CFWA 2YW5A 4UYFB 4YY6A 3ZYUA 4UYFA 4CUUA 3MUKA 4NR5A 1WEWA 1JSPB 3ASLA 4CFLA 4XUAA 2N9GA 4V3KC 2MA6A 3P5OA 4QSVA 4AYCB 1N72A 5L99A 4PCIA 2DVRA 2FUUA 4C66A 2KYUA 3LQIA 4TYLA 4YAXA 2K4DA 2JRJA 5D1LB 1VYXA 2YQMA 2RNXA 3O37A 3LJWA 5EI4A 2ECIA 3GG3A 3O36A 2F6NA 4TT2A 4CUPA 5FB0A 5CGPA 4YBMA 4O72A 4TQNA 5EPSA 1WIMA 3IU6A 3V43A 2Y1NA 5KHMA 5ACYA 4TZ2A 3L1ZB 4L58A 4R7EA 5L8TA 4NQNA 3MULA 5C87A 4LJNA 5L8UA 3U5PA 4O7BA 4QR4A 5ENFA 2ECJA 2MD7B 5ENBA 1Z2QA 2HDPA 4PY6A 4A9JA 5C89A 1XWHA 5C4QA 5B78A 4HXSA 5HCLA 4GPJA 2M1RA 4YBTA 4GNEA 1JM7A 2G43A 5DYAA 2YDWA 4HXRA 4ALGA 5KTWA 2H60A 2QJ0A 2RS9B 5LKUA 2KIZA 3C6WA 4WZ0A 4BW3A 4YYDA 1IYMA 5A81A 3SOUA 4BBQA 5D1MB 4KV4A 1WENA 3ZNIA 4ZC9A 3LQJA 4RVRA 2QIZA 3AADA 3RPGB 4UP0A 3O35A 2D8SA 2JMJA 5CZGA 5TBNA 2L80A 4QF2A 2L5EA 4QZSA 4HBVA 4CL9A 4UYHA 4V3LC 5DKAA 5TDRA 2MD8C 2K16A 5DBMA 5AMFA 5FG6A 4N4GA 4UYGA 1X0JA 4O7FA 4XY8A 2R0YA 4Y03A 5EVAA 2E6SA 5F1HA 2LXHC 2VJEB 4NS5A 4FK5A 4FJCA 4WA6A 5D3NA 4YYIA 5DLXA 2LGVA 1JM7B 4LYIA 5L98A 5AITA 5LKTA 5H1UA 5I86A 5DFDA 2YEMA 4N4FA 2I7KA 3MB3A 5H85A 3JVJA 4LKAA 3PURA 3SVGA 4MR5A 4NYVA 5EICA 5FE0A 2YU4A 4J3IA 5FFYA 3S91A 2KWNA 5B8DA 4P5OB 2NXBA 5E9LA 1WGMA 4A49A 4QEVA 5JWMA 4O70A 2YHNA 4MEOA 5BT4A 4W4UA 3SOWA 5TDWA 3EB6A 2FUIA 5BT5A 2DVSA 4XI1A 2G6QA 2ECTA 5A5NA 3HCTA 5HRXA 2KWOA 4QY4A 2HYED 4WZ3B 3TLPA 4GNFA 5D7XA 5D3LA 5L97A 5A5SA 2Y1MA 3MB4A 5ENEA 3O34A 2YUCA 5E3DA 5CY9A 2VJEA 2YREA 3U5OA 3LXJA 5CRMA 2EA6A 4MR4A 2R0VA 5CQ7A 5LJ1A 2ECGA 5G4SA 3PHDA 5EM3A 2ECWA 4NN2A 5LJ0A 4CFKA 2MNYA 3MHHA 5I3LA 4Z6IA 5EV9A 4I7BA 2LGLA 1K2FA 5I7YA 3MXFA 5A83A 4LR6A 5FDZA 4A9LA 5D0CA 3P1FA 4HXMA 5HRWA 3NG2A 3M62A 4NRCA 3FL2A 3O7AA 5EPBA 4HBYA 3U5NA 5G05B 2K17A 2YHOA 2F6JA 4YH4A 2OXQC 4WZ2A 3MQMA 1X4IA 5COIA 1JOCA 2KREA 2M6MA 4J0SA 2PUYA 3SVHA 4FO9A 4O74A 4XYAA 5E9KA 4C9ZA 4YADA 4O7CA 4YC9A 4UP5A 4PS5A 3HMFA 4Q6FA 4QSPA 4OGJA 3UV5A 5LKZA 5HQ7A 2LGKA 2VPDA 2G4AA 5EYAF 5CQAA 4IR3A 4YYHA 4UYDA 4B86C 4Q0NA 4IORA 4LK9A 1FP0A 3DAIA 2YYRA 5I40A 5FFVA 4YATA 5C13A 2MJVB 4LC2A 1RMDA 4ZUXU 4NR4A 3ONIA 4WHUA 5DW1A 2YELA 3SHBA 4IOOA 3Q2FA 4NYXA 3UVXA 5G04B 2VP7A 4UIUA 3N9OA 5DX4A 4BJXA 5TB6A 1WESA 1MM2A 2YEKA 5DKDA 5DYUA 5FH8A 2LDRA 2DWWA 4QEUA 5KH9A 4QR3A 4Z93A 5F2PA 5I89A 1FBVA 5CUGA 4PKLA 2XEUA 4IR4A 3C5KA 5FE3A 3DQVR 1Z6UA 3RTRB 4QUUA 2ZETC 4UIXA 4TU6A 5I1QA 4HXOA 4GNDA 4NRAA 5D3SA 2L85A 5DFBA 5E3GA 4YYGA 4QR5A 4A9OA 4FLPA 3L1XA 4NR9A 4HXKA 5E0RA 5ENHA 5IGKA 1WILA 3RPGC 4AVXA 5D24A 4PTBA 5C7NA 2BAYA 4QF3A 5TRBA 4A9EA 4XY9A 4HXLA 5TCMA 5KH7A 5E9YA 5B76A 5H1TA 4UIWA 2WP2A 5EWCA 4E96A 4GB0A 5E9VA 4LZSA 1WEOA 2DATA 4TS8A 5A85A 4WIVA 4MEQA 3UV4A 5EWVA 4LZRA 5FBXA 4LDFA 4I7DA 5CUDA 3EB5A 4LADB 4GNGA 4F52B 2YSJA 3O70A 2VPGA 4QUTA 5G0FA 5HJCA 3ZPV1 5KTXA 5DFCA 1WEMA 5AMEA 5A7CA 2CKLB 5D3JA 4LRGA 4J1PA 2R0SA 5CRZA 1VFYA 2RI7A 5E9MA 4QC1A 1LDJB 2MUMA 2F42A 4NXJA 5F1LA 1HYJA 1WEPA 2KU3A 2RSDA 5ETDA 5F62A 2AN6A 4AYCA 5CQ8A 4QB3A 5DINA 5D25A 2KFTA 1LDKC 3N9LA 4N4IA 5DKCA 3QZTA 3U5KA 4CURA 4UIZA 5F61A 5EWWA 5FH6A 5I80A 2E7NA 4PCEA 3P1DA 5II1A 5B75A 5KO4A 5CQ3A 2LQ6A 2RNWA 3GL6A 5KH3A 5DY7A 5EA1A 2KGIA 4R8PK 4I7CA 2M3HA 1WUGA 3NXBA 3UW9A 3P1CA 5CTLA 4Z1SA 4CUTA 5HFRA 5AD3A 5EQ1A 5I88A 1WUMA 2DX8A 1BORA 3HCUA 4S3OB 4F3IA 5CQ6A 4QSWA 2ECVA 2LGGA 3Q2EA 3KNVA 3M99A 4CUSA 4Z1QA 5D1KB 5CPEA 5FE1A 5EWHA 4MENA 5F5ZA 5C11A 2QICA 5IGLA 2KE1A 3HMHA 2E3KA 4A9IA 1WEUA 2Y43A 4IR6A 2DKWA 3ZVYA 4YYNA 2MA5A 2I50A 2OO1A 5II2A 5E7DA 3JVLA 4NUCA 5I29A 1WEVA 2DVQA 4UI9B 3KV6A 5FE5A 3T7LA 5CS8A 5AIUA 5IIDA 5FE2A 1ZBDB 4Z6HA 5F25A 5A5OA 5ENGA 4BW1A 2L5UA 2JMIA 2LRIC 5F36A 5D3RA 4BHWA 3JVMA 4CUQA 5BT3A 4NUEA 4O78A 2EODA 4J0RA 4O64A 5F60A 2R10A 4WHWA 3L11A 5DYCA 4IR5A 3HTKC 4MR6A 1JM4B 3QZVA 1F62A 5JG6A 5J3XA 1HYIA 5L96A 5D26A 5DW2A 4AP4A 4ZQLA 3QZSA 3HCSA 4R2YA 5E9IA 4A9MA 5D3HA 4ALHA 1E6IA 2KGGA 1U6GB 3G0JA 5FFWA 2VJFB 3G0LA 5LVQA 3LQHA 4AUQB 4HBXA 1MM3A 4MVTA 2L84A 4QSRA 4TT4A 1X4UA 5EU1A 4YABA 4YH3A 1DVPA 3PUQA 5AD2A 3DWYA 