3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
4Z93A 2OXQC 2CSZA 4NUDA 5CRMA 5KTUA 5ENGA 2K16A 3M63A 1RMDA 4MENA 3K2JA 4NXJA 2PNXA 2PUYA 2LSPB 5DX4A 3QZVA 5IGNA 4BW3A 4TU6A 4CUQA 5LUUA 3NXBA 4NR8A 5E0RA 4QSVA 1X4IA 5DYAA 2L84A 2L0BA 5DW1A 3P5OA 2L43A 5LKZA 4YYHA 2C2LA 2YDWA 1Z60A 2UZGA 5D1MB 5DYUA 4YH3A 5CUEA 1N72A 5HRVA 1LDJB 4X3GA 3ZVYA 4Y03A 4HXPA 5EWVA 5F62A 4O71A 5DYCA 5A5RA 3SOXA 4Z1SA 4NS5A 3V43A 2LGKA 5G4RA 5L98A 3LJWA 4XY8A 2LGLA 4J3IA 4OGIA 4YAXA 5EGUA 5LJ2A 3G0LA 4O76A 1JM4B 1WEVA 3RTRB 4QSRA 5E9LA 3O70A 3ONIA 5CUGA 4YBMA 5D3PA 5EU1A 4YATA 2F6JA 4PCEA 4ZQLA 4NUCA 4LLBA 4F3IA 2VPBA 5FE0A 5FE2A 5F60A 4R7EA 5CRZA 2L5EA 3O33A 1WFKA 4O7FA 4TU4A 5E9VA 4Z6HA 5KU3A 5E3GA 2C2VS 5A5PA 5I83A 2KREA 3ZTGA 5KH7A 5ENBA 5FE6A 5B76A 2D82A 3JVMA 4PCIA 5EPSA 4MR6A 4RVRA 4PPEA 2M1RA 3O35A 5G0FA 1XWHA 4CUTA 4PKLA 5JWMA 5LJ1A 5EM3A 4QSPA 3N9OA 2KR4A 5I86A 5B8DA 5IGMA 4A9MA 1X0JA 4MVTA 5G04B 2F6NA 4QYLA 3LRQA 5CTLA 5TDRA 1VYXA 2DWWA 2DVQA 3KQIA 3P1CA 5FB1A 4Q6FA 5DINA 2LV9A 5HQ6A 1IYMA 2LN0A 2OUOA 4LRGA 4N4HA 4TT4A 4YBTA 5BT4A 5D0CA 5A82A 2QICA 4QEWA 5F5ZA 5B79A 4QF3A 3D7CA 2JMJA 5EWCA 4OUFA 2G6QA 1MM2A 4QB3A 4YC9A 5B77A 5L8TA 2YQMA 1JOCA 4QC3A 3PURA 3ZYUA 4GNFA 5H1TA 5TABA 4UIXA 5CUCA 4WZ2A 5G05B 4NYXA 1WEQA 5L96A 3N9NA 2E3KA 3IU5A 1HYIA 4YBSA 1VFYA 2ZETC 4AYCB 5E74A 2F42A 2MIQA 5CQAA 5HM0A 4J0SA 4TZ2A 5EWWA 1VD4A 5IBNA 4A9OA 2VPGA 2JMDA 4A49A 5CU8A 4QSUA 2VJEA 3LQHA 4XYAA 5C85A 2YU4A 2R0VA 5D3HA 2KYUA 4V3LC 5FBXA 4A9HA 5FG6A 5CGPA 2E6RA 2YHNA 5DYXA 3G0JA 5FH7A 5I1QA 5D3SA 2Y1NA 5B78A 5DKAA 4NN2A 2YEMA 4LZRA 1JM7B 3DQVR 5CQ6A 4YYJA 5EWHA 1WEEA 2ECWA 4UIZA 5JI8A 3M99A 4XUBA 2ECVA 1E4UA 2D9EA 2KTBB 5EA1A 2EA6A 5CZGA 2LRIC 5I29A 1T1HA 4YYKA 5AMFA 5L8UA 2KWKA 3GL6A 4ALGA 4AP4A 5I3LA 5KHMA 4UIVA 2N9GA 2DVSA 2JRJA 3HCSA 2RO1A 3UVWA 1WIMA 4HXLA 5II2A 4HXOA 3RCWA 5DKDA 2MNZA 3EB5A 4XI1A 4Z1QA 4BW4A 3SOUA 5D3TA 2YYRA 4C9ZA 2G43A 2K17A 2K1JA 3N9PA 4LJNA 3TLPA 5CQ4A 4IORA 4LYWA 4IR6A 3ZNIA 1WEOA 5EICA 2AN6A 3PHDA 4HBVA 4IR3A 5TB6A 4A9JA 2YEKA 5EISA 5ETDA 2IDAA 5TBNA 4B86C 5FH6A 4TQNA 2YW8A 5CUAA 2FUUA 3NG2A 4TYLA 5CUDA 4AUQB 4LK9A 5TRBA 3MUKA 4I7DA 1HYJA 4TT6A 4QR3A 4QR5A 5CS8A 4BW1A 4QSSA 2OSSA 5ENIA 5F25A 5HJCA 5HQ5A 1K2FA 3KV5A 3UV5A 4NUEA 2YW5A 5FG4A 4QNSA 3LQIA 4NRAA 4A4BA 2RNYA 4O75A 2XB1A 5CQ8A 5E9MA 5HELA 1V87A 3ZPVE 2ECGA 4UYHA 4I7CA 5H9MA 2RFJA 2CT2A 3L11A 5CP5A 5KTWA 4WZ3B 4QEVA 5LVQA 3T7LA 3KNVA 4MSXA 5DKCA 5AD3A 3U5MA 2CKLA 4NQMA 4A9NA 5BT5A 3HCTA 4NYVA 5AITA 5H1UA 4QUTA 2MA6A 5A5NA 4MR5A 4BHWA 3SVHA 5D24A 5K29A 1MM3A 3HCUA 5KTXA 5DFCA 5EYAF 3IU6A 3UVYA 5E9IA 3M62A 3GV4A 4O64A 2WP2A 5F36A 4UYFA 2H0DA 3L1ZB 4NQNA 2YUCA 4FIPA 4QSWA 4NYWA 3HTKC 2VPDA 2LXHC 2ECIA 2QIZA 4HXSA 5FFVA 4R2YA 5ACYA 2ECTA 3O34A 5FG5A 1FBVA 5I7XA 3S92A 4YYDA 2QJ0A 5A5SA 5A85A 4HXRA 5F1HA 5L97A 2EGPA 2L80A 2KU3A 4E96A 3SVFA 3LXJA 4QF2A 2RNXA 5I89A 5D3RA 2L75A 4LZSA 2G4AA 3FKMX 3Q2FA 5ETBA 2MNYA 2R10A 4XUAA 5I80A 4A0CD 4NR9A 5DFBA 3UVXA 2MUMA 4A9FA 2KWNA 5KH3A 4UITA 2CSYA 5EP7A 2YSMA 5EPRA 5EK9A 4A9EA 3PUQA 5C13A 2MD8C 4LC2A 5E73A 4BJXA 4LKAA 4PY6A 5EVAA 2RSDA 3EB6A 4QBMA 5ENFA 2VJEB 4KV1A 5TDWA 5FERA 4CL9A 4MR3A 3U5KA 5A5QA 1WEUA 3RPGC 5ENJA 5CY9A 3DWYA 4HBYA 1WUGA 2RS9B 5HQ7A 5D1LB 4O74A 5IGKA 3IHPA 5CPEA 4Q0NA 4QUUA 2MD7B 2YYNA 5FE5A 3MQMA 5EWDA 4TS8A 5ENEA 4WA6A 1DVPA 4W4UA 4O7EA 4CCGX 4LYSA 5E7DA 5COIA 1LDKC 5DLXA 4YY6A 4YYIA 1BORA 3O36A 5EQ1A 2YELA 2YQLA 3MXFA 2HYED 2YREA 4NR6A 1F68A 2EODA 3UV2A 4WHUA 5HRWA 4QC1A 4J0RA 3LQJA 4X2IA 4QEUA 5ENCA 3U5LA 4TZ8A 1WILA 5D3NA 3O7AA 5JG6A 3UW9A 4CLBA 4XY9A 2MA5A 2FSAA 4ALHA 2VJFA 1WEPA 4IOQA 2LDRA 3U5NA 3RPGB 2E7NA 2L85A 4LADB 4TKPB 2R0YA 4TTEA 2KGIA 2DATA 5FE9A 4HBXA 5F2PA 5F63A 3T6RA 1U6GB 3U5JA 2VPEA 2RNWA 2L5UA 4HXNA 3ZVZB 1WESA 5CFWA 5E3DA 4GPJA 1X4UA 4C66A 2NAAA 4S3OC 1F62A 5CQ7A 2YURA 5AMEA 5LCWB 4N4GA 2YHOA 4YYGA 4ZC9A 3HMHA 3MULA 2M85A 3I3JA 3U5OA 4HXMA 4R8PK 5F3AA 3C5KA 5D25A 5AD2A 4A9IA 4UI9B 4IR4A 4YABA 4N4IA 4LZ2A 1CHCA 3JVJA 5LKTA 3MHSA 5DW2A 2BAYA 5H1VA 5CQ5A 4TT2A 4QR4A 2VNFA 2Y43A 3SOWA 4LYIA 4N3WA 4CUPA 3JVKA 5D7XA 5FFYA 1WEWA 2YT5A 4AKNA 4CFLA 1Z2QA 4KCXA 5II1A 2CKLB 5J3XA 4WHWA 2ECNA 4LDFA 2DX8A 4GB0A 2LGVA 5LJ0A 4IOOA 3P1FA 4UIWA 4V3KC 3HMFA 4L58A 4CA1A 2KE1A 5EV9A 4O72A 1FP0A 5C89A 2YQDA 4CURA 5HFQA 4S3OB 1N87A 5CQTA 4AVXA 4UYFB 2H0DB 4QZSA 4PTBA 4CFKA 5IIDA 2K4DA 4A4CA 2M6MA 4FO9A 4HBWA 5FE1A 5A83A 2R0SA 4YYMA 4N4FA 3Q2EA 4MEPA 3DAIA 2Y1MA 4B7YC 4GNEA 4QSXA 3O37A 5I88A 5FB0A 4DONA 1G25A 5A81A 5EI4A 1WEMA 5FFWA 1JSPB 2LGGA 5C4QA 4I7BA 4YADA 5B75A 4MR4A 5E9KA 5HENA 4FK5A 5C11A 3P1EA 2E7OA 4NR4A 2E6SA 2DKWA 4YH4A 2D8SA 5HRXA 3QZTA 2XEUA 5DY7A 1WUMA 1WGMA 2RI7A 3MHHA 5G4SA 1WENA 3N9LA 2NXBA 3N9MA 4UP0A 2VP7A 4UP5A 5A5OA 2I7KA 5FE7A 5FDZA 4UYEA 3GG3A 2ECJA 2DVVA 3HMEA 4HXKA 3FL2A 3N9QA 3QZSA 3SVGA 4LR6A 4QYDA 5FE8A 5D26A 2DVRA 5FE4A 4FLPA 4YYNA 5C8GA 3VK6A 4BW2A 4F52B 3UV4A 5E9YA 2I8NA 5IGLA 5KO4A 4KV4A 5ENHA 4O7BA 5AIUA 5FEYA 2MJVB 4UIUA 4UYGA 5H85A 4O77A 4NRCA 2LQ6A 4ZDTA 5DKHA 5LVRA 2KGGA 5DBMA 3ASLA 2I50A 4IC3A 1ZS5A 4GNGA 4O78A 3P1DA 1X4JA 4NR7A 4PS5A 4YY4A 5LKUA 3S91A 2MT5A 2VJFB 3ZPV1 5A7CA 4O7CA 4J1PA 5HLSA 4MEOA 3C6WA 4O7AA 1Z6UA 4Z6IA 3DPLR 4P5OB 5DFDA 4NR5A 4CUUA 5BT3A 1WE9A 3UVDA 5IG6A 4CUSA 2H60A 2GRCA 3KV6A 4AYCA 3ZYQA 5D3LA 4IR5A 4Q0OA 5KH9A 4UIYA 3MB4A 1EQFA 4OGJA 1E6IA 4QSTA 2KIZA 4BBQA 2LXPC 4YK0A 5F61A 4UYDA 4A9LA 2KWJA 4NRBA 5TCMA 5FH8A 5L99A 5D3JA 3I2DA 5HCLA 2G45A 4ZUXU 5J0DA 4IC2A 1ZBDB 2JMIA 5DLZA 3MB3A 2WP1A 5EPBA 4A9KA 3U5PA 5I7YA 5LKXA 5CUBA 2YSJA 5D1KB 4MEQA 2OO1A 1JM7A 5FE3A 3AADA 3L1XA 5C87A 4FJCA 4C67A 5C7NA 3SHBA 2FUIA 4GNDA 5F1LA 4L7XA 4WIVA 5I40A 2M3HA 4QY4A 3AQAA 4ZW1A 5CQ3A 4QSQA 3JVLA 2KFTA 4WZ0A 2HDPA 4O70A 5HFRA 5HEMA 2KWOA
