3U5NA

Crystal structure of the complex of trim33 phd-bromo and h3(1-20)k9me3k14ac histone peptide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
205
structure length
185
Chain Sequence
DDPNEDWCAVCQNGGDLLCCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDAQGLSPVDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQKADSEVAQAGKAVALYFEDKLTEIYSDRTFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords E3 ubiquitin-protein ligase TRIM33
publication title A Poised Chromatin Platform for TGF-beta access to master regulators
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 185
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3u5nA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3u5nA01
5IGNA 5EI4A 5E3DA 4IR3A 4QR3A 2K16A 2YYNA 3HTKC 5ENFA 5I40A 1VFYA 4A9OA 2KWNA 4WZ2A 2NAAA 2YELA 5F5ZA 4UIWA 4WIVA 5EVAA 4Z1SA 5FG4A 4UYGA 5G05B 4ZQLA 3N9MA 5HRVA 5F1LA 3UV5A 3N9OA 4PPEA 5C13A 4CUPA 2L75A 3EB6A 4FLPA 4MEOA 4UYFB 5DY7A 5E9VA 1CHCA 2ECGA 5E3GA 4HXSA 5A5OA 3HCUA 4LADB 2KU3A 1WUGA 3SVFA 4FJCA 5FERA 4MR3A 4A4CA 2I8NA 4LC2A 5LVRA 5DLZA 5L8UA 1HYJA 5HRWA 5I89A 3P1CA 2I7KA 5F62A 5E9YA 5DW1A 5L97A 1WEPA 2WP1A 3MB3A 4NR9A 5D3JA 5CUCA 2N9GA 5COIA 2VNFA 4F3IA 2DATA 4PY6A 2VJEB 4HXRA 4A9IA 4CFLA 3T6RA 4LYSA 4J3IA 1Z6UA 3KNVA 5H1UA 2YEMA 2KTBB 2RO1A 4HXLA 5ENJA 2I50A 5C11A 2G43A 3P1DA 2YQLA 5D3PA 1X0JA 3MHHA 5CQ3A 3V43A 4YY6A 5E9IA 1V87A 5I7XA 1BORA 4Q0OA 2RSDA 2E7NA 5FE6A 2YDWA 4AYCA 4UIXA 4BHWA 4C9ZA 5LKZA 4IR5A 4ZC9A 4QZSA 4Q6FA 4A4BA 4B86C 4HBYA 3LRQA 1WEWA 2KREA 4PCEA 5HQ7A 2DKWA 2WP2A 4OUFA 4YYNA 2D8SA 4O7EA 2EODA 4MENA 3P1FA 2VPBA 5I80A 2KGIA 4X3GA 3RCWA 5FH8A 4QEVA 4QEUA 5KU3A 5AITA 4YYHA 4HXPA 4TTEA 3NXBA 3Q2FA 5EV9A 5II1A 4A9LA 2L80A 4YAXA 4GNDA 4MEPA 5A5PA 2E6RA 2ECTA 5A5NA 2QJ0A 5FFWA 5CU8A 5IG6A 5ACYA 5FH7A 5JWMA 5FFYA 4NYXA 1Z60A 5ENCA 2LRIC 4PTBA 5CRZA 4Z93A 3GG3A 4YYDA 5IGLA 1LDKC 5E73A 3KQIA 5FFVA 3N9LA 3DPLR 1F62A 4NXJA 3VK6A 2KIZA 3L11A 5C4QA 