2XB1A 2G45A 2UZGA 4KCXA 5EGUA 2NAAA 4CCGX 2ECNA 2K1JA 5FG4A 2RO1A 4CA1A 2OUOA 3KV5A 2KWJA 3UV2A 1X4JA 4QYDA 3KQIA 4B7YC 5EK9A 5LJ2A 3N9NA 4UYEA 5FERA 4TTEA 4A4CA 2YSMA 3SVFA 3M63A 5CU8A 4AKNA 2VNFA 3N9QA 4A0CD 4XUBA 4O75A 3DPLR 4QSUA 4YYJA 4O76A 5FEYA 3VK6A 5EP7A 2MT5A 4QSTA 2C2LA 3LRQA 3ZPVE 2D82A 4YK0A 4KV1A 4LYWA 3HMEA 4N4HA 4YBSA 2H0DA 2YYNA 4ZDTA 3I3JA 3P1EA 4IC2A 5HFQA 5F63A 4YY4A 5ENIA 5CUAA 4YYMA 5LKXA 4DONA 5DLZA 2GRCA 4TZ8A 2D9EA 5JI8A 5H9MA 3IHPA 4HXNA 4QC3A 2CSYA 2KWKA 4IC3A 3JVKA 4NQMA 4QSXA 5FG5A 2L43A 2RNYA 5D3TA 5CQTA 3UVWA 4HXPA 4UITA 1G25A 4NR7A 3U5LA 4LYSA 4A9KA 1N87A 1ZS5A 4QEWA 4OGIA 5A5RA 3UVDA 3IU5A 4O77A 1WE9A 5D3PA 3ZVZB 5FE6A 4S3OC 4QBMA 4Q0OA 3O33A 4BW2A 3ZTGA 4OUFA 5HRVA 5EPRA 4NRBA 4MR3A 1CHCA 1WFKA 2LSPB 4O7EA 2MNZA 5EISA 2H0DB 2OSSA 3K2JA 4NUDA 1V87A 1EQFA 2JMDA 5LCWB 2L75A 3UVYA 4C67A 3RCWA 5F3AA 5A5QA 5FE7A 2CSZA 2VPEA 4NYWA 3MHSA 4X3GA 5CQ5A 5CP5A 5CUEA 2M85A 4UIVA 5HELA 3SOXA 5B77A 2DVVA 2KTBB 3T6RA 4ZW1A 5IG6A 3AQAA 4LZ2A 4NR8A 5DYXA 1Z60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXP C;  4TU4 A;  5CUB A;  4BW4 A;  2YQL A;  4QYL A;  4FIP A;  5FE4 A;  2E7O A;  2RFJ A;  4QSS A;  5LVR A;  2C2V S;  5E74 A;  5HLS A;  5C85 A;  2I8N A;  5FE9 A;  5KU3 A;  4O71 A;  5FH7 A;  1WEQ A;  5B79 A;  2IDA A;  1VD4 A;  4PPE A;  2YT5 A;  5ENJ A;  5HEN A;  4UIY A;  4QNS A;  5IGM A;  4O7A A;  5CQ4 A;  2LV9 A;  5CUC A;  5ENC A;  2MIQ A;  2PNX A;  3U5J A;  5FB1 A;  5HQ5 A;  5HM0 A;  5I7X A;  3ZYQ A;  2EGP A;  5EWD A;  4X2I A;  2YQD A;  3GV4 A;  5HQ6 A;  5LUU A;  2E6R A;  4A9F A;  5HEM A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  4TT6 A;  5C8G A;  5A82 A;  2KR4 A;  3N9M A;  1E4U A;  3S92 A;  1WEE A;  5IGN A;  5FE8 A;  5J0D A;  5K29 A;  4NR6 A;  4L7X A;  4LLB A;  4A9H A;  3D7C A;  5I83 A;  2YUR A;  4A4B A;  5ETB A;  2VJF A;  2WP1 A;  4A9N A;  3I2D A;  5TAB A;  4IOQ A;  5H1V A;  5G4R A;  4YYK A;  5KTU A;  4MEP A;  5E73 A;  4CLB A;  5A5P A;  4TKP B;  2LN0 A;  3FKM X;  2FSA A;  2CT2 A;  4QSQ A;  2YW8 A;  2VPB A;  5IBN A;  2L0B A;  5DKH A;  3U5M A;  2CKL A;  4HBW A;  1F68 A;  5CFW A;  2YW5 A;  4UYF B;  4YY6 A;  3ZYU A;  4UYF A;  4CUU A;  3MUK A;  4NR5 A;  1WEW A;  1JSP B;  3ASL A;  4CFL A;  4XUA A;  2N9G A;  4V3K C;  2MA6 A;  3P5O A;  4QSV A;  4AYC B;  1N72 A;  5L99 A;  4PCI A;  2DVR A;  2FUU A;  4C66 A;  2KYU A;  3LQI A;  4TYL A;  4YAX A;  2K4D A;  2JRJ A;  5D1L B;  1VYX A;  2YQM A;  2RNX A;  3O37 A;  3LJW A;  5EI4 A;  2ECI A;  3GG3 A;  3O36 A;  2F6N A;  4TT2 A;  4CUP A;  5FB0 A;  5CGP A;  4YBM A;  4O72 A;  4TQN A;  5EPS A;  1WIM A;  3IU6 A;  3V43 A;  2Y1N A;  5KHM A;  5ACY A;  4TZ2 A;  3L1Z B;  4L58 A;  4R7E A;  5L8T A;  4NQN A;  3MUL A;  5C87 A;  4LJN A;  5L8U A;  3U5P A;  4O7B A;  4QR4 A;  5ENF A;  2ECJ A;  2MD7 B;  5ENB A;  1Z2Q A;  2HDP A;  4PY6 A;  4A9J A;  5C89 A;  1XWH A;  5C4Q A;  5B78 A;  4HXS A;  5HCL A;  4GPJ A;  2M1R A;  4YBT A;  4GNE A;  1JM7 A;  2G43 A;  5DYA A;  2YDW A;  4HXR A;  4ALG A;  5KTW A;  2H60 A;  2QJ0 A;  2RS9 B;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  4BW3 A;  4YYD A;  1IYM A;  5A81 A;  3SOU A;  4BBQ A;  5D1M B;  4KV4 A;  1WEN A;  3ZNI A;  4ZC9 A;  3LQJ A;  4RVR A;  2QIZ A;  3AAD A;  3RPG B;  4UP0 A;  3O35 A;  2D8S A;  2JMJ A;  5CZG A;  5TBN A;  2L80 A;  4QF2 A;  2L5E A;  4QZS A;  4HBV A;  4CL9 A;  4UYH A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  5DBM A;  5AMF A;  5FG6 A;  4N4G A;  4UYG A;  1X0J A;  4O7F A;  4XY8 A;  2R0Y A;  4Y03 A;  5EVA A;  2E6S A;  5F1H A;  2LXH C;  2VJE B;  4NS5 A;  4FK5 A;  4FJC A;  4WA6 A;  5D3N A;  4YYI A;  5DLX A;  2LGV A;  1JM7 B;  4LYI A;  5L98 A;  5AIT A;  5LKT A;  5H1U A;  5I86 A;  5DFD A;  2YEM A;  4N4F A;  2I7K A;  3MB3 A;  5H85 A;  3JVJ A;  4LKA A;  3PUR A;  3SVG A;  4MR5 A;  4NYV A;  5EIC A;  5FE0 A;  2YU4 A;  4J3I A;  5FFY A;  3S91 A;  2KWN A;  5B8D A;  4P5O B;  2NXB A;  5E9L A;  1WGM A;  4A49 A;  4QEV A;  5JWM A;  4O70 