chains in the Genus database with same CATH superfamily
4Z93A 2OXQC 2CSZA 4H9DA 4NUDA 5CRMA 5KTUA 4OGCA 5ENGA 2K16A 3M63A 1RMDA 4MENA 3K2JA 4NXJA 2PNXA 2PUYA 3LVRE 2LSPB 5DX4A 3QZVA 5IGNA 4BW3A 4TU6A 4CUQA 5LUUA 3NXBA 4NR8A 5E0RA 4QSVA 1X4IA 5DYAA 2L84A 2L0BA 2CRWA 5DW1A 3P5OA 2L43A 3VKHA 5LKZA 4YYHA 1DCQA 2YDWA 2C2LA 3FANA 3FEHA 1Z60A 2UZGA 5D1MB 5DYUA 3T9KA 4YH3A 5CUEA 1N72A 5HRVA 1LDJB 4X3GA 3ZVYA 4Y03A 4HXPA 5EWVA 5F62A 4O71A 5DYCA 5A5RA 3SOXA 4Z1SA 4NS5A 3V43A 2LGKA 5G4RA 5L98A 3LJWA 4XY8A 2LGLA 4J3IA 4OGIA 4YAXA 5EGUA 5LJ2A 3G0LA 4O76A 1JM4B 1WEVA 3RTRB 4QSRA 1PUOA 5E9LA 3O70A 3ONIA 5CUGA 4YBMA 5D3PA 5EU1A 4YATA 2F6JA 4PCEA 4ZQLA 4NUCA 4LLBA 4F3IA 2VPBA 5FE0A 5FE2A 5F60A 4R7EA 5CRZA 2L5EA 3O33A 1WFKA 4O7FA 4TU4A 5E9VA 4Z6HA 5KU3A 5E3GA 2C2VS 5A5PA 5I83A 2KREA 3ZTGA 5KH7A 5ENBA 5FE6A 5B76A 2D82A 3JVMA 4PCIA 5EPSA 4MR6A 4RVRA 4PPEA 2M1RA 3O35A 5G0FA 1XWHA 4CUTA 4PKLA 5JWMA 5LJ1A 5EM3A 4QSPA 3N9OA 2KR4A 5I86A 5B8DA 5IGMA 4A9MA 1X0JA 4MVTA 3E2DA 5G04B 2F6NA 4QYLA 3H7HA 3LRQA 5CTLA 2CSVA 5TDRA 1VYXA 2DWWA 2DVQA 3KQIA 3P1CA 5FB1A 4Q6FA 5DINA 2LV9A 5HQ6A 1IYMA 2LN0A 2OUOA 4LRGA 4N4HA 4TT4A 4YBTA 5BT4A 5D0CA 5A82A 2QICA 4QEWA 5F5ZA 5B79A 4QF3A 5SVXA 3D7CA 2JMJA 5EWCA 3M7KA 4OUFA 2G6QA 1MM2A 4QB3A 4YC9A 5B77A 5L8TA 2YQMA 1JOCA 4QC3A 3PURA 3ZYUA 4GNFA 5H1TA 5TABA 4UIXA 5CUCA 4WZ2A 5G05B 4NYXA 1WEQA 5L96A 3N9NA 2E3KA 3IU5A 1HYIA 2LAUA 4AKHA 4YBSA 1VFYA 2ZETC 4AYCB 5E74A 3VKGA 2F42A 2MIQA 5CQAA 2CONA 5HM0A 4J0SA 4TZ2A 5EWWA 1VD4A 5IBNA 4A9OA 2VPGA 2JMDA 4A49A 5CU8A 4QSUA 2VJEA 3LQHA 4XYAA 5C85A 2YU4A 2R0VA 5D3HA 2KYUA 4V3LC 5FBXA 4A9HA 5FG6A 5CGPA 2E6RA 2YHNA 5DYXA 3G0JA 5FH7A 5I1QA 5D3SA 2Y1NA 5B78A 5DKAA 4NN2A 2YEMA 4LZRA 1JM7B 3DQVR 5CQ6A 4YYJA 5EWHA 1WEEA 2ECWA 4UIZA 5JI8A 3M99A 4XUBA 2ECVA 1E4UA 2D9EA 2KTBB 2KKYA 5EA1A 2EA6A 5CZGA 2LRIC 5I29A 1MBMA 4YYKA 1T1HA 2XOYA 5AMFA 5L8UA 2KWKA 3GL6A 4ALGA 4AP4A 5I3LA 5KHMA 4UIVA 2N9GA 2DVSA 2JRJA 3HCSA 2RO1A 3UVWA 1WIMA 4HXLA 5II2A 4HXOA 3RCWA 5DKDA 2MNZA 3EB5A 4XI1A 4Z1QA 4BW4A 3SOUA 5D3TA 2YYRA 4C9ZA 2G43A 2K17A 2K1JA 3N9PA 4LJNA 3TLPA 3LJUX 5CQ4A 4IORA 4LYWA 4IR6A 3ZNIA 1WEOA 5EICA 2AN6A 3PHDA 4HBVA 4IR3A 5TB6A 4A9JA 2YEKA 5EISA 5ETDA 2IDAA 3FAOA 5TBNA 4B86C 5FH6A 4TQNA 2YW8A 5CUAA 2FUUA 3NG2A 4TYLA 5CUDA 4AUQB 4LK9A 5TRBA 1ZKRA 3MUKA 4I7DA 4TT6A 1HYJA 4QR3A 4QR5A 5CS8A 4BW1A 4QSSA 2OSSA 5ENIA 5F25A 5HJCA 5HQ5A 1K2FA 3KV5A 5SVYA 3UV5A 4NUEA 2YW5A 5FG4A 4QNSA 3LQIA 4NRAA 2EXUA 4A4BA 2RNYA 4O75A 2XB1A 5CQ8A 5E9MA 5HELA 1V87A 3ZPVE 2ECGA 4UYHA 4I7CA 5H9MA 2RFJA 2CT2A 3L11A 5CP5A 5KTWA 3DDTA 4QEVA 5LVQA 3FM8C 4WZ3B 3KNVA 3T7LA 4MSXA 5DKCA 5AD3A 3U5MA 2B0OE 2CKLA 4NQMA 4A9NA 5BT5A 3HCTA 4NYVA 5AITA 5H1UA 4QUTA 2MA6A 5A5NA 4MR5A 4BHWA 3SVHA 5D24A 5K29A 1MM3A 3HCUA 5KTXA 5DFCA 5EYAF 2D8UA 3IU6A 3UVYA 5E9IA 3M62A 3GV4A 4O64A 2WP2A 5F36A 4UYFA 2H0DA 3L1ZB 4NQNA 2YUCA 3LVQE 4FIPA 4QSWA 4NYWA 3HTKC 2VPDA 2XOZA 2LXHC 2ECIA 2QIZA 4HXSA 5FFVA 4R2YA 2L7PA 5ACYA 2ECTA 3O34A 5FG5A 1FBVA 5I7XA 3S92A 4YYDA 2QJ0A 5A5SA 5A85A 4HXRA 5F1HA 5L97A 2EGPA 2L80A 3DWDA 2KU3A 4E96A 3SVFA 3LXJA 4QF2A 2RNXA 5I89A 5D3RA 3D1DA 2L75A 4LZSA 2G4AA 3FKMX 3Q2FA 5ETBA 2MNYA 2R10A 4XUAA 5I80A 4A0CD 4NR9A 5DFBA 3UVXA 2MUMA 4A9FA 2KWNA 5KH3A 4UITA 2CSYA 5EP7A 2YSMA 5EPRA 5EK9A 4A9EA 3PUQA 5C13A 2MD8C 4LC2A 5E73A 4BJXA 4LKAA 4PY6A 5EVAA 2RSDA 3EB6A 4QBMA 5ENFA 2VJEB 4KV1A 2XOCA 5TDWA 4CL9A 5FERA 4MR3A 3LDYA 3U5KA 5A5QA 1WEUA 3RPGC 5ENJA 5CY9A 3DWYA 4HBYA 1WUGA 2RS9B 5HQ7A 5D1LB 4O74A 4AI6A 5IGKA 3IHPA 5CPEA 3PLWA 4Q0NA 4QUUA 2MD7B 2YYNA 5FE5A 3MQMA 5EWDA 4TS8A 5ENEA 4WA6A 1DVPA 4W4UA 4O7EA 4CCGX 4LYSA 5E7DA 5COIA 1LDKC 5DLXA 2DSMA 4YY6A 4YYIA 1BORA 3MDBC 3O36A 5EQ1A 2YELA 2YQLA 3MXFA 2HYED 2YREA 4NR6A 1F68A 2EODA 3UV2A 4WHUA 5HRWA 4QC1A 4J0RA 3LQJA 4X2IA 4QEUA 5ENCA 3U5LA 4TZ8A 1WILA 5D3NA 3O7AA 5JG6A 3UW9A 4CLBA 4XY9A 2MA5A 2FSAA 4ALHA 2VJFA 1WEPA 4IOQA 2LDRA 3U5NA 3RPGB 2E7NA 2L85A 4LADB 4TKPB 2R0YA 4TTEA 2KGIA 2DATA 5FE9A 4HBXA 3JUEA 5F2PA 5F63A 2EGMA 1U6GB 3T6RA 3U5JA 2VPEA 2RNWA 2L5UA 4HXNA 3ZVZB 1WESA 5CFWA 5E3DA 4GPJA 1X4UA 4C66A 2NAAA 4S3OC 1F62A 5CQ7A 2YURA 5AMEA 5LCWB 4N4GA 2YHOA 4YYGA 3SUBA 4ZC9A 3HMHA 3MULA 2M85A 3I3JA 3U5OA 4HXMA 4R8PK 5F3AA 3C5KA 2FD4A 5D25A 5AD2A 2JM3A 4A9IA 2YVRA 4UI9B 4IR4A 4YABA 4N4IA 4LZ2A 1CHCA 3JVJA 5LKTA 3MHSA 5DW2A 2BAYA 4AKIA 5H1VA 5CQ5A 5SVIB 4TT2A 4QR4A 2VNFA 2Y43A 3SOWA 3D1BA 4OGEA 4LYIA 4N3WA 4CUPA 3JVKA 5D7XA 5FFYA 1WEWA 2YT5A 4AKNA 4CFLA 1Z2QA 5K3QA 4KCXA 5II1A 2CKLB 4Z0OA 5J3XA 4F1PA 4WHWA 2ECNA 4LDFA 5SVIA 2DX8A 4QQ4A 4GB0A 2LGVA 5LJ0A 4IOOA 3P1FA 4UIWA 4V3KC 3HMFA 4L58A 2FFWA 4CA1A 2KE1A 5EV9A 4O72A 3KDEC 1FP0A 5C89A 2YQDA 4CURA 5HFQA 4S3OB 1N87A 5CQTA 2XP0A 4AVXA 4UYFB 2H0DB 4QZSA 4PTBA 4CFKA 5IIDA 2K4DA 4A4CA 2M6MA 4FO9A 4HBWA 5FE1A 5A83A 2R0SA 3O47A 4YYMA 4N4FA 2JUNA 3Q2EA 4MEPA 3DAIA 2Y1MA 4B7YC 4GNEA 4QSXA 3ERRA 3O37A 5I88A 5FB0A 4DONA 1G25A 4AKGA 5A81A 5EI4A 1WEMA 5FFWA 1JSPB 2LGGA 5C4QA 4I7BA 4YADA 5B75A 4MR4A 5E9KA 5HENA 4FK5A 2IQJA 5C11A 3P1EA 2E7OA 4NR4A 2E6SA 2DKWA 4YH4A 2D8SA 5HRXA 3QZTA 2XEUA 5DY7A 1WUMA 1WGMA 2RI7A 3MHHA 5G4SA 1WENA 3N9LA 2NXBA 2CRRA 3N9MA 4UP0A 2VP7A 4UP5A 5A5OA 2I7KA 5FE7A 5FDZA 4UYEA 3GG3A 2ECJA 2DVVA 3HMEA 4HXKA 3FL2A 3N9QA 3QZSA 3SVGA 4LR6A 4QYDA 5FE8A 4O62A 5D26A 2DVRA 5FE4A 4FLPA 4YYNA 5C8GA 2RR4A 4BW2A 3VK6A 4F52B 