2LGLA 2YEKA 4BW3A 5D1KB 5HFQA 1HYIA 5CS8A 5E9KA 3LXJA 1JM4B 5F60A 2QICA 2YT5A 5D3LA 2YW8A 1MM2A 2MNZA 3SHBA 2YU4A 4AYCB 1JM7A 4LDFA 5CUGA 1WEQA 3O35A 4W4UA 5DINA 3G0LA 4NYVA 4O7AA 4N4FA 5EU1A 5G04B 4LJNA 4O78A 2Y43A 5EM3A 4CL9A 4S3OC 5KTUA 3JVKA 2YUCA 5HELA 3JVJA 3ZYUA 3SOUA 2ECJA 1WEUA 4ZDTA 4OGIA 5CQ5A 5CRMA 2HDPA 3M63A 4O76A 4QR5A 4NYWA 3O37A 3T7LA 3PHDA 5KTWA 4NR5A 3JVLA 2KWKA 1IYMA 2KWOA 5E9MA 2YYRA 3NG2A 4MSXA 2L5EA 5EWDA 5C89A 4UIVA 2ECVA 1N72A 3P1EA 3KV6A 4NR7A 4LRGA 4NQNA 4TT6A 4QNSA 3EB5A 2JMIA 5TCMA 5B75A 4UIZA 1EQFA 4DONA 5IGMA 3DQVR 5H1TA 2CKLB 4O72A 4QSRA 2C2VS 2D9EA 4HBWA 3G0JA 4L7XA 5A5SA 3RTRB 3SOWA 2LGVA 5CFWA 3O34A 4QSQA 2DVVA 2LQ6A 2YHOA 4XI1A 4O7CA 4I7DA 2DVRA 4O71A 2D82A 3AADA 4ALHA 4XY9A 5HM0A 5CY9A 1JSPB 2MD8C 2E6SA 3ZPV1 2H0DA 4LYIA 5FDZA 3UVDA 3U5PA 4WA6A 2ECWA 4UYHA 5B8DA 2YW5A 4TYLA 2LXHC 5D3NA 3ZTGA 2F6JA 2RNXA 2L0BA 2PNXA 4NS5A 1WEEA 5D24A 4QB3A 5FE2A 1ZS5A 3L1ZB 5D3RA 3SVGA 3U5KA 2KGGA 4GNFA 2MUMA 4Y03A 4N4HA 2YSJA 3FL2A 5CPEA 5B76A 5I29A 4QSVA 4NN2A 5BT3A 4O70A 5CP5A 4A0CD 5I86A 2BAYA 5AD2A 5DKAA 2CT2A 4O64A 5G4SA 5TABA 2VJFA 2ECNA 5A5QA 5F25A 3LQHA 2YSMA 4NR6A 3UV4A 1FBVA 5C87A 4HXNA 5J0DA 2CSZA 2HYED 2UZGA 3FKMX 2RFJA 2XEUA 4QUTA 4HXKA 3O70A 4BBQA 2FUUA 5EICA 2AN6A 4WZ0A 5D1LB 3QZVA 4LR6A 5A82A 3UW9A 3QZTA 4NRBA 5D25A 4QSWA 2LV9A 5C85A 4LK9A 2OUOA 2DVQA 2KFTA 4QYDA 4NRAA 5TB6A 5HEMA 4A9EA 3LQJA 4V3KC 3MQMA 5JI8A 1DVPA 3C5KA 5IIDA 3O7AA 3K2JA 4KV4A 4MR6A 5A85A 5H85A 2H0DB 4UITA 5CQ7A 5ENHA 3ONIA 3N9PA 2MNYA 2YHNA 4YBMA 2EGPA 2LN0A 2VPGA 3N9QA 2G4AA 5CQ6A 2YQMA 4IOQA 5B78A 4QC1A 4UYDA 4Q0NA 3PURA 4O75A 3UVWA 3ZNIA 4QUUA 5A83A 2E7OA 3HMEA 4LYWA 1X4IA 4CUQA 2E3KA 4CA1A 4A9NA 4IC2A 4UP0A 3U5LA 4QF3A 2VPEA 5H9MA 3MB4A 4YH4A 4E96A 2LDRA 5LJ1A 2EA6A 3MULA 4CUSA 5KTXA 1WENA 2M85A 4O74A 2M6MA 2KWJA 5FH6A 5B77A 5D1MB 1K2FA 3LJWA 2RNWA 5DFCA 3ZYQA 4LKAA 5LKUA 4B7YC 5KH7A 4PS5A 5KHMA 3DAIA 2H60A 3AQAA 4LZRA 4WHWA 1T1HA 4NQMA 4NUEA 5EISA 5EGUA 