A;  2YHN A;  4MEO A;  5BT4 A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  5BT5 A;  2DVS A;  4XI1 A;  2G6Q A;  2ECT A;  5A5N A;  3HCT A;  5HRX A;  2KWO A;  4QY4 A;  2HYE D;  4WZ3 B;  3TLP A;  4GNF A;  5D7X A;  5D3L A;  5L97 A;  5A5S A;  2Y1M A;  3MB4 A;  5ENE A;  3O34 A;  2YUC A;  5E3D A;  5CY9 A;  2VJE A;  2YRE A;  3U5O A;  3LXJ A;  5CRM A;  2EA6 A;  4MR4 A;  2R0V A;  5CQ7 A;  5LJ1 A;  2ECG A;  5G4S A;  3PHD A;  5EM3 A;  2ECW A;  4NN2 A;  5LJ0 A;  4CFK A;  2MNY A;  3MHH A;  5I3L A;  4Z6I A;  5EV9 A;  4I7B A;  2LGL A;  1K2F A;  5I7Y A;  3MXF A;  5A83 A;  4LR6 A;  5FDZ A;  4A9L A;  5D0C A;  3P1F A;  4HXM A;  5HRW A;  3NG2 A;  3M62 A;  4NRC A;  3FL2 A;  3O7A A;  5EPB A;  4HBY A;  3U5N A;  5G05 B;  2K17 A;  2YHO A;  2F6J A;  4YH4 A;  2OXQ C;  4WZ2 A;  3MQM A;  1X4I A;  5COI A;  1JOC A;  2KRE A;  2M6M A;  4J0S A;  2PUY A;  3SVH A;  4FO9 A;  4O74 A;  4XYA A;  5E9K A;  4C9Z A;  4YAD A;  4O7C A;  4YC9 A;  4UP5 A;  4PS5 A;  3HMF A;  4Q6F A;  4QSP A;  4OGJ A;  3UV5 A;  5LKZ A;  5HQ7 A;  2LGK A;  2VPD A;  2G4A A;  5EYA F;  5CQA A;  4IR3 A;  4YYH A;  4UYD A;  4B86 C;  4Q0N A;  4IOR A;  4LK9 A;  1FP0 A;  3DAI A;  2YYR A;  5I40 A;  5FFV A;  4YAT A;  5C13 A;  2MJV B;  4LC2 A;  1RMD A;  4ZUX U;  4NR4 A;  3ONI A;  4WHU A;  5DW1 A;  2YEL A;  3SHB A;  4IOO A;  3Q2F A;  4NYX A;  3UVX A;  5G04 B;  2VP7 A;  4UIU A;  3N9O A;  5DX4 A;  4BJX A;  5TB6 A;  1WES A;  1MM2 A;  2YEK A;  5DKD A;  5DYU A;  5FH8 A;  2LDR A;  2DWW A;  4QEU A;  5KH9 A;  4QR3 A;  4Z93 A;  5F2P A;  5I89 A;  1FBV A;  5CUG A;  4PKL A;  2XEU A;  4IR4 A;  3C5K A;  5FE3 A;  3DQV R;  1Z6U A;  3RTR B;  4QUU A;  2ZET C;  4UIX A;  4TU6 A;  5I1Q A;  4HXO A;  4GND A;  4NRA A;  5D3S A;  2L85 A;  5DFB A;  5E3G A;  4YYG A;  4QR5 A;  4A9O A;  4FLP A;  3L1X A;  4NR9 A;  4HXK A;  5E0R A;  5ENH A;  5IGK A;  1WIL A;  3RPG C;  4AVX A;  5D24 A;  4PTB A;  5C7N A;  2BAY A;  4QF3 A;  5TRB A;  4A9E A;  4XY9 A;  4HXL A;  5TCM A;  5KH7 A;  5E9Y A;  5B76 A;  5H1T A;  4UIW A;  2WP2 A;  5EWC A;  4E96 A;  4GB0 A;  5E9V A;  4LZS A;  1WEO A;  2DAT A;  4TS8 A;  5A85 A;  4WIV A;  4MEQ A;  3UV4 A;  5EWV A;  4LZR A;  5FBX A;  4LDF A;  4I7D A;  5CUD A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2YSJ A;  3O70 A;  2VPG A;  4QUT A;  5G0F A;  5HJC A;  3ZPV 1;  5KTX A;  5DFC A;  1WEM A;  5AME A;  5A7C A;  2CKL B;  5D3J A;  4LRG A;  4J1P A;  2R0S A;  5CRZ A;  1VFY A;  2RI7 A;  5E9M A;  4QC1 A;  1LDJ B;  2MUM A;  2F42 A;  4NXJ A;  5F1L A;  1HYJ A;  1WEP A;  2KU3 A;  2RSD A;  5ETD A;  5F62 A;  2AN6 A;  4AYC A;  5CQ8 A;  4QB3 A;  5DIN A;  5D25 A;  2KFT A;  1LDK C;  3N9L A;  4N4I A;  5DKC A;  3QZT A;  3U5K A;  4CUR A;  4UIZ A;  5F61 A;  5EWW A;  5FH6 A;  5I80 A;  2E7N A;  4PCE A;  3P1D A;  5II1 A;  5B75 A;  5KO4 A;  5CQ3 A;  2LQ6 A;  2RNW A;  3GL6 A;  5KH3 A;  5DY7 A;  5EA1 A;  2KGI A;  4R8P K;  4I7C A;  2M3H A;  1WUG A;  3NXB A;  3UW9 A;  3P1C A;  5CTL A;  4Z1S A;  4CUT A;  5HFR A;  5AD3 A;  5EQ1 A;  5I88 A;  1WUM A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  4F3I A;  5CQ6 A;  4QSW A;  2ECV A;  2LGG A;  3Q2E A;  3KNV A;  3M99 A;  4CUS A;  4Z1Q A;  5D1K B;  5CPE A;  5FE1 A;  5EWH A;  4MEN A;  5F5Z A;  5C11 A;  2QIC A;  5IGL A;  2KE1 A;  3HMH A;  2E3K A;  4A9I A;  1WEU A;  2Y43 A;  4IR6 A;  2DKW A;  3ZVY A;  4YYN A;  2MA5 A;  2I50 A;  2OO1 A;  5II2 A;  5E7D A;  3JVL A;  4NUC A;  5I29 A;  1WEV A;  2DVQ A;  4UI9 B;  3KV6 A;  5FE5 A;  3T7L A;  5CS8 A;  5AIU A;  5IID A;  5FE2 A;  1ZBD B;  4Z6H A;  5F25 A;  5A5O A;  5ENG A;  4BW1 A;  2L5U A;  2JMI A;  2LRI C;  5F36 A;  5D3R A;  4BHW A;  3JVM A;  4CUQ A;  5BT3 A;  4NUE A;  4O78 A;  2EOD A;  4J0R A;  4O64 A;  5F60 A;  2R10 A;  4WHW A;  3L11 A;  5DYC A;  4IR5 A;  3HTK C;  4MR6 A;  1JM4 B;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  5L96 A;  5D26 A;  5DW2 A;  4AP4 A;  4ZQL A;  3QZS A;  3HCS A;  4R2Y A;  5E9I A;  4A9M A;  5D3H A;  4ALH A;  1E6I A;  2KGG A;  