3UV4A 5E9YA 2I8NA 5IGLA 5KO4A 4KV4A 5ENHA 4O7BA 5AIUA 5FEYA 2MJVB 4UIUA 4UYGA 5H85A 4O77A 4NRCA 2LQ6A 4ZDTA 5DKHA 5LVRA 2KGGA 5DBMA 3FJUB 3ASLA 2I50A 4IC3A 1ZS5A 4GNGA 4O78A 3P1DA 1X4JA 4NR7A 2OWAA 4PS5A 4YY4A 5LKUA 3S91A 2MT5A 2VJFB 3ZPV1 5A7CA 4O7CA 4J1PA 5HLSA 4MEOA 3C6WA 4O7AA 1Z6UA 4Z6IA 3DPLR 4P5OB 5DFDA 2DJAA 4NR5A 4CUUA 5BT3A 1WE9A 3UVDA 5IG6A 4CUSA 2H60A 2GRCA 2EJNA 3KV6A 4AYCA 3ZYQA 5D3LA 4IR5A 4Q0OA 5KH9A 4UIYA 3MB4A 1EQFA 4OGJA 1E6IA 4QSTA 2KIZA 4BBQA 2LXPC 4YK0A 5F61A 4UYDA 4A9LA 2KWJA 4NRBA 5TCMA 5FH8A 5L99A 5D3JA 3I2DA 5HCLA 2G45A 4ZUXU 5J0DA 4IC2A 1ZBDB 2JMIA 4Z0RA 5DLZA 3MB3A 2KKXA 2WP1A 5EPBA 4A9KA 3U5PA 5I7YA 5LKXA 5CUBA 2YSJA 5D1KB 4MEQA 2OO1A 1JM7A 5FE3A 3AADA 3L1XA 5C87A 2P57A 4FJCA 4C67A 5C7NA 3SHBA 2FUIA 4GNDA 2M13A 2E61A 5F1LA 4L7XA 3Q1DA 4WIVA 5I40A 2M3HA 4QY4A 3AQAA 4ZW1A 5CQ3A 4QSQA 3JVLA 2KFTA 2MKEA 4WZ0A 2HDPA 4O70A 5HFRA 5HEMA 2KWOA
chains in the Genus database with same CATH topology
4Z93A 2OXQC 2CSZA 4NUDA 5CRMA 5KTUA 5ENGA 2K16A 3M63A 1RMDA 4MENA 3K2JA 4NXJA 2PNXA 2PUYA 2LSPB 5DX4A 3QZVA 5IGNA 4BW3A 4TU6A 4CUQA 5LUUA 3NXBA 4NR8A 5E0RA 4QSVA 1X4IA 5DYAA 2L84A 2L0BA 5DW1A 3P5OA 2L43A 5LKZA 4YYHA 2C2LA 2YDWA 1Z60A 2UZGA 5D1MB 5DYUA 4YH3A 5CUEA 1N72A 5HRVA 1LDJB 4X3GA 3ZVYA 4Y03A 4HXPA 5EWVA 5F62A 4O71A 5DYCA 5A5RA 3SOXA 4Z1SA 4NS5A 3V43A 2LGKA 5G4RA 5L98A 3LJWA 4XY8A 2LGLA 4J3IA 4OGIA 4YAXA 5EGUA 5LJ2A 3G0LA 4O76A 1JM4B 1WEVA 3RTRB 4QSRA 5E9LA 3O70A 3ONIA 5CUGA 4YBMA 5D3PA 5EU1A 4YATA 2F6JA 4PCEA 4ZQLA 4NUCA 4LLBA 4F3IA 2VPBA 5FE0A 5FE2A 5F60A 4R7EA 5CRZA 2L5EA 3O33A 1WFKA 4O7FA 4TU4A 5E9VA 4Z6HA 5KU3A 5E3GA 2C2VS 5A5PA 5I83A 2KREA 3ZTGA 5KH7A 5ENBA 5FE6A 5B76A 2D82A 3JVMA 4PCIA 5EPSA 4MR6A 4RVRA 4PPEA 2M1RA 3O35A 5G0FA 1XWHA 4CUTA 4PKLA 5JWMA 5LJ1A 5EM3A 4QSPA 3N9OA 2KR4A 5I86A 5B8DA 5IGMA 4A9MA 1X0JA 4MVTA 5G04B 2F6NA 4QYLA 3LRQA 5CTLA 5TDRA 1VYXA 2DWWA 2DVQA 3KQIA 3P1CA 5FB1A 4Q6FA 5DINA 2LV9A 5HQ6A 1IYMA 2LN0A 2OUOA 4LRGA 4N4HA 4TT4A 4YBTA 5BT4A 5D0CA 5A82A 2QICA 4QEWA 5F5ZA 5B79A 4QF3A 3D7CA 2JMJA 5EWCA 4OUFA 2G6QA 1MM2A 4QB3A 4YC9A 5B77A 5L8TA 2YQMA 1JOCA 4QC3A 3PURA 3ZYUA 4GNFA 5H1TA 5TABA 4UIXA 5CUCA 4WZ2A 5G05B 4NYXA 1WEQA 5L96A 3N9NA 2E3KA 3IU5A 1HYIA 4YBSA 1VFYA 2ZETC 4AYCB 5E74A 2F42A 2MIQA 5CQAA 5HM0A 4J0SA 4TZ2A 5EWWA 1VD4A 5IBNA 4A9OA 2VPGA 2JMDA 4A49A 5CU8A 4QSUA 2VJEA 3LQHA 4XYAA 5C85A 2YU4A 2R0VA 5D3HA 2KYUA 4V3LC 5FBXA 4A9HA 5FG6A 5CGPA 2E6RA 2YHNA 5DYXA 3G0JA 5FH7A 5I1QA 5D3SA 2Y1NA 5B78A 5DKAA 4NN2A 2YEMA 4LZRA 1JM7B 3DQVR 5CQ6A 4YYJA 5EWHA 1WEEA 2ECWA 4UIZA 5JI8A 3M99A 4XUBA 2ECVA 1E4UA 2D9EA 2KTBB 5EA1A 2EA6A 5CZGA 2LRIC 5I29A 1T1HA 4YYKA 5AMFA 5L8UA 2KWKA 3GL6A 4ALGA 4AP4A 5I3LA 5KHMA 4UIVA 2N9GA 2DVSA 2JRJA 3HCSA 2RO1A 3UVWA 1WIMA 4HXLA 5II2A 4HXOA 3RCWA 5DKDA 2MNZA 3EB5A 4XI1A 4Z1QA 4BW4A 3SOUA 5D3TA 2YYRA 4C9ZA 2G43A 2K17A 2K1JA 3N9PA 4LJNA 3TLPA 5CQ4A 4IORA 4LYWA 4IR6A 3ZNIA 1WEOA 5EICA 2AN6A 3PHDA 4HBVA 4IR3A 5TB6A 4A9JA 2YEKA 5EISA 5ETDA 2IDAA 5TBNA 4B86C 5FH6A 4TQNA 2YW8A 5CUAA 2FUUA 3NG2A 4TYLA 5CUDA 4AUQB 4LK9A 5TRBA 3MUKA 4I7DA 1HYJA 4TT6A 4QR3A 4QR5A 5CS8A 4BW1A 4QSSA 2OSSA 5ENIA 5F25A 5HJCA 5HQ5A 1K2FA 3KV5A 3UV5A 4NUEA 2YW5A 5FG4A 4QNSA 3LQIA 4NRAA 4A4BA 2RNYA 4O75A 2XB1A 5CQ8A 5E9MA 5HELA 1V87A 3ZPVE 2ECGA 4UYHA 4I7CA 5H9MA 2RFJA 2CT2A 3L11A 5CP5A 5KTWA 4WZ3B 4QEVA 5LVQA 3T7LA 3KNVA 4MSXA 5DKCA 5AD3A 3U5MA 2CKLA 4NQMA 4A9NA 5BT5A 3HCTA 4NYVA 5AITA 5H1UA 4QUTA 2MA6A 5A5NA 4MR5A 4BHWA 3SVHA 5D24A 5K29A 1MM3A 3HCUA 5KTXA 5DFCA 5EYAF 3IU6A 3UVYA 5E9IA 3M62A 3GV4A 4O64A 2WP2A 5F36A 4UYFA 2H0DA 3L1ZB 4NQNA 2YUCA 4FIPA 4QSWA 4NYWA 3HTKC 2VPDA 2LXHC 2ECIA 2QIZA 4HXSA 5FFVA 4R2YA 5ACYA 2ECTA 3O34A 5FG5A 1FBVA 5I7XA 3S92A 4YYDA 2QJ0A 5A5SA 5A85A 4HXRA 5F1HA 5L97A 2EGPA 2L80A 2KU3A 4E96A 3SVFA 3LXJA 4QF2A 2RNXA 5I89A 5D3RA 2L75A 4LZSA 2G4AA 3FKMX 3Q2FA 5ETBA 2MNYA 2R10A 4XUAA 5I80A 4A0CD 4NR9A 5DFBA 3UVXA 2MUMA 4A9FA 2KWNA 5KH3A 4UITA 2CSYA 5EP7A 2YSMA 5EPRA 5EK9A 4A9EA 3PUQA 5C13A 2MD8C 4LC2A 5E73A 4BJXA 4LKAA 4PY6A 5EVAA 2RSDA 3EB6A 4QBMA 5ENFA 2VJEB 4KV1A 5TDWA 5FERA 4CL9A 4MR3A 3U5KA 5A5QA 1WEUA 3RPGC 5ENJA 5CY9A 3DWYA 4HBYA 1WUGA 2RS9B 5HQ7A 5D1LB 4O74A 5IGKA 3IHPA 5CPEA 4Q0NA 4QUUA 2MD7B 2YYNA 5FE5A 3MQMA 5EWDA 4TS8A 5ENEA 4WA6A 1DVPA 4W4UA 4O7EA 4CCGX 4LYSA 5E7DA 5COIA 1LDKC 5DLXA 4YY6A 4YYIA 1BORA 3O36A 5EQ1A 2YELA 2YQLA 3MXFA 2HYED 2YREA 4NR6A 1F68A 2EODA 3UV2A 4WHUA 5HRWA 4QC1A 4J0RA 3LQJA 4X2IA 4QEUA 5ENCA 3U5LA 4TZ8A 1WILA 5D3NA 3O7AA 5JG6A 3UW9A 4CLBA 4XY9A 2MA5A 2FSAA 4ALHA 2VJFA 1WEPA 4IOQA 2LDRA 3U5NA 3RPGB 2E7NA 2L85A 4LADB 4TKPB 2R0YA 4TTEA 2KGIA 2DATA 5FE9A 4HBXA 5F2PA 5F63A 3T6RA 1U6GB 3U5JA 2VPEA 2RNWA 2L5UA 4HXNA 3ZVZB 1WESA 5CFWA 5E3DA 4GPJA 1X4UA 4C66A 2NAAA 4S3OC 1F62A 5CQ7A 2YURA 5AMEA 5LCWB 4N4GA 2YHOA 4YYGA 4ZC9A 3HMHA 3MULA 2M85A 3I3JA 3U5OA 4HXMA 4R8PK 5F3AA 3C5KA 5D25A 5AD2A 4A9IA 4UI9B 4IR4A 4YABA 4N4IA 4LZ2A 1CHCA 3JVJA 5LKTA 3MHSA 5DW2A 2BAYA 5H1VA 5CQ5A 4TT2A 4QR4A 2VNFA 2Y43A 3SOWA 4LYIA 4N3WA 4CUPA 3JVKA 5D7XA 5FFYA 1WEWA 2YT5A 4AKNA 4CFLA 1Z2QA 4KCXA 5II1A 2CKLB 5J3XA 4WHWA 2ECNA 4LDFA 2DX8A 4GB0A 2LGVA 5LJ0A 4IOOA 3P1FA 4UIWA 4V3KC 3HMFA 4L58A 4CA1A 2KE1A 5EV9A 4O72A 1FP0A 5C89A 2YQDA 4CURA 5HFQA 4S3OB 1N87A 5CQTA 4AVXA 4UYFB 2H0DB 4QZSA 4PTBA 4CFKA 5IIDA 2K4DA 4A4CA 2M6MA 4FO9A 4HBWA 5FE1A 5A83A 2R0SA 4YYMA 4N4FA 3Q2EA 4MEPA 3DAIA 2Y1MA 4B7YC 4GNEA 4QSXA 3O37A 5I88A 5FB0A 4DONA 1G25A 5A81A 5EI4A 1WEMA 5FFWA 1JSPB 2LGGA 5C4QA 4I7BA 4YADA 5B75A 4MR4A 5E9KA 5HENA 4FK5A 5C11A 3P1EA 2E7OA 4NR4A 2E6SA 2DKWA 