5HCLA 5EQ1A 3L1XA 5LJ2A 5I1QA 2DVSA 5A5RA 4TQNA 5LUUA 4IR6A 4C67A 4O7FA 5CGPA 4CFKA 5I88A 3RPGB 2ECIA 4BW4A 4ALGA 3GV4A 5D3SA 2L43A 4QR4A 2QIZA 5EWVA 5I83A 1F68A 4CLBA 2LXPC 4N3WA 5H1VA 5FE1A 1WGMA 3DWYA 5EWWA 3U5MA 4MR5A 3U5OA 5BT5A 4YH3A 5ETDA 4NUDA 3QZSA 4UYFA 3HMFA 5EPBA 5DYCA 5LJ0A 5FE5A 5ENIA 4HXMA 4YYKA 3MUKA 2YURA 3P5OA 5FE3A 5J3XA 4NUCA 4TKPB 5DBMA 2DWWA 4TU4A 2G45A 5DFDA 5TDRA 5I3LA 4F52B 1MM3A 4QSPA 1WEVA 5AIUA 3SOXA 4YADA 4C66A 5L98A 2Y1NA 2VJEA 4UI9B 4ZUXU 2MJVB 3D7CA 5E74A 5D0CA 2MT5A 5G0FA 1JM7B 5L96A 5LKTA 2VPDA 4GB0A 5IBNA 4IR4A 4UYEA 5EA1A 5L8TA 4MVTA 1N87A 5F1HA 5E7DA 5FB0A 5HENA 2K4DA 4CCGX 1E4UA 3ZVYA 5AD3A 4N4IA 4YYMA 2KYUA 5DKDA 2CSYA 3C6WA 4MEQA 4A9MA 3PUQA 5CUEA 5A81A 5ENGA 3GL6A 5CUAA 2KE1A 4J1PA 4NR8A 5CUDA 5DLXA 5BT4A 4QF2A 5FBXA 4HXOA 4PKLA 3S91A 1X4JA 4Z6HA 2VP7A 5LVQA 4YY4A 5FE7A 3IU6A 4CUUA 2R0VA 4A9FA 4AP4A 2JRJA 3M99A 5F3AA 5CQ4A 2PUYA 1VYXA 3ZPVE 4QBMA 2MA6A 4FIPA 4R2YA 5ENBA 4WZ3B 2YREA 4LZSA 5FE4A 4NR4A 4YC9A 5E0RA 4TU6A 5DKCA 4YBSA 1FP0A 5CUBA 5D7XA 5G4RA 3IHPA 5FE9A 4BW1A 2K1JA 4I7CA 4TT2A 3ZVZB 3UVXA 4Z1QA 4IORA 4A9JA 5CQAA 5AMFA 4YYIA 4CUTA 5HQ5A 3S92A 3M62A 4QSSA 5KO4A 4TZ2A 5DYAA 2RI7A 4HBVA 4QSTA 2FSAA 4BW2A 5K29A 1WUMA 4TT4A 4A9KA 2JMJA 5FEYA 2F42A 4HBXA 5KH3A 5IGKA 5C8GA 4O77A 1WIMA 2R0YA 4XYAA 5JG6A 5TBNA 2LGKA 4TS8A 5CZGA 2DX8A 3O36A 2F6NA 3LQIA 2GRCA 4XUAA 5AMEA 4BJXA 1RMDA 4X2IA 5D3HA 2Y1MA 5KH9A 2ZETC 5F61A 3HCSA 1G25A 5HFRA 5TDWA 3IU5A 5EPSA 5I7YA 2MIQA 1WEOA 1XWHA 5EP7A 4NRCA 4WHUA 5L99A 4UIUA 2OO1A 4TZ8A 5DKHA 5F36A 2JMDA 2VJFB 4LZ2A 2R10A 1WE9A 4FK5A 5EYAF 4A49A 5DYXA 1Z2QA 5FG5A 4YATA 1JOCA 4R8PK 2M3HA 5FE8A 4V3LC 3MXFA 4O7BA 3MHSA 4KV1A 4XUBA 4QEWA 1WFKA 3HCTA 3I3JA 1WEMA 5HLSA 3SVHA 4QYLA 5HRXA 3TLPA 5ETBA 3U5NA 4UP5A 2XB1A 2OSSA 2RS9B 3U5JA 4AUQB 5FE0A 4GPJA 4J0SA 5EWHA 2CKLA 5D26A 5LKXA 2IDAA 4MR4A 5ENEA 5II2A 5TRBA 5CTLA 1X4UA 3Q2EA 5DFBA 4QY4A 2LSPB 5FG6A 2C2LA 4P5OB 1WESA 1U6GB 2LGGA 4UIYA 2FUIA 3KV5A 