1U6G B;  3G0J A;  5FFW A;  2VJF B;  3G0L A;  5LVQ A;  3LQH A;  4AUQ B;  4HBX A;  1MM3 A;  4MVT A;  2L84 A;  4QSR A;  4TT4 A;  1X4U A;  5EU1 A;  4YAB A;  4YH3 A;  1DVP A;  3PUQ A;  5AD2 A;  3DWY A;  2XB1 A;  2G45 A;  2UZG A;  4KCX A;  5EGU A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  5FG4 A;  2RO1 A;  4CA1 A;  2OUO A;  3KV5 A;  2KWJ A;  3UV2 A;  1X4J A;  4QYD A;  3KQI A;  4B7Y C;  5EK9 A;  5LJ2 A;  3N9N A;  4UYE A;  5FER A;  4TTE A;  4A4C A;  2YSM A;  3SVF A;  3M63 A;  5CU8 A;  4AKN A;  2VNF A;  3N9Q A;  4A0C D;  4XUB A;  4O75 A;  3DPL R;  4QSU A;  4YYJ A;  4O76 A;  5FEY A;  3VK6 A;  5EP7 A;  2MT5 A;  4QST A;  2C2L A;  3LRQ A;  3ZPV E;  2D82 A;  4YK0 A;  4KV1 A;  4LYW A;  3HME A;  4N4H A;  4YBS A;  2H0D A;  2YYN A;  4ZDT A;  3I3J A;  3P1E A;  4IC2 A;  5HFQ A;  5F63 A;  4YY4 A;  5ENI A;  5CUA A;  4YYM A;  5LKX A;  4DON A;  5DLZ A;  2GRC A;  4TZ8 A;  2D9E A;  5JI8 A;  5H9M A;  3IHP A;  4HXN A;  4QC3 A;  2CSY A;  2KWK A;  4IC3 A;  3JVK A;  4NQM A;  4QSX A;  5FG5 A;  2L43 A;  2RNY A;  5D3T A;  5CQT A;  3UVW A;  4HXP A;  4UIT A;  1G25 A;  4NR7 A;  3U5L A;  4LYS A;  4A9K A;  1N87 A;  1ZS5 A;  4QEW A;  4OGI A;  5A5R A;  3UVD A;  3IU5 A;  4O77 A;  1WE9 A;  5D3P A;  3ZVZ B;  5FE6 A;  4S3O C;  4QBM A;  4Q0O A;  3O33 A;  4BW2 A;  3ZTG A;  4OUF A;  5HRV A;  5EPR A;  4NRB A;  4MR3 A;  1CHC A;  1WFK A;  2LSP B;  4O7E A;  2MNZ A;  5EIS A;  2H0D B;  2OSS A;  3K2J A;  4NUD A;  1V87 A;  1EQF A;  2JMD A;  5LCW B;  2L75 A;  3UVY A;  4C67 A;  3RCW A;  5F3A A;  5A5Q A;  5FE7 A;  2CSZ A;  2VPE A;  4NYW A;  3MHS A;  4X3G A;  5CQ5 A;  5CP5 A;  5CUE A;  2M85 A;  4UIV A;  5HEL A;  3SOX A;  5B77 A;  2DVV A;  2KTB B;  3T6R A;  4ZW1 A;  5IG6 A;  3AQA A;  4LZ2 A;  4NR8 A;  5DYX A;  1Z60 A; 
#chains in the Genus database with same CATH topology
 2LXP C;  4TU4 A;  5CUB A;  4BW4 A;  2YQL A;  4QYL A;  3D1D A;  4FIP A;  5FE4 A;  2E7O A;  2RFJ A;  3PLW A;  4QSS A;  5LVR A;  2C2V S;  5E74 A;  5HLS A;  5C85 A;  2I8N A;  5FE9 A;  5KU3 A;  4O71 A;  5FH7 A;  1WEQ A;  5B79 A;  2IDA A;  2B0O E;  5SVI A;  1VD4 A;  4PPE A;  2YT5 A;  5ENJ A;  5HEN A;  4UIY A;  4QNS A;  5IGM A;  4O7A A;  5CQ4 A;  2LV9 A;  5CUC A;  5ENC A;  2MIQ A;  2PNX A;  3U5J A;  3M7K A;  5FB1 A;  5HQ5 A;  5SVY A;  2CON A;  5HM0 A;  2XP0 A;  5I7X A;  4H9D A;  3ZYQ A;  2EGP A;  5EWD A;  4X2I A;  2YQD A;  3GV4 A;  5HQ6 A;  5LUU A;  2E6R A;  4A9F A;  5HEM A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  4TT6 A;  5C8G A;  5A82 A;  2KR4 A;  3N9M A;  1E4U A;  3S92 A;  1WEE A;  5IGN A;  5FE8 A;  5J0D A;  5K29 A;  4NR6 A;  4L7X A;  4LLB A;  5K3Q A;  4A9H A;  3D7C A;  5I83 A;  2YUR A;  4A4B A;  5ETB A;  2VJF A;  2WP1 A;  4A9N A;  2XOC A;  3I2D A;  2FFW A;  5TAB A;  4IOQ A;  2CRW A;  5H1V A;  5G4R A;  4YYK A;  5KTU A;  4MEP A;  5E73 A;  4CLB A;  5A5P A;  2FD4 A;  4TKP B;  2LN0 A;  3FKM X;  2FSA A;  2CT2 A;  4QSQ A;  2YW8 A;  2VPB A;  5IBN A;  2L0B A;  5DKH A;  3U5M A;  4Z0R A;  2CKL A;  4HBW A;  1F68 A;  5CFW A;  2YW5 A;  4UYF B;  4YY6 A;  3ZYU A;  4UYF A;  4CUU A;  3MUK A;  4NR5 A;  1WEW A;  1JSP B;  3ASL A;  4CFL A;  4XUA A;  2N9G A;  4V3K C;  2MA6 A;  3E2D A;  3P5O A;  4QSV A;  4AYC B;  3SUB A;  1N72 A;  5L99 A;  4PCI A;  2DVR A;  2EJN A;  4C66 A;  2FUU A;  3LQI A;  4TYL A;  4YAX A;  2K4D A;  2JRJ A;  2KYU A;  3H7H A;  1VYX A;  5D1L B;  2IQJ A;  2YQM A;  2RNX A;  3O37 A;  3LJW A;  5EI4 A;  2ECI A;  3GG3 A;  3O36 A;  2F6N A;  4TT2 A;  4CUP A;  5FB0 A;  5CGP A;  4YBM A;  4O72 A;  4TQN A;  3O47 A;  5EPS A;  1WIM A;  3IU6 A;  3V43 A;  2Y1N A;  3FM8 C;  5KHM A;  5ACY A;  4TZ2 A;  3L1Z B;  4L58 A;  4R7E A;  5L8T A;  4Z0O A;  4NQN A;  3MUL A;  5C87 A;  4LJN A;  5L8U A;  3U5P A;  4O7B A;  4QR4 A;  5ENF A;  2ECJ A;  2MD7 B;  5ENB A;  1Z2Q A;  2HDP A;  4PY6 A;  4A9J A;  5C89 A;  1XWH A;  5C4Q A;  5B78 A;  4HXS A;  5HCL A;  4GPJ A;  2M1R A;  4YBT A;  4GNE A;  1JM7 A;  2G43 A;  5DYA A;  2YDW A;  4HXR A;  4ALG