4YH4A 2D8SA 5HRXA 3QZTA 2XEUA 5DY7A 1WUMA 1WGMA 2RI7A 3MHHA 5G4SA 1WENA 3N9LA 2NXBA 3N9MA 4UP0A 2VP7A 4UP5A 5A5OA 2I7KA 5FE7A 5FDZA 4UYEA 3GG3A 2ECJA 2DVVA 3HMEA 4HXKA 3FL2A 3N9QA 3QZSA 3SVGA 4LR6A 4QYDA 5FE8A 5D26A 2DVRA 5FE4A 4FLPA 4YYNA 5C8GA 3VK6A 4BW2A 4F52B 3UV4A 5E9YA 2I8NA 5IGLA 5KO4A 4KV4A 5ENHA 4O7BA 5AIUA 5FEYA 2MJVB 4UIUA 4UYGA 5H85A 4O77A 4NRCA 2LQ6A 4ZDTA 5DKHA 5LVRA 2KGGA 5DBMA 3ASLA 2I50A 4IC3A 1ZS5A 4GNGA 4O78A 3P1DA 1X4JA 4NR7A 4PS5A 4YY4A 5LKUA 3S91A 2MT5A 2VJFB 3ZPV1 5A7CA 4O7CA 4J1PA 5HLSA 4MEOA 3C6WA 4O7AA 1Z6UA 4Z6IA 3DPLR 4P5OB 5DFDA 4NR5A 4CUUA 5BT3A 1WE9A 3UVDA 5IG6A 4CUSA 2H60A 2GRCA 3KV6A 4AYCA 3ZYQA 5D3LA 4IR5A 4Q0OA 5KH9A 4UIYA 3MB4A 1EQFA 4OGJA 1E6IA 4QSTA 2KIZA 4BBQA 2LXPC 4YK0A 5F61A 4UYDA 4A9LA 2KWJA 4NRBA 5TCMA 5FH8A 5L99A 5D3JA 3I2DA 5HCLA 2G45A 4ZUXU 5J0DA 4IC2A 1ZBDB 2JMIA 5DLZA 3MB3A 2WP1A 5EPBA 4A9KA 3U5PA 5I7YA 5LKXA 5CUBA 2YSJA 5D1KB 4MEQA 2OO1A 1JM7A 5FE3A 3AADA 3L1XA 5C87A 4FJCA 4C67A 5C7NA 3SHBA 2FUIA 4GNDA 5F1LA 4L7XA 4WIVA 5I40A 2M3HA 4QY4A 3AQAA 4ZW1A 5CQ3A 4QSQA 3JVLA 2KFTA 4WZ0A 2HDPA 4O70A 5HFRA 5HEMA 2KWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z93 A;  2OXQ C;  2CSZ A;  4NUD A;  5CRM A;  5KTU A;  5ENG A;  2K16 A;  3M63 A;  1RMD A;  4MEN A;  3K2J A;  4NXJ A;  2PNX A;  2PUY A;  2LSP B;  5DX4 A;  3QZV A;  5IGN A;  4BW3 A;  4TU6 A;  4CUQ A;  5LUU A;  3NXB A;  4NR8 A;  5E0R A;  4QSV A;  1X4I A;  5DYA A;  2L84 A;  2L0B A;  5DW1 A;  3P5O A;  2L43 A;  5LKZ A;  4YYH A;  2C2L A;  2YDW A;  1Z60 A;  2UZG A;  5D1M B;  5DYU A;  4YH3 A;  5CUE A;  1N72 A;  5HRV A;  1LDJ B;  4X3G A;  3ZVY A;  4Y03 A;  4HXP A;  5EWV A;  5F62 A;  4O71 A;  5DYC A;  5A5R A;  3SOX A;  4Z1S A;  4NS5 A;  3V43 A;  2LGK A;  5G4R A;  5L98 A;  3LJW A;  4XY8 A;  2LGL A;  4J3I A;  4OGI A;  4YAX A;  5EGU A;  5LJ2 A;  3G0L A;  4O76 A;  1JM4 B;  1WEV A;  3RTR B;  4QSR A;  5E9L A;  3O70 A;  3ONI A;  5CUG A;  4YBM A;  5D3P A;  5EU1 A;  4YAT A;  2F6J A;  4PCE A;  4ZQL A;  4NUC A;  4LLB A;  4F3I A;  2VPB A;  5FE0 A;  5FE2 A;  5F60 A;  4R7E A;  5CRZ A;  2L5E A;  3O33 A;  1WFK A;  4O7F A;  4TU4 A;  5E9V A;  4Z6H A;  5KU3 A;  5E3G A;  2C2V S;  5A5P A;  5I83 A;  2KRE A;  3ZTG A;  5KH7 A;  5ENB A;  5FE6 A;  5B76 A;  2D82 A;  3JVM A;  4PCI A;  5EPS A;  4MR6 A;  4RVR A;  4PPE A;  2M1R A;  3O35 A;  5G0F A;  1XWH A;  4CUT A;  4PKL A;  5JWM A;  5LJ1 A;  5EM3 A;  4QSP A;  3N9O A;  2KR4 A;  5I86 A;  5B8D A;  5IGM A;  4A9M A;  1X0J A;  4MVT A;  5G04 B;  2F6N A;  4QYL A;  3LRQ A;  5CTL A;  5TDR A;  1VYX A;  2DWW A;  2DVQ A;  3KQI A;  3P1C A;  5FB1 A;  4Q6F A;  5DIN A;  2LV9 A;  5HQ6 A;  1IYM A;  2LN0 A;  2OUO A;  4LRG A;  4N4H A;  4TT4 A;  4YBT A;  5BT4 A;  5D0C A;  5A82 A;  2QIC A;  4QEW A;  5F5Z A;  5B79 A;  4QF3 A;  3D7C A;  2JMJ A;  5EWC A;  4OUF A;  2G6Q A;  1MM2 A;  4QB3 A;  4YC9 A;  5B77 A;  5L8T A;  2YQM A;  1JOC A;  4QC3 A;  3PUR A;  3ZYU A;  4GNF A;  5H1T A;  5TAB A;  4UIX A;  5CUC A;  4WZ2 A;  5G05 B;  4NYX A;  1WEQ A;  5L96 A;  3N9N A;  2E3K A;  3IU5 A;  1HYI A;  4YBS A;  1VFY A;  2ZET C;  4AYC B;  5E74 A;  2F42 A;  2MIQ A;  5CQA A;  5HM0 A;  4J0S A;  4TZ2 A;  5EWW A;  1VD4 A;  5IBN A;  4A9O A;  2VPG A;  2JMD A;  4A49 A;  5CU8 A;  4QSU A;  2VJE A;  3LQH A;  4XYA A;  5C85 A;  2YU4 A;  2R0V A;  5D3H A;  2KYU A;  4V3L C;  5FBX A;  4A9H A;  5FG6 A;  5CGP A;  2E6R A;  2YHN A;  5DYX A;  3G0J A;  5FH7 A;  5I1Q A;  5D3S A;  2Y1N A;  5B78 A;  5DKA A;  4NN2 A;  2YEM A;  4LZR A;  1JM7 B;  3DQV R;  5CQ6 A;  4YYJ A;  5EWH A;  1WEE A;  2ECW A;  4UIZ A;  5JI8 A;  3M99 A;  4XUB A;  2ECV A;  1E4U A;  2D9E A;  2KTB B;  5EA1 A;  2EA6 A;  5CZG A;  2LRI C;  5I29 A;  1T1H A;  4YYK A;  5AMF A;  5L8U A;  2KWK A;  3GL6 A;  4ALG A;  4AP4 A;  5I3L A;  5KHM A;  4UIV A;  2N9G A;  2DVS A;  2JRJ A;  3HCS A;  2RO1 A;  3UVW A;  1WIM A;  4HXL A;  5II2 A;  4HXO A;  3RCW A;  5DKD A;  2MNZ A;  3EB5 A;  4XI1 A;  4Z1Q A;  4BW4 A;  3SOU A;  5D3T A;  2YYR A;  4C9Z A;  2G43 A;  2K17 A;  2K1J A;  3N9P A;  4LJN A;  3TLP A;  5CQ4 A;  4IOR A;  4LYW A;  4IR6 A;  3ZNI A;  1WEO A;  5EIC A;  2AN6 A;  3PHD A;  4HBV A;  4IR3 A;  5TB6 A;  4A9J A;  2YEK A;  5EIS A;  5ETD A;  2IDA A;  5TBN A;  4B86 C;  5FH6 A;  4TQN A;  2YW8 A;  5CUA A;  2FUU A;  3NG2 A;  4TYL A;  5CUD A;  4AUQ B;  4LK9 A;  5TRB A;  3MUK A;  4I7D A;  1HYJ A;  4TT6 A;  4QR3 A;  4QR5 A;  5CS8 A;  4BW1 A;  4QSS A;  2OSS A;  5ENI A;  5F25 A;  5HJC A;  5HQ5 A;  1K2F A;  3KV5 A;  3UV5 A;  4NUE A;  2YW5 A;  5FG4 A;  4QNS A;  3LQI A;  4NRA A;  4A4B A;  2RNY A;  4O75 A;  2XB1 A;  5CQ8 A;  5E9M A;  5HEL A;  1V87 A;  3ZPV E;  2ECG A;  4UYH A;  4I7C A;  5H9M A;  2RFJ A;  2CT2 A;  3L11 A;  5CP5 A;  5KTW A;  4WZ3 B;  4QEV A;  5LVQ A;  3T7L A;  3KNV A;  4MSX A;  5DKC A;  5AD3 A;  3U5M A;  2CKL A;  4NQM A;  4A9N A;  5BT5 A;  3HCT A;  4NYV A;  5AIT A;  5H1U A;  4QUT A;  2MA6 A;  5A5N A;  4MR5 A;  4BHW A;  3SVH A;  5D24 A;  5K29 A;  1MM3 A;  3HCU A;  5KTX A;  5DFC A;  5EYA F;  3IU6 A;  3UVY A;  5E9I A;  3M62 A;  3GV4 A;  4O64 A;  2WP2 A;  5F36 A;  4UYF A;  2H0D A;  3L1Z B;  4NQN A;  2YUC A;  4FIP A;  4QSW A;  4NYW A;  3HTK C;  2VPD A;  2LXH C;  2ECI A;  2QIZ A;  4HXS A;  5FFV A;  4R2Y A;  5ACY A;  2ECT A;  3O34 A;  5FG5 A;  1FBV A;  5I7X A;  3S92 A;  4YYD A;  2QJ0 A;  5A5S A;  5A85 A;  4HXR A;  5F1H A;  5L97 A;  2EGP A;  2L80 A;  2KU3 A;  4E96 A;  3SVF A;  3LXJ A;  4QF2 A;  2RNX A;  5I89 A;  5D3R A;  2L75 A;  4LZS A;  2G4A A;  3FKM X;  3Q2F A;  5ETB A;  2MNY A;  2R10 A;  4XUA A;  5I80 A;  4A0C