5DYUA 2G6QA 4YYGA 2M1RA 2L85A 2L5UA 5DX4A 4S3OB 4AVXA 3RPGC 5HJCA 3ASLA 2MA5A 3HMHA 4IOOA 4XY8A 5LCWB 2L84A 4A9HA 1VD4A 5B79A 5A7CA 5E9LA 5F2PA 4Z6IA 4J0RA 5FB1A 5DW2A 4YK0A 4GNEA 1E6IA 4OGJA 4QSUA 2MD7B 1LDJB 5F63A 4ZW1A 2KR4A 4L58A 4R7EA 3UV2A 3JVMA 5EWCA 1WILA 4GNGA 4PCIA 2OXQC 4FO9A 3UVYA 3N9NA 3O33A 1ZBDB 2NXBA 2RNYA 4AKNA 5D3TA 4QC3A 4RVRA 3I2DA 4I7BA 4YBTA 4YABA 2R0SA 4CURA 4LLBA 5C7NA 5EK9A 5HQ6A 4QSXA 4IC3A 5CQTA 4YYJA 4N4GA 5EPRA 4KCXA 2K17A 5CQ8A 2YQDA
chains in the Genus database with same CATH superfamily
5IGNA 5EI4A 5E3DA 4IR3A 4QR3A 2K16A 2YYNA 3HTKC 5ENFA 5I40A 1VFYA 4A9OA 2KWNA 4WZ2A 2NAAA 2YELA 5F5ZA 4UIWA 4WIVA 5EVAA 4Z1SA 5FG4A 4UYGA 5G05B 4ZQLA 3N9MA 5HRVA 5F1LA 3UV5A 3N9OA 4PPEA 5C13A 4CUPA 2L75A 2XP0A 3EB6A 4FLPA 4MEOA 4UYFB 5DY7A 5E9VA 1CHCA 2ECGA 3E2DA 5E3GA 4HXSA 5A5OA 3HCUA 4LADB 2KU3A 1WUGA 3SVFA 4FJCA 5FERA 4MR3A 4A4CA 3T9KA 2I8NA 4LC2A 5LVRA 5DLZA 5L8UA 1HYJA 5HRWA 5I89A 3P1CA 3FJUB 2I7KA 5F62A 5E9YA 5DW1A 5L97A 1WEPA 2WP1A 2B0OE 3MB3A 4NR9A 5D3JA 5CUCA 2N9GA 5COIA 2VNFA 4F3IA 2DATA 4PY6A 2VJEB 4HXRA 4A9IA 4CFLA 3T6RA 4LYSA 4J3IA 1Z6UA 3KNVA 5H1UA 2CRRA 2YEMA 2KTBB 2RO1A 4HXLA 5ENJA 2I50A 5C11A 2G43A 3P1DA 2YQLA 3M7KA 5D3PA 1X0JA 3MHHA 5CQ3A 3V43A 4YY6A 5E9IA 1V87A 5I7XA 1BORA 4Q0OA 2RSDA 2E7NA 5FE6A 2YDWA 4AYCA 4UIXA 4BHWA 4C9ZA 5LKZA 4IR5A 4ZC9A 4QZSA 4Q6FA 4A4BA 4B86C 4HBYA 3LRQA 1WEWA 2KREA 4PCEA 5HQ7A 2FD4A 2DKWA 2WP2A 4OUFA 4YYNA 2D8SA 4O7EA 2EODA 4MENA 3P1FA 2VPBA 5I80A 2KGIA 4X3GA 3RCWA 5FH8A 4QEVA 4QEUA 5KU3A 5AITA 4YYHA 4HXPA 4TTEA 3NXBA 3Q2FA 5EV9A 5II1A 4A9LA 2L80A 4YAXA 4GNDA 4MEPA 5A5PA 2E6RA 2ECTA 5A5NA 2QJ0A 5FFWA 5CU8A 5IG6A 5ACYA 5FH7A 4F1PA 5JWMA 5FFYA 4NYXA 1Z60A 5ENCA 2LRIC 4PTBA 5CRZA 4Z93A 3GG3A 4YYDA 5IGLA 1LDKC 5E73A 2FFWA 5FFVA 3KQIA 3DPLR 2DJAA 4NXJA 3N9LA 3VK6A 3D1DA 2KIZA 3L11A 5C4QA 2LGLA 2YEKA 4BW3A 5D1KB 5HFQA 1HYIA 5CS8A 5E9KA 3LXJA 1JM4B 5F60A 2QICA 2YT5A 5D3LA 2YW8A 1MM2A 2MNZA 3SHBA 2YU4A 4AYCB 1JM7A 