A;  5KTW A;  3T9K A;  2H60 A;  2QJ0 A;  2RS9 B;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  4BW3 A;  4YYD A;  1IYM A;  5A81 A;  3SOU A;  4BBQ A;  5D1M B;  4KV4 A;  1WEN A;  3ZNI A;  4ZC9 A;  3LQJ A;  4RVR A;  2QIZ A;  3AAD A;  3RPG B;  4UP0 A;  3O35 A;  2D8S A;  2JMJ A;  5SVI B;  5CZG A;  5TBN A;  2L80 A;  3DDT A;  4QF2 A;  2L5E A;  4QZS A;  4HBV A;  4CL9 A;  4UYH A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  5DBM A;  5AMF A;  4OGE A;  5FG6 A;  4N4G A;  4UYG A;  1X0J A;  4O7F A;  4XY8 A;  2R0Y A;  4Y03 A;  5EVA A;  2E6S A;  5F1H A;  2LXH C;  2VJE B;  4NS5 A;  4FK5 A;  4FJC A;  4WA6 A;  5D3N A;  4YYI A;  5DLX A;  2LGV A;  1JM7 B;  4LYI A;  5L98 A;  5AIT A;  5LKT A;  2P57 A;  5H1U A;  5I86 A;  5DFD A;  2YEM A;  4N4F A;  2I7K A;  3MB3 A;  5H85 A;  3JVJ A;  4LKA A;  3PUR A;  3SVG A;  4MR5 A;  4NYV A;  5EIC A;  5FE0 A;  2YU4 A;  4J3I A;  5FFY A;  3S91 A;  2KWN A;  5B8D A;  4P5O B;  2NXB A;  5E9L A;  1WGM A;  4A49 A;  4QEV A;  5JWM A;  4O70 A;  2YHN A;  2MKE A;  2CSV A;  4MEO A;  5BT4 A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  5BT5 A;  2DVS A;  2JUN A;  4XI1 A;  2G6Q A;  2ECT A;  5A5N A;  3HCT A;  5HRX A;  2JM3 A;  2KWO A;  2RR4 A;  4QY4 A;  2HYE D;  4WZ3 B;  3TLP A;  1ZKR A;  4GNF A;  5D7X A;  5D3L A;  5L97 A;  5A5S A;  2Y1M A;  3MB4 A;  5ENE A;  3O34 A;  2YUC A;  5E3D A;  5CY9 A;  2VJE A;  2YRE A;  3U5O A;  3LXJ A;  5CRM A;  2EA6 A;  1DCQ A;  4MR4 A;  2R0V A;  5CQ7 A;  5LJ1 A;  2ECG A;  5G4S A;  3PHD A;  1PUO A;  5EM3 A;  2ECW A;  5LJ0 A;  4CFK A;  2MNY A;  3MHH A;  4NN2 A;  5I3L A;  3Q1D A;  4Z6I A;  5EV9 A;  4I7B A;  2LGL A;  1K2F A;  5I7Y A;  3MXF A;  5A83 A;  4LR6 A;  5FDZ A;  4A9L A;  5D0C A;  3P1F A;  4HXM A;  5HRW A;  3NG2 A;  2KKY A;  3M62 A;  4NRC A;  3FL2 A;  3O7A A;  5EPB A;  4HBY A;  3U5N A;  5G05 B;  2K17 A;  2YHO A;  2F6J A;  4YH4 A;  2OXQ C;  4WZ2 A;  3MQM A;  1X4I A;  5COI A;  1JOC A;  2KRE A;  2M6M A;  4J0S A;  2PUY A;  3SVH A;  4FO9 A;  4O74 A;  4XYA A;  5E9K A;  3VKH A;  2LAU A;  4YAD A;  4C9Z A;  4O7C A;  4YC9 A;  4UP5 A;  4PS5 A;  3HMF A;  4Q6F A;  4QSP A;  4OGJ A;  3UV5 A;  5LKZ A;  5HQ7 A;  2LGK A;  2VPD A;  2G4A A;  5EYA F;  5CQA A;  4IR3 A;  4YYH A;  4UYD A;  4B86 C;  4Q0N A;  4IOR A;  4LK9 A;  1FP0 A;  3DAI A;  2YYR A;  5I40 A;  5FFV A;  4YAT A;  5C13 A;  2MJV B;  4LC2 A;  1RMD A;  4ZUX U;  4NR4 A;  3ONI A;  4WHU A;  5DW1 A;  2YEL A;  3SHB A;  4IOO A;  3Q2F A;  4NYX A;  3UVX A;  5G04 B;  2VP7 A;  4UIU A;  3N9O A;  5DX4 A;  3FAO A;  4BJX A;  5TB6 A;  1WES A;  1MM2 A;  2YEK A;  5DKD A;  5DYU A;  5FH8 A;  2LDR A;  2L7P A;  2DWW A;  4QEU A;  5KH9 A;  4QR3 A;  4Z93 A;  5F2P A;  5I89 A;  1FBV A;  5CUG A;  4PKL A;  2XEU A;  4IR4 A;  3C5K A;  5FE3 A;  3DQV R;  1Z6U A;  3RTR B;  4QUU A;  3FEH A;  3KDE C;  2ZET C;  4UIX A;  4TU6 A;  5I1Q A;  4HXO A;  4AKG A;  4GND A;  4NRA A;  5D3S A;  2L85 A;  5DFB A;  5E3G A;  4YYG A;  4QR5 A;  4A9O A;  4FLP A;  3L1X A;  4NR9 A;  4HXK A;  5E0R A;  5ENH A;  5IGK A;  1WIL A;  3RPG C;  4AVX A;  5D24 A;  4PTB A;  5C7N A;  2BAY A;  4QF3 A;  3LDY A;  5TRB A;  4A9E A;  4XY9 A;  4HXL A;  5TCM A;  5KH7 A;  5E9Y A;  5B76 A;  5H1T A;  4UIW A;  2WP2 A;  5EWC A;  4E96 A;  4GB0 A;  5E9V A;  4LZS A;  1WEO A;  2DAT A;  4TS8 A;  5A85 A;  3LJU X;  4WIV A;  4MEQ A;  3UV4 A;  5EWV A;  4LZR A;  5FBX A;  4LDF A;  4I7D A;  5CUD A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2M13 A;  2YSJ A;  2VPG A;  4QUT A;  3O70 A;  5G0F A;  5HJC A;  3ZPV 1;  5KTX A;  5DFC A;  1WEM A;  5AME A;  3MDB C;  5A7C A;  2CKL B;  5D3J A;  4LRG A;  4J1P A;  2D8U A;  2R0S A;  5CRZ A;  1VFY A;  2RI7 A;  5E9M A;  4QC1 A;  1LDJ B;  2MUM A;  2F42 A;  4NXJ A;  5F1L A;  1HYJ A;  1WEP A;  3LVQ E;  2KU3 A;  2RSD A;  5ETD A;  5F62 A;  2AN6 A;  4AYC A;  5CQ8 A;  4QB3 A;  4QQ4 A;  5D25 A;  2KFT A;  5DIN A;  1LDK C;  3N9L A;  4N4I A;  5DKC A;  3QZT A;  3U5K A;  4CUR A;  4UIZ A;  5F61 A;  4O62 A;  5EWW