D;  4NR9 A;  5DFB A;  3UVX A;  2MUM A;  4A9F A;  2KWN A;  5KH3 A;  4UIT A;  2CSY A;  5EP7 A;  2YSM A;  5EPR A;  5EK9 A;  4A9E A;  3PUQ A;  5C13 A;  2MD8 C;  4LC2 A;  5E73 A;  4BJX A;  4LKA A;  4PY6 A;  5EVA A;  2RSD A;  3EB6 A;  4QBM A;  5ENF A;  2VJE B;  4KV1 A;  5TDW A;  5FER A;  4CL9 A;  4MR3 A;  3U5K A;  5A5Q A;  1WEU A;  3RPG C;  5ENJ A;  5CY9 A;  3DWY A;  4HBY A;  1WUG A;  2RS9 B;  5HQ7 A;  5D1L B;  4O74 A;  5IGK A;  3IHP A;  5CPE A;  4Q0N A;  4QUU A;  2MD7 B;  2YYN A;  5FE5 A;  3MQM A;  5EWD A;  4TS8 A;  5ENE A;  4WA6 A;  1DVP A;  4W4U A;  4O7E A;  4CCG X;  4LYS A;  5E7D A;  5COI A;  1LDK C;  5DLX A;  4YY6 A;  4YYI A;  1BOR A;  3O36 A;  5EQ1 A;  2YEL A;  2YQL A;  3MXF A;  2HYE D;  2YRE A;  4NR6 A;  1F68 A;  2EOD A;  3UV2 A;  4WHU A;  5HRW A;  4QC1 A;  4J0R A;  3LQJ A;  4X2I A;  4QEU A;  5ENC A;  3U5L A;  4TZ8 A;  1WIL A;  5D3N A;  3O7A A;  5JG6 A;  3UW9 A;  4CLB A;  4XY9 A;  2MA5 A;  2FSA A;  4ALH A;  2VJF A;  1WEP A;  4IOQ A;  2LDR A;  3U5N A;  3RPG B;  2E7N A;  2L85 A;  4LAD B;  4TKP B;  2R0Y A;  4TTE A;  2KGI A;  2DAT A;  5FE9 A;  4HBX A;  5F2P A;  5F63 A;  3T6R A;  1U6G B;  3U5J A;  2VPE A;  2RNW A;  2L5U A;  4HXN A;  3ZVZ B;  1WES A;  5CFW A;  5E3D A;  4GPJ A;  1X4U A;  4C66 A;  2NAA A;  4S3O C;  1F62 A;  5CQ7 A;  2YUR A;  5AME A;  5LCW B;  4N4G A;  2YHO A;  4YYG A;  4ZC9 A;  3HMH A;  3MUL A;  2M85 A;  3I3J A;  3U5O A;  4HXM A;  4R8P K;  5F3A A;  3C5K A;  5D25 A;  5AD2 A;  4A9I A;  4UI9 B;  4IR4 A;  4YAB A;  4N4I A;  4LZ2 A;  1CHC A;  3JVJ A;  5LKT A;  3MHS A;  5DW2 A;  2BAY A;  5H1V A;  5CQ5 A;  4TT2 A;  4QR4 A;  2VNF A;  2Y43 A;  3SOW A;  4LYI A;  4N3W A;  4CUP A;  3JVK A;  5D7X A;  5FFY A;  1WEW A;  2YT5 A;  4AKN A;  4CFL A;  1Z2Q A;  4KCX A;  5II1 A;  2CKL B;  5J3X A;  4WHW A;  2ECN A;  4LDF A;  2DX8 A;  4GB0 A;  2LGV A;  5LJ0 A;  4IOO A;  3P1F A;  4UIW A;  4V3K C;  3HMF A;  4L58 A;  4CA1 A;  2KE1 A;  5EV9 A;  4O72 A;  1FP0 A;  5C89 A;  2YQD A;  4CUR A;  5HFQ A;  4S3O B;  1N87 A;  5CQT A;  4AVX A;  4UYF B;  2H0D B;  4QZS A;  4PTB A;  4CFK A;  5IID A;  2K4D A;  4A4C A;  2M6M A;  4FO9 A;  4HBW A;  5FE1 A;  5A83 A;  2R0S A;  4YYM A;  4N4F A;  3Q2E A;  4MEP A;  3DAI A;  2Y1M A;  4B7Y C;  4GNE A;  4QSX A;  3O37 A;  5I88 A;  5FB0 A;  4DON A;  1G25 A;  5A81 A;  5EI4 A;  1WEM A;  5FFW A;  1JSP B;  2LGG A;  5C4Q A;  4I7B A;  4YAD A;  5B75 A;  4MR4 A;  5E9K A;  5HEN A;  4FK5 A;  5C11 A;  3P1E A;  2E7O A;  4NR4 A;  2E6S A;  2DKW A;  4YH4 A;  2D8S A;  5HRX A;  3QZT A;  2XEU A;  5DY7 A;  1WUM A;  1WGM A;  2RI7 A;  3MHH A;  5G4S A;  1WEN A;  3N9L A;  2NXB A;  3N9M A;  4UP0 A;  2VP7 A;  4UP5 A;  5A5O A;  2I7K A;  5FE7 A;  5FDZ A;  4UYE A;  3GG3 A;  2ECJ A;  2DVV A;  3HME A;  4HXK A;  3FL2 A;  3N9Q A;  3QZS A;  3SVG A;  4LR6 A;  4QYD A;  5FE8 A;  5D26 A;  2DVR A;  5FE4 A;  4FLP A;  4YYN A;  5C8G A;  3VK6 A;  4BW2 A;  4F52 B;  3UV4 A;  5E9Y A;  2I8N A;  5IGL A;  5KO4 A;  4KV4 A;  5ENH A;  4O7B A;  5AIU A;  5FEY A;  2MJV B;  4UIU A;  4UYG A;  5H85 A;  4O77 A;  4NRC A;  2LQ6 A;  4ZDT A;  5DKH A;  5LVR A;  2KGG A;  5DBM A;  3ASL A;  2I50 A;  4IC3 A;  1ZS5 A;  4GNG A;  4O78 A;  3P1D A;  1X4J A;  4NR7 A;  4PS5 A;  4YY4 A;  5LKU A;  3S91 A;  2MT5 A;  2VJF B;  3ZPV 1;  5A7C A;  4O7C A;  4J1P A;  5HLS A;  4MEO A;  3C6W A;  4O7A A;  1Z6U A;  4Z6I A;  3DPL R;  4P5O B;  5DFD A;  4NR5 A;  4CUU A;  5BT3 A;  1WE9 A;  3UVD A;  5IG6 A;  4CUS A;  2H60 A;  2GRC A;  3KV6 A;  4AYC A;  3ZYQ A;  5D3L A;  4IR5 A;  4Q0O A;  5KH9 A;  4UIY A;  3MB4 A;  1EQF A;  4OGJ A;  1E6I A;  4QST A;  2KIZ A;  4BBQ A;  2LXP C;  4YK0 A;  5F61 A;  4UYD A;  4A9L A;  2KWJ A;  4NRB A;  5TCM A;  5FH8 A;  5L99 A;  5D3J A;  3I2D A;  5HCL A;  2G45 A;  4ZUX U;  5J0D A;  4IC2 A;  1ZBD B;  2JMI A;  5DLZ A;  3MB3 A;  2WP1 A;  5EPB A;  4A9K A;  3U5P A;  5I7Y A;  5LKX A;  5CUB A;  2YSJ A;  5D1K B;  4MEQ A;  2OO1 A;  1JM7 A;  5FE3 A;  3AAD A;  3L1X A;  5C87 A;  4FJC A;  4C67 A;  5C7N A;  3SHB A;  2FUI A;  4GND A;  5F1L A;  4L7X A;  4WIV A;  5I40 A;  2M3H A;  4QY4 A;  3AQA A;  4ZW1 A;  5CQ3 A;  4QSQ A;  3JVL A;  2KFT A;  4WZ0 A;  2HDP A;  4O70 A;  5HFR A;  5HEM A;  2KWO A; 
#chains in the Genus database with same CATH topology
 4Z93 A;  2OXQ C;  2CSZ A;  4H9D A;  4NUD A;  5CRM A;  5KTU A;  4OGC A;  5ENG A;  2K16 A;  3M63 A;  1RMD A;  4MEN A;  3K2J A;  4NXJ A;  2PNX A;  2PUY A;  3LVR E;  2LSP B;  5DX4 A;  3QZV A;  5IGN A;  4BW3 A;  4TU6 A;  4CUQ A;  5LUU A;  3NXB A;  4NR8 A;  5E0R A;  4QSV A;  1X4I A;  5DYA A;  2L84 A;  2L0B A;  2CRW A;  5DW1 A;  3P5O A;  2L43 A;  3VKH A;  5LKZ A;  4YYH A;  1DCQ A;  2YDW A;  2C2L A;  3FAN A;  3FEH A;  1Z60 A;  2UZG A;  5D1M B;  5DYU A;  3T9K A;  4YH3 A;  5CUE A;  1N72 A;  5HRV A;  1LDJ B;  4X3G A;  3ZVY A;  4Y03 A;  4HXP A;  5EWV A;  5F62 A;  4O71 A;  5DYC A;  5A5R A;  3SOX A;  4Z1S A;  4NS5 A;  3V43 A;  2LGK A;  5G4R A;  5L98 A;  3LJW A;  4XY8 A;  2LGL A;  4J3I A;  4OGI A;  4YAX A;  5EGU A;  5LJ2 A;  3G0L A;  4O76 A;  1JM4 B;  1WEV A;  3RTR B;  4QSR A;  1PUO A;  5E9L A;  3O70 A;  3ONI A;  5CUG A;  4YBM A;  5D3P A;  5EU1 A;  4YAT A;  2F6J A;  4PCE A;  4ZQL A;  4NUC A;  4LLB A;  4F3I A;  2VPB A;  5FE0 A;  5FE2 A;  5F60 A;  4R7E A;  5CRZ A;  2L5E A;  3O33 A;  1WFK A;  4O7F A;  4TU4 A;  5E9V A;  4Z6H A;  5KU3 A;  5E3G A;  2C2V S;  5A5P A;  5I83 A;  2KRE A;  3ZTG A;  5KH7 A;  5ENB A;  5FE6 A;  5B76 A;  2D82 A;  3JVM A;  4PCI A;  5EPS A;  4MR6 A;  4RVR A;  4PPE A;  2M1R A;  3O35 A;  5G0F A;  1XWH A;  4CUT A;  4PKL A;  5JWM A;  