A;  5FH6 A;  5I80 A;  2E7N A;  4PCE A;  3P1D A;  5II1 A;  5B75 A;  5KO4 A;  5CQ3 A;  2LQ6 A;  2RNW A;  3GL6 A;  5KH3 A;  5DY7 A;  5EA1 A;  2KGI A;  4R8P K;  4I7C A;  4AKI A;  2M3H A;  1WUG A;  3NXB A;  3UW9 A;  3P1C A;  4OGC A;  5CTL A;  4Z1S A;  4CUT A;  5HFR A;  5AD3 A;  5EQ1 A;  5I88 A;  1WUM A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  4F3I A;  3JUE A;  5CQ6 A;  4QSW A;  2ECV A;  2LGG A;  3Q2E A;  3KNV A;  3M99 A;  4CUS A;  4Z1Q A;  5D1K B;  5CPE A;  5FE1 A;  5EWH A;  4MEN A;  5F5Z A;  5C11 A;  2QIC A;  5IGL A;  2KE1 A;  3HMH A;  2E3K A;  4A9I A;  1WEU A;  2Y43 A;  4IR6 A;  2DKW A;  3ZVY A;  4YYN A;  3DWD A;  2MA5 A;  2I50 A;  2KKX A;  3LVR E;  2OO1 A;  5II2 A;  5E7D A;  3JVL A;  4NUC A;  5I29 A;  1WEV A;  2DVQ A;  4UI9 B;  3KV6 A;  2DSM A;  5FE5 A;  3T7L A;  5CS8 A;  5AIU A;  5IID A;  5FE2 A;  1ZBD B;  4Z6H A;  5F25 A;  5A5O A;  5ENG A;  4BW1 A;  2L5U A;  2JMI A;  2LRI C;  5F36 A;  5D3R A;  4BHW A;  3JVM A;  4CUQ A;  5BT3 A;  4NUE A;  4O78 A;  2DJA A;  2EOD A;  4J0R A;  4O64 A;  5F60 A;  2R10 A;  4WHW A;  3L11 A;  5DYC A;  4IR5 A;  3HTK C;  4MR6 A;  1JM4 B;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  5L96 A;  5D26 A;  5DW2 A;  3FJU B;  4AP4 A;  2XOY A;  4ZQL A;  3QZS A;  3HCS A;  4R2Y A;  5E9I A;  4A9M A;  5D3H A;  4ALH A;  1E6I A;  2KGG A;  1U6G B;  3G0J A;  5FFW A;  2VJF B;  3G0L A;  5LVQ A;  3LQH A;  4AUQ B;  4HBX A;  1MM3 A;  2EGM A;  4MVT A;  2L84 A;  4QSR A;  4TT4 A;  1X4U A;  5EU1 A;  4YAB A;  4YH3 A;  1DVP A;  3PUQ A;  5AD2 A;  3DWY A;  2XB1 A;  2G45 A;  2UZG A;  4KCX A;  5EGU A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  5FG4 A;  2RO1 A;  4CA1 A;  2OUO A;  2CRR A;  3KV5 A;  2KWJ A;  3UV2 A;  1X4J A;  4QYD A;  3KQI A;  4B7Y C;  5EK9 A;  5LJ2 A;  3N9N A;  4UYE A;  5FER A;  4TTE A;  4A4C A;  2YSM A;  3SVF A;  3M63 A;  5CU8 A;  4AKN A;  2VNF A;  3N9Q A;  4A0C D;  4XUB A;  4O75 A;  3DPL R;  4QSU A;  4YYJ A;  4O76 A;  5FEY A;  3VK6 A;  5EP7 A;  2MT5 A;  4QST A;  2C2L A;  3LRQ A;  3ZPV E;  4AKH A;  2D82 A;  2YVR A;  4YK0 A;  4KV1 A;  4LYW A;  3ERR A;  3HME A;  4N4H A;  4YBS A;  2H0D A;  2YYN A;  4ZDT A;  3I3J A;  3P1E A;  4IC2 A;  5HFQ A;  5F63 A;  4YY4 A;  5ENI A;  5CUA A;  4YYM A;  5LKX A;  4DON A;  5DLZ A;  2GRC A;  4TZ8 A;  2D9E A;  5JI8 A;  5H9M A;  3IHP A;  4HXN A;  4QC3 A;  2CSY A;  2KWK A;  3FAN A;  3JVK A;  4IC3 A;  4NQM A;  4QSX A;  3D1B A;  5FG5 A;  2E61 A;  2L43 A;  2RNY A;  5D3T A;  5CQT A;  3UVW A;  4HXP A;  4UIT A;  1G25 A;  2OWA A;  4NR7 A;  3U5L A;  4LYS A;  4A9K A;  1N87 A;  2XOZ A;  1ZS5 A;  4QEW A;  4OGI A;  5A5R A;  3UVD A;  3IU5 A;  4O77 A;  1WE9 A;  5D3P A;  3ZVZ B;  5FE6 A;  4S3O C;  4QBM A;  4Q0O A;  3O33 A;  4BW2 A;  3ZTG A;  4OUF A;  5HRV A;  5EPR A;  4NRB A;  4MR3 A;  1CHC A;  1WFK A;  2LSP B;  4O7E A;  2MNZ A;  4F1P A;  5EIS A;  2H0D B;  2OSS A;  3K2J A;  4NUD A;  1V87 A;  1EQF A;  4AI6 A;  2JMD A;  2L75 A;  5LCW B;  2EXU A;  3UVY A;  4C67 A;  3RCW A;  5F3A A;  5A5Q A;  5FE7 A;  2CSZ A;  2VPE A;  4NYW A;  3MHS A;  4X3G A;  5CQ5 A;  5CP5 A;  5CUE A;  2M85 A;  4UIV A;  5HEL A;  5SVX A;  1MBM A;  3SOX A;  3VKG A;  5B77 A;  2DVV A;  2KTB B;  3T6R A;  4ZW1 A;  5IG6 A;  3AQA A;  4LZ2 A;  4NR8 A;  5DYX A;  1Z60 A; 
#chains in the Genus database with same CATH homology
 2LXP C;  4TU4 A;  5CUB A;  4BW4 A;  2YQL A;  4QYL A;  4FIP A;  5FE4 A;  2E7O A;  2RFJ A;  4QSS A;  5LVR A;  2C2V S;  5E74 A;  5HLS A;  5C85 A;  2I8N A;  5FE9 A;  5KU3 A;  4O71 A;  5FH7 A;  1WEQ A;  5B79 A;  2IDA A;  1VD4 A;  4PPE A;  2YT5 A;  5ENJ A;  5HEN A;  4UIY A;  4QNS A;  5IGM A;  4O7A A;  5CQ4 A;  2LV9 A;  5CUC A;  5ENC A;  2MIQ A;  2PNX A;  3U5J A;  5FB1 A;  5HQ5 A;  5HM0 A;  5I7X A;  3ZYQ A;  2EGP A;  5EWD A;  4X2I A;  2YQD A;  3GV4 A;  5HQ6 A;  5LUU A;  2E6R A;  4A9F A;  5HEM A;  1T1H A;  4MSX A;  4N3W A;  3N9P A;  4TT6 A;  5C8G A;  5A82 A;  2KR4 A;  3N9M A;  1E4U A;  3S92 A;  1WEE A;  5IGN A;  