5LJ1 A;  5EM3 A;  4QSP A;  3N9O A;  2KR4 A;  5I86 A;  5B8D A;  5IGM A;  4A9M A;  1X0J A;  4MVT A;  3E2D A;  5G04 B;  2F6N A;  4QYL A;  3H7H A;  3LRQ A;  5CTL A;  2CSV A;  5TDR A;  1VYX A;  2DWW A;  2DVQ A;  3KQI A;  3P1C A;  5FB1 A;  4Q6F A;  5DIN A;  2LV9 A;  5HQ6 A;  1IYM A;  2LN0 A;  2OUO A;  4LRG A;  4N4H A;  4TT4 A;  4YBT A;  5BT4 A;  5D0C A;  5A82 A;  2QIC A;  4QEW A;  5F5Z A;  5B79 A;  4QF3 A;  5SVX A;  3D7C A;  2JMJ A;  5EWC A;  3M7K A;  4OUF A;  2G6Q A;  1MM2 A;  4QB3 A;  4YC9 A;  5B77 A;  5L8T A;  2YQM A;  1JOC A;  4QC3 A;  3PUR A;  3ZYU A;  4GNF A;  5H1T A;  5TAB A;  4UIX A;  5CUC A;  4WZ2 A;  5G05 B;  4NYX A;  1WEQ A;  5L96 A;  3N9N A;  2E3K A;  3IU5 A;  1HYI A;  2LAU A;  4AKH A;  4YBS A;  1VFY A;  2ZET C;  4AYC B;  5E74 A;  3VKG A;  2F42 A;  2MIQ A;  5CQA A;  2CON A;  5HM0 A;  4J0S A;  4TZ2 A;  5EWW A;  1VD4 A;  5IBN A;  4A9O A;  2VPG A;  2JMD A;  4A49 A;  5CU8 A;  4QSU A;  2VJE A;  3LQH A;  4XYA A;  5C85 A;  2YU4 A;  2R0V A;  5D3H A;  2KYU A;  4V3L C;  5FBX A;  4A9H A;  5FG6 A;  5CGP A;  2E6R A;  2YHN A;  5DYX A;  3G0J A;  5FH7 A;  5I1Q A;  5D3S A;  2Y1N A;  5B78 A;  5DKA A;  4NN2 A;  2YEM A;  4LZR A;  1JM7 B;  3DQV R;  5CQ6 A;  4YYJ A;  5EWH A;  1WEE A;  2ECW A;  4UIZ A;  5JI8 A;  3M99 A;  4XUB A;  2ECV A;  1E4U A;  2D9E A;  2KTB B;  2KKY A;  5EA1 A;  2EA6 A;  5CZG A;  2LRI C;  5I29 A;  1MBM A;  4YYK A;  1T1H A;  2XOY A;  5AMF A;  5L8U A;  2KWK A;  3GL6 A;  4ALG A;  4AP4 A;  5I3L A;  5KHM A;  4UIV A;  2N9G A;  2DVS A;  2JRJ A;  3HCS A;  2RO1 A;  3UVW A;  1WIM A;  4HXL A;  5II2 A;  4HXO A;  3RCW A;  5DKD A;  2MNZ A;  3EB5 A;  4XI1 A;  4Z1Q A;  4BW4 A;  3SOU A;  5D3T A;  2YYR A;  4C9Z A;  2G43 A;  2K17 A;  2K1J A;  3N9P A;  4LJN A;  3TLP A;  3LJU X;  5CQ4 A;  4IOR A;  4LYW A;  4IR6 A;  3ZNI A;  1WEO A;  5EIC A;  2AN6 A;  3PHD A;  4HBV A;  4IR3 A;  5TB6 A;  4A9J A;  2YEK A;  5EIS A;  5ETD A;  2IDA A;  3FAO A;  5TBN A;  4B86 C;  5FH6 A;  4TQN A;  2YW8 A;  5CUA A;  2FUU A;  3NG2 A;  4TYL A;  5CUD A;  4AUQ B;  4LK9 A;  5TRB A;  1ZKR A;  3MUK A;  4I7D A;  4TT6 A;  1HYJ A;  4QR3 A;  4QR5 A;  5CS8 A;  4BW1 A;  4QSS A;  2OSS A;  5ENI A;  5F25 A;  5HJC A;  5HQ5 A;  1K2F A;  3KV5 A;  5SVY A;  3UV5 A;  4NUE A;  2YW5 A;  5FG4 A;  4QNS A;  3LQI A;  4NRA A;  2EXU A;  4A4B A;  2RNY A;  4O75 A;  2XB1 A;  5CQ8 A;  5E9M A;  5HEL A;  1V87 A;  3ZPV E;  2ECG A;  4UYH A;  4I7C A;  5H9M A;  2RFJ A;  2CT2 A;  3L11 A;  5CP5 A;  5KTW A;  3DDT A;  4QEV A;  5LVQ A;  3FM8 C;  4WZ3 B;  3KNV A;  3T7L A;  4MSX A;  5DKC A;  5AD3 A;  3U5M A;  2B0O E;  2CKL A;  4NQM A;  4A9N A;  5BT5 A;  3HCT A;  4NYV A;  5AIT A;  5H1U A;  4QUT A;  2MA6 A;  5A5N A;  4MR5 A;  4BHW A;  3SVH A;  5D24 A;  5K29 A;  1MM3 A;  3HCU A;  5KTX A;  5DFC A;  5EYA F;  2D8U A;  3IU6 A;  3UVY A;  5E9I A;  3M62 A;  3GV4 A;  4O64 A;  2WP2 A;  5F36 A;  4UYF A;  2H0D A;  3L1Z B;  4NQN A;  2YUC A;  3LVQ E;  4FIP A;  4QSW A;  4NYW A;  3HTK C;  2VPD A;  2XOZ A;  2LXH C;  2ECI A;  2QIZ A;  4HXS A;  5FFV A;  4R2Y A;  2L7P A;  5ACY A;  2ECT A;  3O34 A;  5FG5 A;  1FBV A;  5I7X A;  3S92 A;  4YYD A;  2QJ0 A;  5A5S A;  5A85 A;  4HXR A;  5F1H A;  5L97 A;  2EGP A;  2L80 A;  3DWD A;  2KU3 A;  4E96 A;  3SVF A;  3LXJ A;  4QF2 A;  2RNX A;  5I89 A;  5D3R A;  3D1D A;  2L75 A;  4LZS A;  2G4A A;  3FKM X;  3Q2F A;  5ETB A;  2MNY A;  2R10 A;  4XUA A;  5I80 A;  4A0C D;  4NR9 A;  5DFB A;  3UVX A;  2MUM A;  4A9F A;  2KWN A;  5KH3 A;  4UIT A;  2CSY A;  5EP7 A;  2YSM A;  5EPR A;  5EK9 A;  4A9E A;  3PUQ A;  5C13 A;  2MD8 C;  4LC2 A;  5E73 A;  4BJX A;  4LKA A;  4PY6 A;  5EVA A;  2RSD A;  3EB6 A;  4QBM A;  5ENF A;  2VJE B;  4KV1 A;  2XOC A;  5TDW A;  4CL9 A;  5FER A;  4MR3 A;  3LDY A;  3U5K A;  5A5Q A;  1WEU A;  3RPG C;  5ENJ A;  5CY9 A;  3DWY A;  4HBY A;  1WUG A;  2RS9 B;  5HQ7 A;  5D1L B;  4O74 A;  4AI6 A;  5IGK A;  3IHP A;  5CPE A;  3PLW A;  4Q0N A;  4QUU A;  2MD7 B;  2YYN A;  5FE5 A;  3MQM A;  5EWD A;  4TS8 A;  5ENE A;  4WA6 A;  1DVP A;  4W4U A;  4O7E A;  4CCG X;  4LYS A;  5E7D A;  5COI A;  1LDK C;  5DLX A;  2DSM A;  4YY6 A;  4YYI A;  1BOR A;  3MDB C;  3O36 A;  5EQ1 A;  2YEL A;  2YQL A;  3MXF A;  2HYE D;  2YRE A;  4NR6 A;  1F68 A;  2EOD A;  3UV2 A;  4WHU A;  5HRW A;  4QC1 A;  4J0R A;  3LQJ A;  4X2I A;  4QEU A;  5ENC A;  3U5L A;  4TZ8 A;  1WIL A;  5D3N A;  3O7A A;  5JG6 A;  3UW9 A;  4CLB A;  4XY9 A;  2MA5 A;  2FSA A;  4ALH A;  2VJF A;  1WEP A;  4IOQ A;  2LDR A;  3U5N A;  3RPG B;  2E7N A;  2L85 A;  4LAD B;  4TKP B;  2R0Y A;  4TTE A;  2KGI A;  2DAT A;  5FE9 A;  4HBX A;  3JUE A;  5F2P A;  5F63 A;  2EGM A;  1U6G B;  3T6R A;  3U5J A;  2VPE A;  2RNW A;  2L5U A;  4HXN A;  3ZVZ B;  1WES A;  5CFW A;  5E3D A;  4GPJ A;  1X4U A;  4C66 A;  2NAA A;  4S3O C;  1F62 A;  5CQ7 A;  2YUR A;  5AME A;  5LCW B;  4N4G A;  2YHO A;  4YYG A;  3SUB A;  4ZC9 A;  3HMH A;  3MUL A;  2M85 A;  3I3J A;  3U5O A;  4HXM A;  4R8P K;  5F3A A;  3C5K A;  2FD4 A;  5D25 A;  5AD2 A;  2JM3 A;  4A9I A;  2YVR A;  4UI9 B;  4IR4 A;  4YAB A;  4N4I A;  4LZ2 A;  1CHC A;  3JVJ A;  5LKT A;  3MHS A;  5DW2 A;  2BAY A;  4AKI A;  5H1V A;  5CQ5 A;  5SVI B;  4TT2 A;  4QR4 A;  2VNF A;  2Y43 A;  3SOW A;  3D1B A;  4OGE A;  4LYI A;  4N3W A;  4CUP A;  3JVK A;  5D7X A;  5FFY A;  1WEW A;  2YT5 A;  4AKN A;  4CFL A;  1Z2Q A;  5K3Q A;  4KCX A;  5II1 A;  2CKL B;  4Z0O A;  5J3X A;  4F1P A;  4WHW A;  2ECN A;  4LDF A;  5SVI A;  2DX8 A;  4QQ4 A;  4GB0 A;  2LGV A;  5LJ0 A;  4IOO A;  3P1F A;  4UIW A;  4V3K C;  3HMF A;  4L58 A;  2FFW A;  4CA1 A;  2KE1 A;  5EV9 