5FE8 A;  5J0D A;  5K29 A;  4NR6 A;  4L7X A;  4LLB A;  4A9H A;  3D7C A;  5I83 A;  2YUR A;  4A4B A;  5ETB A;  2VJF A;  2WP1 A;  4A9N A;  3I2D A;  5TAB A;  4IOQ A;  5H1V A;  5G4R A;  4YYK A;  5KTU A;  4MEP A;  5E73 A;  4CLB A;  5A5P A;  4TKP B;  2LN0 A;  3FKM X;  2FSA A;  2CT2 A;  4QSQ A;  2YW8 A;  2VPB A;  5IBN A;  2L0B A;  5DKH A;  3U5M A;  2CKL A;  4HBW A;  1F68 A;  5CFW A;  2YW5 A;  4UYF B;  4YY6 A;  3ZYU A;  4UYF A;  4CUU A;  3MUK A;  4NR5 A;  1WEW A;  1JSP B;  3ASL A;  4CFL A;  4XUA A;  2N9G A;  4V3K C;  2MA6 A;  3P5O A;  4QSV A;  4AYC B;  1N72 A;  5L99 A;  4PCI A;  2DVR A;  2FUU A;  4C66 A;  2KYU A;  3LQI A;  4TYL A;  4YAX A;  2K4D A;  2JRJ A;  5D1L B;  1VYX A;  2YQM A;  2RNX A;  3O37 A;  3LJW A;  5EI4 A;  2ECI A;  3GG3 A;  3O36 A;  2F6N A;  4TT2 A;  4CUP A;  5FB0 A;  5CGP A;  4YBM A;  4O72 A;  4TQN A;  5EPS A;  1WIM A;  3IU6 A;  3V43 A;  2Y1N A;  5KHM A;  5ACY A;  4TZ2 A;  3L1Z B;  4L58 A;  4R7E A;  5L8T A;  4NQN A;  3MUL A;  5C87 A;  4LJN A;  5L8U A;  3U5P A;  4O7B A;  4QR4 A;  5ENF A;  2ECJ A;  2MD7 B;  5ENB A;  1Z2Q A;  2HDP A;  4PY6 A;  4A9J A;  5C89 A;  1XWH A;  5C4Q A;  5B78 A;  4HXS A;  5HCL A;  4GPJ A;  2M1R A;  4YBT A;  4GNE A;  1JM7 A;  2G43 A;  5DYA A;  2YDW A;  4HXR A;  4ALG A;  5KTW A;  2H60 A;  2QJ0 A;  2RS9 B;  5LKU A;  2KIZ A;  3C6W A;  4WZ0 A;  4BW3 A;  4YYD A;  1IYM A;  5A81 A;  3SOU A;  4BBQ A;  5D1M B;  4KV4 A;  1WEN A;  3ZNI A;  4ZC9 A;  3LQJ A;  4RVR A;  2QIZ A;  3AAD A;  3RPG B;  4UP0 A;  3O35 A;  2D8S A;  2JMJ A;  5CZG A;  5TBN A;  2L80 A;  4QF2 A;  2L5E A;  4QZS A;  4HBV A;  4CL9 A;  4UYH A;  4V3L C;  5DKA A;  5TDR A;  2MD8 C;  2K16 A;  5DBM A;  5AMF A;  5FG6 A;  4N4G A;  4UYG A;  1X0J A;  4O7F A;  4XY8 A;  2R0Y A;  4Y03 A;  5EVA A;  2E6S A;  5F1H A;  2LXH C;  2VJE B;  4NS5 A;  4FK5 A;  4FJC A;  4WA6 A;  5D3N A;  4YYI A;  5DLX A;  2LGV A;  1JM7 B;  4LYI A;  5L98 A;  5AIT A;  5LKT A;  5H1U A;  5I86 A;  5DFD A;  2YEM A;  4N4F A;  2I7K A;  3MB3 A;  5H85 A;  3JVJ A;  4LKA A;  3PUR A;  3SVG A;  4MR5 A;  4NYV A;  5EIC A;  5FE0 A;  2YU4 A;  4J3I A;  5FFY A;  3S91 A;  2KWN A;  5B8D A;  4P5O B;  2NXB A;  5E9L A;  1WGM A;  4A49 A;  4QEV A;  5JWM A;  4O70 A;  2YHN A;  4MEO A;  5BT4 A;  4W4U A;  3SOW A;  5TDW A;  3EB6 A;  2FUI A;  5BT5 A;  2DVS A;  4XI1 A;  2G6Q A;  2ECT A;  5A5N A;  3HCT A;  5HRX A;  2KWO A;  4QY4 A;  2HYE D;  4WZ3 B;  3TLP A;  4GNF A;  5D7X A;  5D3L A;  5L97 A;  5A5S A;  2Y1M A;  3MB4 A;  5ENE A;  3O34 A;  2YUC A;  5E3D A;  5CY9 A;  2VJE A;  2YRE A;  3U5O A;  3LXJ A;  5CRM A;  2EA6 A;  4MR4 A;  2R0V A;  5CQ7 A;  5LJ1 A;  2ECG A;  5G4S A;  3PHD A;  5EM3 A;  2ECW A;  4NN2 A;  5LJ0 A;  4CFK A;  2MNY A;  3MHH A;  5I3L A;  4Z6I A;  5EV9 A;  4I7B A;  2LGL A;  1K2F A;  5I7Y A;  3MXF A;  5A83 A;  4LR6 A;  5FDZ A;  4A9L A;  5D0C A;  3P1F A;  4HXM A;  5HRW A;  3NG2 A;  3M62 A;  4NRC A;  3FL2 A;  3O7A A;  5EPB A;  4HBY A;  3U5N A;  5G05 B;  2K17 A;  2YHO A;  2F6J A;  4YH4 A;  2OXQ C;  4WZ2 A;  3MQM A;  1X4I A;  5COI A;  1JOC A;  2KRE A;  2M6M A;  4J0S A;  2PUY A;  3SVH A;  4FO9 A;  4O74 A;  4XYA A;  5E9K A;  4C9Z A;  4YAD A;  4O7C A;  4YC9 A;  4UP5 A;  4PS5 A;  3HMF A;  4Q6F A;  4QSP A;  4OGJ A;  3UV5 A;  5LKZ A;  5HQ7 A;  2LGK A;  2VPD A;  2G4A A;  5EYA F;  5CQA A;  4IR3 A;  4YYH A;  4UYD A;  4B86 C;  4Q0N A;  4IOR A;  4LK9 A;  1FP0 A;  3DAI A;  2YYR A;  5I40 A;  5FFV A;  4YAT A;  5C13 A;  2MJV B;  4LC2 A;  1RMD A;  4ZUX U;  4NR4 A;  3ONI A;  4WHU A;  5DW1 A;  2YEL A;  3SHB A;  4IOO A;  3Q2F A;  4NYX A;  3UVX A;  5G04 B;  2VP7 A;  4UIU A;  3N9O A;  5DX4 A;  4BJX A;  5TB6 A;  1WES A;  1MM2 A;  2YEK A;  5DKD A;  5DYU A;  5FH8 A;  2LDR A;  2DWW A;  4QEU A;  5KH9 A;  4QR3 A;  4Z93 A;  5F2P A;  5I89 A;  1FBV A;  5CUG A;  4PKL A;  2XEU A;  4IR4 A;  3C5K A;  5FE3 A;  3DQV R;  1Z6U A;  3RTR B;  4QUU A;  2ZET C;  4UIX A;  4TU6 A;  5I1Q A;  4HXO A;  4GND A;  4NRA A;  5D3S A;  2L85 A;  5DFB A;  5E3G A;  4YYG A;  4QR5 