A;  4O72 A;  3KDE C;  1FP0 A;  5C89 A;  2YQD A;  4CUR A;  5HFQ A;  4S3O B;  1N87 A;  5CQT A;  2XP0 A;  4AVX A;  4UYF B;  2H0D B;  4QZS A;  4PTB A;  4CFK A;  5IID A;  2K4D A;  4A4C A;  2M6M A;  4FO9 A;  4HBW A;  5FE1 A;  5A83 A;  2R0S A;  3O47 A;  4YYM A;  4N4F A;  2JUN A;  3Q2E A;  4MEP A;  3DAI A;  2Y1M A;  4B7Y C;  4GNE A;  4QSX A;  3ERR A;  3O37 A;  5I88 A;  5FB0 A;  4DON A;  1G25 A;  4AKG A;  5A81 A;  5EI4 A;  1WEM A;  5FFW A;  1JSP B;  2LGG A;  5C4Q A;  4I7B A;  4YAD A;  5B75 A;  4MR4 A;  5E9K A;  5HEN A;  4FK5 A;  2IQJ A;  5C11 A;  3P1E A;  2E7O A;  4NR4 A;  2E6S A;  2DKW A;  4YH4 A;  2D8S A;  5HRX A;  3QZT A;  2XEU A;  5DY7 A;  1WUM A;  1WGM A;  2RI7 A;  3MHH A;  5G4S A;  1WEN A;  3N9L A;  2NXB A;  2CRR A;  3N9M A;  4UP0 A;  2VP7 A;  4UP5 A;  5A5O A;  2I7K A;  5FE7 A;  5FDZ A;  4UYE A;  3GG3 A;  2ECJ A;  2DVV A;  3HME A;  4HXK A;  3FL2 A;  3N9Q A;  3QZS A;  3SVG A;  4LR6 A;  4QYD A;  5FE8 A;  4O62 A;  5D26 A;  2DVR A;  5FE4 A;  4FLP A;  4YYN A;  5C8G A;  2RR4 A;  4BW2 A;  3VK6 A;  4F52 B;  3UV4 A;  5E9Y A;  2I8N A;  5IGL A;  5KO4 A;  4KV4 A;  5ENH A;  4O7B A;  5AIU A;  5FEY A;  2MJV B;  4UIU A;  4UYG A;  5H85 A;  4O77 A;  4NRC A;  2LQ6 A;  4ZDT A;  5DKH A;  5LVR A;  2KGG A;  5DBM A;  3FJU B;  3ASL A;  2I50 A;  4IC3 A;  1ZS5 A;  4GNG A;  4O78 A;  3P1D A;  1X4J A;  4NR7 A;  2OWA A;  4PS5 A;  4YY4 A;  5LKU A;  3S91 A;  2MT5 A;  2VJF B;  3ZPV 1;  5A7C A;  4O7C A;  4J1P A;  5HLS A;  4MEO A;  3C6W A;  4O7A A;  1Z6U A;  4Z6I A;  3DPL R;  4P5O B;  5DFD A;  2DJA A;  4NR5 A;  4CUU A;  5BT3 A;  1WE9 A;  3UVD A;  5IG6 A;  4CUS A;  2H60 A;  2GRC A;  2EJN A;  3KV6 A;  4AYC A;  3ZYQ A;  5D3L A;  4IR5 A;  4Q0O A;  5KH9 A;  4UIY A;  3MB4 A;  1EQF A;  4OGJ A;  1E6I A;  4QST A;  2KIZ A;  4BBQ A;  2LXP C;  4YK0 A;  5F61 A;  4UYD A;  4A9L A;  2KWJ A;  4NRB A;  5TCM A;  5FH8 A;  5L99 A;  5D3J A;  3I2D A;  5HCL A;  2G45 A;  4ZUX U;  5J0D A;  4IC2 A;  1ZBD B;  2JMI A;  4Z0R A;  5DLZ A;  3MB3 A;  2KKX A;  2WP1 A;  5EPB A;  4A9K A;  3U5P A;  5I7Y A;  5LKX A;  5CUB A;  2YSJ A;  5D1K B;  4MEQ A;  2OO1 A;  1JM7 A;  5FE3 A;  3AAD A;  3L1X A;  5C87 A;  2P57 A;  4FJC A;  4C67 A;  5C7N A;  3SHB A;  2FUI A;  4GND A;  2M13 A;  2E61 A;  5F1L A;  4L7X A;  3Q1D A;  4WIV A;  5I40 A;  2M3H A;  4QY4 A;  3AQA A;  4ZW1 A;  5CQ3 A;  4QSQ A;  3JVL A;  2KFT A;  2MKE A;  4WZ0 A;  2HDP A;  4O70 A;  5HFR A;  5HEM A;  2KWO A; 
#chains in the Genus database with same CATH homology
 4Z93 A;  2OXQ C;  2CSZ A;  4NUD A;  5CRM A;  5KTU A;  5ENG A;  2K16 A;  3M63 A;  1RMD A;  4MEN A;  3K2J A;  4NXJ A;  2PNX A;  2PUY A;  2LSP B;  5DX4 A;  3QZV A;  5IGN A;  4BW3 A;  4TU6 A;  4CUQ A;  5LUU A;  3NXB A;  4NR8 A;  5E0R A;  4QSV A;  1X4I A;  5DYA A;  2L84 A;  2L0B A;  5DW1 A;  3P5O A;  2L43 A;  5LKZ A;  4YYH A;  2C2L A;  2YDW A;  1Z60 A;  2UZG A;  5D1M B;  5DYU A;  4YH3 A;  5CUE A;  1N72 A;  5HRV A;  1LDJ B;  4X3G A;  3ZVY A;  4Y03 A;  4HXP A;  5EWV A;  5F62 A;  4O71 A;  5DYC A;  5A5R A;  3SOX A;  4Z1S A;  4NS5 A;  3V43 A;  2LGK A;  5G4R A;  5L98 A;  3LJW A;  4XY8 A;  2LGL A;  4J3I A;  4OGI A;  4YAX A;  5EGU A;  5LJ2 A;  3G0L A;  4O76 A;  1JM4 B;  1WEV A;  3RTR B;  4QSR A;  5E9L A;  3O70 A;  3ONI A;  5CUG A;  4YBM A;  5D3P A;  5EU1 A;  4YAT A;  2F6J A;  4PCE A;  4ZQL A;  4NUC A;  4LLB A;  4F3I A;  2VPB A;  5FE0 A;  5FE2 A;  5F60 A;  4R7E A;  5CRZ A;  2L5E A;  3O33 A;  1WFK A;  4O7F A;  4TU4 A;  5E9V A;  4Z6H A;  5KU3 A;  5E3G A;  2C2V S;  5A5P A;  5I83 A;  2KRE A;  3ZTG A;  5KH7 A;  5ENB A;  5FE6 A;  5B76 A;  2D82 A;  3JVM A;  4PCI A;  5EPS A;  4MR6 A;  4RVR A;  4PPE A;  2M1R A;  3O35 A;  5G0F A;  1XWH A;  4CUT A;  4PKL A;  5JWM A;  5LJ1 A;  5EM3 A;  4QSP A;  3N9O A;  2KR4 A;  5I86 A;  5B8D A;  5IGM A;  4A9M A;  1X0J A;  4MVT A;  5G04 B;  2F6N A;  4QYL A;  3LRQ A;  5CTL A;  5TDR A;  1VYX A;  2DWW A;  2DVQ A;  3KQI A;  3P1C A;  5FB1 A;  4Q6F A;  5DIN A;  2LV9 A;  5HQ6 A;  1IYM A;  2LN0 A;  2OUO A;  4LRG A;  4N4H A;  4TT4 A;  4YBT A;  5BT4 A;  5D0C A;  5A82 A;  2QIC A;  4QEW A;  5F5Z A;  5B79 A;  4QF3 A;  3D7C A;  2JMJ A;  5EWC A;  4OUF A;  2G6Q A;  1MM2 A;  4QB3 A;  4YC9 A;  5B77 A;  5L8T A;  2YQM A;  1JOC A;  4QC3 A;  3PUR A;  3ZYU A;  4GNF A;  5H1T A;  5TAB A;  4UIX A;  5CUC A;  4WZ2 A;  5G05 B;  4NYX A;  1WEQ A;  5L96 A;  3N9N A;  2E3K A;  3IU5 A;  1HYI A;  4YBS A;  1VFY A;  2ZET C;  4AYC B;  5E74 A;  2F42 A;  2MIQ A;  5CQA A;  5HM0 A;  4J0S A;  4TZ2 A;  5EWW A;  1VD4 A;  5IBN A;  4A9O A;  2VPG A;  2JMD A;  4A49 A;  5CU8 A;  4QSU A;  2VJE A;  3LQH A;  4XYA A;  5C85 A;  2YU4 A;  2R0V A;  5D3H A;  2KYU A;  4V3L C;  5FBX A;  4A9H A;  5FG6 A;  5CGP A;  2E6R A;  2YHN A;  5DYX A;  3G0J A;  5FH7 A;  5I1Q A;  5D3S A;  2Y1N A;  5B78 A;  5DKA A;  4NN2 A;  2YEM A;  4LZR A;  1JM7 B;  3DQV R;  5CQ6 A;  4YYJ A;  5EWH A;  1WEE A;  2ECW A;  4UIZ A;  5JI8 A;  3M99 A;  4XUB A;  2ECV A;  1E4U A;  2D9E A;  2KTB B;  5EA1 A;  2EA6 A;  5CZG A;  2LRI C;  5I29 A;  1T1H A;  4YYK A;  5AMF A;  5L8U A;  2KWK A;  3GL6 A;  4ALG A;  4AP4 A;  5I3L A;  5KHM A;  4UIV A;  2N9G A;  2DVS A;  2JRJ A;  3HCS A;  2RO1 A;  3UVW A;  1WIM A;  4HXL A;  5II2 A;  4HXO A;  3RCW A;  5DKD A;  2MNZ A;  3EB5 A;  4XI1 A;  4Z1Q A;  4BW4 A;  3SOU A;  5D3T A;  2YYR A;  4C9Z A;  2G43 A;  2K17 A;  2K1J A;  3N9P A;  4LJN A;  3TLP A;  5CQ4 A;  4IOR A;  4LYW A;  4IR6 A;  3ZNI A;  1WEO A;  5EIC A;  2AN6 A;  3PHD A;  4HBV A;  4IR3 A;  5TB6 A;  4A9J A;  2YEK A;  5EIS A;  5ETD A;  2IDA A;  5TBN A;  4B86 C;  5FH6 A;  