A;  4A9O A;  4FLP A;  3L1X A;  4NR9 A;  4HXK A;  5E0R A;  5ENH A;  5IGK A;  1WIL A;  3RPG C;  4AVX A;  5D24 A;  4PTB A;  5C7N A;  2BAY A;  4QF3 A;  5TRB A;  4A9E A;  4XY9 A;  4HXL A;  5TCM A;  5KH7 A;  5E9Y A;  5B76 A;  5H1T A;  4UIW A;  2WP2 A;  5EWC A;  4E96 A;  4GB0 A;  5E9V A;  4LZS A;  1WEO A;  2DAT A;  4TS8 A;  5A85 A;  4WIV A;  4MEQ A;  3UV4 A;  5EWV A;  4LZR A;  5FBX A;  4LDF A;  4I7D A;  5CUD A;  3EB5 A;  4LAD B;  4GNG A;  4F52 B;  2YSJ A;  3O70 A;  2VPG A;  4QUT A;  5G0F A;  5HJC A;  3ZPV 1;  5KTX A;  5DFC A;  1WEM A;  5AME A;  5A7C A;  2CKL B;  5D3J A;  4LRG A;  4J1P A;  2R0S A;  5CRZ A;  1VFY A;  2RI7 A;  5E9M A;  4QC1 A;  1LDJ B;  2MUM A;  2F42 A;  4NXJ A;  5F1L A;  1HYJ A;  1WEP A;  2KU3 A;  2RSD A;  5ETD A;  5F62 A;  2AN6 A;  4AYC A;  5CQ8 A;  4QB3 A;  5DIN A;  5D25 A;  2KFT A;  1LDK C;  3N9L A;  4N4I A;  5DKC A;  3QZT A;  3U5K A;  4CUR A;  4UIZ A;  5F61 A;  5EWW A;  5FH6 A;  5I80 A;  2E7N A;  4PCE A;  3P1D A;  5II1 A;  5B75 A;  5KO4 A;  5CQ3 A;  2LQ6 A;  2RNW A;  3GL6 A;  5KH3 A;  5DY7 A;  5EA1 A;  2KGI A;  4R8P K;  4I7C A;  2M3H A;  1WUG A;  3NXB A;  3UW9 A;  3P1C A;  5CTL A;  4Z1S A;  4CUT A;  5HFR A;  5AD3 A;  5EQ1 A;  5I88 A;  1WUM A;  2DX8 A;  1BOR A;  3HCU A;  4S3O B;  4F3I A;  5CQ6 A;  4QSW A;  2ECV A;  2LGG A;  3Q2E A;  3KNV A;  3M99 A;  4CUS A;  4Z1Q A;  5D1K B;  5CPE A;  5FE1 A;  5EWH A;  4MEN A;  5F5Z A;  5C11 A;  2QIC A;  5IGL A;  2KE1 A;  3HMH A;  2E3K A;  4A9I A;  1WEU A;  2Y43 A;  4IR6 A;  2DKW A;  3ZVY A;  4YYN A;  2MA5 A;  2I50 A;  2OO1 A;  5II2 A;  5E7D A;  3JVL A;  4NUC A;  5I29 A;  1WEV A;  2DVQ A;  4UI9 B;  3KV6 A;  5FE5 A;  3T7L A;  5CS8 A;  5AIU A;  5IID A;  5FE2 A;  1ZBD B;  4Z6H A;  5F25 A;  5A5O A;  5ENG A;  4BW1 A;  2L5U A;  2JMI A;  2LRI C;  5F36 A;  5D3R A;  4BHW A;  3JVM A;  4CUQ A;  5BT3 A;  4NUE A;  4O78 A;  2EOD A;  4J0R A;  4O64 A;  5F60 A;  2R10 A;  4WHW A;  3L11 A;  5DYC A;  4IR5 A;  3HTK C;  4MR6 A;  1JM4 B;  3QZV A;  1F62 A;  5JG6 A;  5J3X A;  1HYI A;  5L96 A;  5D26 A;  5DW2 A;  4AP4 A;  4ZQL A;  3QZS A;  3HCS A;  4R2Y A;  5E9I A;  4A9M A;  5D3H A;  4ALH A;  1E6I A;  2KGG A;  1U6G B;  3G0J A;  5FFW A;  2VJF B;  3G0L A;  5LVQ A;  3LQH A;  4AUQ B;  4HBX A;  1MM3 A;  4MVT A;  2L84 A;  4QSR A;  4TT4 A;  1X4U A;  5EU1 A;  4YAB A;  4YH3 A;  1DVP A;  3PUQ A;  5AD2 A;  3DWY A;  2XB1 A;  2G45 A;  2UZG A;  4KCX A;  5EGU A;  2NAA A;  4CCG X;  2ECN A;  2K1J A;  5FG4 A;  2RO1 A;  4CA1 A;  2OUO A;  3KV5 A;  2KWJ A;  3UV2 A;  1X4J A;  4QYD A;  3KQI A;  4B7Y C;  5EK9 A;  5LJ2 A;  3N9N A;  4UYE A;  5FER A;  4TTE A;  4A4C A;  2YSM A;  3SVF A;  3M63 A;  5CU8 A;  4AKN A;  2VNF A;  3N9Q A;  4A0C D;  4XUB A;  4O75 A;  3DPL R;  4QSU A;  4YYJ A;  4O76 A;  5FEY A;  3VK6 A;  5EP7 A;  2MT5 A;  4QST A;  2C2L A;  3LRQ A;  3ZPV E;  2D82 A;  4YK0 A;  4KV1 A;  4LYW A;  3HME A;  4N4H A;  4YBS A;  2H0D A;  2YYN A;  4ZDT A;  3I3J A;  3P1E A;  4IC2 A;  5HFQ A;  5F63 A;  4YY4 A;  5ENI A;  5CUA A;  4YYM A;  5LKX A;  4DON A;  5DLZ A;  2GRC A;  4TZ8 A;  2D9E A;  5JI8 A;  5H9M A;  3IHP A;  4HXN A;  4QC3 A;  2CSY A;  2KWK A;  4IC3 A;  3JVK A;  4NQM A;  4QSX A;  5FG5 A;  2L43 A;  2RNY A;  5D3T A;  5CQT A;  3UVW A;  4HXP A;  4UIT A;  1G25 A;  4NR7 A;  3U5L A;  4LYS A;  4A9K A;  1N87 A;  1ZS5 A;  4QEW A;  4OGI A;  5A5R A;  3UVD A;  3IU5 A;  4O77 A;  1WE9 A;  5D3P A;  3ZVZ B;  5FE6 A;  4S3O C;  4QBM A;  4Q0O A;  3O33 A;  4BW2 A;  3ZTG A;  4OUF A;  5HRV A;  5EPR A;  4NRB A;  4MR3 A;  1CHC A;  1WFK A;  2LSP B;  4O7E A;  2MNZ A;  5EIS A;  2H0D B;  2OSS A;  3K2J A;  4NUD A;  1V87 A;  1EQF A;  2JMD A;  5LCW B;  2L75 A;  3UVY A;  4C67 A;  3RCW A;  5F3A A;  5A5Q A;  5FE7 A;  2CSZ A;  2VPE A;  4NYW A;  3MHS A;  4X3G A;  5CQ5 A;  5CP5 A;  5CUE A;  2M85 A;  4UIV A;  5HEL A;  3SOX A;  5B77 A;  2DVV A;  2KTB B;  3T6R A;  4ZW1 A;  5IG6 A;  3AQA A;  4LZ2 A;  4NR8 A;  5DYX A;  1Z60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...