4TQN A;  2YW8 A;  5CUA A;  2FUU A;  3NG2 A;  4TYL A;  5CUD A;  4AUQ B;  4LK9 A;  5TRB A;  3MUK A;  4I7D A;  1HYJ A;  4TT6 A;  4QR3 A;  4QR5 A;  5CS8 A;  4BW1 A;  4QSS A;  2OSS A;  5ENI A;  5F25 A;  5HJC A;  5HQ5 A;  1K2F A;  3KV5 A;  3UV5 A;  4NUE A;  2YW5 A;  5FG4 A;  4QNS A;  3LQI A;  4NRA A;  4A4B A;  2RNY A;  4O75 A;  2XB1 A;  5CQ8 A;  5E9M A;  5HEL A;  1V87 A;  3ZPV E;  2ECG A;  4UYH A;  4I7C A;  5H9M A;  2RFJ A;  2CT2 A;  3L11 A;  5CP5 A;  5KTW A;  4WZ3 B;  4QEV A;  5LVQ A;  3T7L A;  3KNV A;  4MSX A;  5DKC A;  5AD3 A;  3U5M A;  2CKL A;  4NQM A;  4A9N A;  5BT5 A;  3HCT A;  4NYV A;  5AIT A;  5H1U A;  4QUT A;  2MA6 A;  5A5N A;  4MR5 A;  4BHW A;  3SVH A;  5D24 A;  5K29 A;  1MM3 A;  3HCU A;  5KTX A;  5DFC A;  5EYA F;  3IU6 A;  3UVY A;  5E9I A;  3M62 A;  3GV4 A;  4O64 A;  2WP2 A;  5F36 A;  4UYF A;  2H0D A;  3L1Z B;  4NQN A;  2YUC A;  4FIP A;  4QSW A;  4NYW A;  3HTK C;  2VPD A;  2LXH C;  2ECI A;  2QIZ A;  4HXS A;  5FFV A;  4R2Y A;  5ACY A;  2ECT A;  3O34 A;  5FG5 A;  1FBV A;  5I7X A;  3S92 A;  4YYD A;  2QJ0 A;  5A5S A;  5A85 A;  4HXR A;  5F1H A;  5L97 A;  2EGP A;  2L80 A;  2KU3 A;  4E96 A;  3SVF A;  3LXJ A;  4QF2 A;  2RNX A;  5I89 A;  5D3R A;  2L75 A;  4LZS A;  2G4A A;  3FKM X;  3Q2F A;  5ETB A;  2MNY A;  2R10 A;  4XUA A;  5I80 A;  4A0C D;  4NR9 A;  5DFB A;  3UVX A;  2MUM A;  4A9F A;  2KWN A;  5KH3 A;  4UIT A;  2CSY A;  5EP7 A;  2YSM A;  5EPR A;  5EK9 A;  4A9E A;  3PUQ A;  5C13 A;  2MD8 C;  4LC2 A;  5E73 A;  4BJX A;  4LKA A;  4PY6 A;  5EVA A;  2RSD A;  3EB6 A;  4QBM A;  5ENF A;  2VJE B;  4KV1 A;  5TDW A;  5FER A;  4CL9 A;  4MR3 A;  3U5K A;  5A5Q A;  1WEU A;  3RPG C;  5ENJ A;  5CY9 A;  3DWY A;  4HBY A;  1WUG A;  2RS9 B;  5HQ7 A;  5D1L B;  4O74 A;  5IGK A;  3IHP A;  5CPE A;  4Q0N A;  4QUU A;  2MD7 B;  2YYN A;  5FE5 A;  3MQM A;  5EWD A;  4TS8 A;  5ENE A;  4WA6 A;  1DVP A;  4W4U A;  4O7E A;  4CCG X;  4LYS A;  5E7D A;  5COI A;  1LDK C;  5DLX A;  4YY6 A;  4YYI A;  1BOR A;  3O36 A;  5EQ1 A;  2YEL A;  2YQL A;  3MXF A;  2HYE D;  2YRE A;  4NR6 A;  1F68 A;  2EOD A;  3UV2 A;  4WHU A;  5HRW A;  4QC1 A;  4J0R A;  3LQJ A;  4X2I A;  4QEU A;  5ENC A;  3U5L A;  4TZ8 A;  1WIL A;  5D3N A;  3O7A A;  5JG6 A;  3UW9 A;  4CLB A;  4XY9 A;  2MA5 A;  2FSA A;  4ALH A;  2VJF A;  1WEP A;  4IOQ A;  2LDR A;  3U5N A;  3RPG B;  2E7N A;  2L85 A;  4LAD B;  4TKP B;  2R0Y A;  4TTE A;  2KGI A;  2DAT A;  5FE9 A;  4HBX A;  5F2P A;  5F63 A;  3T6R A;  1U6G B;  3U5J A;  2VPE A;  2RNW A;  2L5U A;  4HXN A;  3ZVZ B;  1WES A;  5CFW A;  5E3D A;  4GPJ A;  1X4U A;  4C66 A;  2NAA A;  4S3O C;  1F62 A;  5CQ7 A;  2YUR A;  5AME A;  5LCW B;  4N4G A;  2YHO A;  4YYG A;  4ZC9 A;  3HMH A;  3MUL A;  2M85 A;  3I3J A;  3U5O A;  4HXM A;  4R8P K;  5F3A A;  3C5K A;  5D25 A;  5AD2 A;  4A9I A;  4UI9 B;  4IR4 A;  4YAB A;  4N4I A;  4LZ2 A;  1CHC A;  3JVJ A;  5LKT A;  3MHS A;  5DW2 A;  2BAY A;  5H1V A;  5CQ5 A;  4TT2 A;  4QR4 A;  2VNF A;  2Y43 A;  3SOW A;  4LYI A;  4N3W A;  4CUP A;  3JVK A;  5D7X A;  5FFY A;  1WEW A;  2YT5 A;  4AKN A;  4CFL A;  1Z2Q A;  4KCX A;  5II1 A;  2CKL B;  5J3X A;  4WHW A;  2ECN A;  4LDF A;  2DX8 A;  4GB0 A;  2LGV A;  5LJ0 A;  4IOO A;  3P1F A;  4UIW A;  4V3K C;  3HMF A;  4L58 A;  4CA1 A;  2KE1 A;  5EV9 A;  4O72 A;  1FP0 A;  5C89 A;  2YQD A;  4CUR A;  5HFQ A;  4S3O B;  1N87 A;  5CQT A;  4AVX A;  4UYF B;  2H0D B;  4QZS A;  4PTB A;  4CFK A;  5IID A;  2K4D A;  4A4C A;  2M6M A;  4FO9 A;  4HBW A;  5FE1 A;  5A83 A;  2R0S A;  4YYM A;  4N4F A;  3Q2E A;  4MEP A;  3DAI A;  2Y1M A;  4B7Y C;  4GNE A;  4QSX A;  3O37 A;  5I88 A;  5FB0 A;  4DON A;  1G25 A;  5A81 A;  5EI4 A;  1WEM A;  5FFW A;  1JSP B;  2LGG A;  5C4Q A;  4I7B A;  4YAD A;  5B75 A;  4MR4 A;  5E9K A;  5HEN A;  4FK5 A;  5C11 A;  3P1E A;  2E7O A;  4NR4 A;  2E6S A;  2DKW A;  4YH4 A;  2D8S A;  5HRX A;  3QZT A;  2XEU A;  5DY7 A;  1WUM A;  1WGM A;  2RI7 A;  3MHH A;  5G4S A;  1WEN A;  3N9L A;  2NXB A;  3N9M A;  4UP0 A;  2VP7 A;  4UP5 A;  5A5O A;  2I7K A;  5FE7 A;  5FDZ A;  4UYE A;  3GG3 A;  2ECJ A;  2DVV A;  3HME A;  4HXK A;  3FL2 A;  3N9Q A;  3QZS A;  3SVG A;  4LR6 A;  4QYD A;  5FE8 A;  5D26 A;  2DVR A;  5FE4 A;  4FLP A;  4YYN A;  5C8G A;  3VK6 A;  4BW2 A;  4F52 B;  3UV4 A;  5E9Y A;  2I8N A;  5IGL A;  5KO4 A;  4KV4 A;  5ENH A;  4O7B A;  5AIU A;  5FEY A;  2MJV B;  4UIU A;  4UYG A;  5H85 A;  4O77 A;  4NRC A;  2LQ6 A;  4ZDT A;  5DKH A;  5LVR A;  2KGG A;  5DBM A;  3ASL A;  2I50 A;  4IC3 A;  1ZS5 A;  4GNG A;  4O78 A;  3P1D A;  1X4J A;  4NR7 A;  4PS5 A;  4YY4 A;  5LKU A;  3S91 A;  2MT5 A;  2VJF B;  3ZPV 1;  5A7C A;  4O7C A;  4J1P A;  5HLS A;  4MEO A;  3C6W A;  4O7A A;  1Z6U A;  4Z6I A;  3DPL R;  4P5O B;  5DFD A;  4NR5 A;  4CUU A;  5BT3 A;  1WE9 A;  3UVD A;  5IG6 A;  4CUS A;  2H60 A;  2GRC A;  3KV6 A;  4AYC A;  3ZYQ A;  5D3L A;  4IR5 A;  4Q0O A;  5KH9 A;  4UIY A;  3MB4 A;  1EQF A;  4OGJ A;  1E6I A;  4QST A;  2KIZ A;  4BBQ A;  2LXP C;  4YK0 A;  5F61 A;  4UYD A;  4A9L A;  2KWJ A;  4NRB A;  5TCM A;  5FH8 A;  5L99 A;  5D3J A;  3I2D A;  5HCL A;  2G45 A;  4ZUX U;  5J0D A;  4IC2 A;  1ZBD B;  2JMI A;  5DLZ A;  3MB3 A;  2WP1 A;  5EPB A;  4A9K A;  3U5P A;  5I7Y A;  5LKX A;  5CUB A;  2YSJ A;  5D1K B;  4MEQ A;  2OO1 A;  1JM7 A;  5FE3 A;  3AAD A;  3L1X A;  5C87 A;  4FJC A;  4C67 A;  5C7N A;  3SHB A;  2FUI A;  4GND A;  5F1L A;  4L7X A;  4WIV A;  5I40 A;  2M3H A;  4QY4 A;  3AQA A;  4ZW1 A;  5CQ3 A;  4QSQ A;  3JVL A;  2KFT A;  4WZ0 A;  2HDP A;  4O70 A;  5HFR A;  5HEM A;  2KWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...