2CSVA 4LDFA 5CUGA 1WEQA 2L7PA 4AKIA 3O35A 4Z0RA 4W4UA 5DINA 3G0LA 4NYVA 4O7AA 4N4FA 5EU1A 5G04B 4LJNA 4O78A 2Y43A 5EM3A 4CL9A 4S3OC 5KTUA 3JVKA 2YUCA 5HELA 3JVJA 3ZYUA 3SOUA 2ECJA 2EJNA 1WEUA 4ZDTA 4OGIA 5CQ5A 5CRMA 2HDPA 3M63A 4O76A 4QR5A 4NYWA 3O37A 3T7LA 3PHDA 5KTWA 4NR5A 3JVLA 2KWKA 1IYMA 2KWOA 5E9MA 2YYRA 2EGMA 3NG2A 4MSXA 2L5EA 5EWDA 5C89A 4UIVA 2ECVA 1N72A 3P1EA 3KV6A 4NR7A 4LRGA 4NQNA 4TT6A 4QNSA 2JM3A 2JMIA 3EB5A 5TCMA 5B75A 4UIZA 1EQFA 4DONA 5IGMA 3DQVR 5H1TA 2CKLB 4O72A 4QSRA 2C2VS 2D9EA 5SVIA 3SUBA 4HBWA 1DCQA 3G0JA 4L7XA 5A5SA 3RTRB 3SOWA 2LGVA 5CFWA 3O34A 4QSQA 2DVVA 2LQ6A 2YHOA 4XI1A 4O7CA 4I7DA 2DVRA 4O71A 2D82A 3AADA 4ALHA 4XY9A 5HM0A 5CY9A 1JSPB 2MD8C 2E6SA 3ZPV1 2H0DA 4LYIA 5FDZA 3UVDA 3U5PA 3LVQE 4WA6A 2ECWA 4UYHA 4AI6A 5B8DA 2YW5A 4TYLA 2LXHC 5D3NA 3ZTGA 2F6JA 2RNXA 2L0BA 2PNXA 4NS5A 1WEEA 5D24A 4QB3A 5FE2A 1ZS5A 2CONA 5D3RA 3SVGA 3U5KA 2CRWA 2KGGA 3L1ZB 3LVRE 4GNFA 2MUMA 4Y03A 4N4HA 2YSJA 3FL2A 5CPEA 5B76A 5I29A 4QSVA 4NN2A 5BT3A 4O70A 5CP5A 4A0CD 5I86A 2BAYA 5AD2A 5DKAA 2CT2A 4O64A 5G4SA 5TABA 2VJFA 2ECNA 5A5QA 5F25A 3LQHA 2YSMA 4NR6A 1ZKRA 3UV4A 1FBVA 5C87A 4HXNA 5J0DA 2CSZA 2HYED 2UZGA 3FKMX 2RFJA 2XEUA 4QUTA 4HXKA 3O70A 4BBQA 4AKGA 5EICA 2AN6A 2FUUA 4WZ0A 5D1LB 3QZVA 4LR6A 5A82A 3UW9A 3QZTA 4NRBA 5D25A 3VKHA 3FM8C 2XOYA 4QSWA 2LV9A 5C85A 2XOCA 4LK9A 2OUOA 2DVQA 3LDYA 2KFTA 4QYDA 4NRAA 5TB6A 5HEMA 4A9EA 3LQJA 3FANA 3MQMA 4OGCA 5JI8A 4V3KC 1DVPA 3C5KA 5IIDA 3O7AA 3K2JA 4KV4A 4MR6A 5A85A 5H85A 2H0DB 4UITA 5CQ7A 5ENHA 3ONIA 3N9PA 2MNYA 2YHNA 4YBMA 2P57A 2EGPA 2LN0A 4H9DA 2VPGA 3N9QA 2G4AA 5CQ6A 2YQMA 4O62A 4IOQA 5B78A 4QC1A 4UYDA 4Q0NA 3PURA 4O75A 3UVWA 3ZNIA 4QUUA 2LAUA 5A83A 2E7OA 3HMEA 4LYWA 1X4IA 4CUQA 2E3KA 4CA1A 4A9NA 4IC2A 4UP0A 3U5LA 4QF3A 2VPEA 5H9MA 3MB4A 4YH4A 4E96A 2LDRA 5LJ1A 2EA6A 3MULA 4CUSA 5KTXA 3DWDA 1WENA 2M85A 4AKHA 4O74A 2M6MA 2KWJA 5FH6A 5B77A 5D1MB 1K2FA 3LJWA 2RNWA 5DFCA 3ZYQA 4LKAA 5LKUA 3D1BA 4B7YC 5KH7A 4PS5A 5KHMA 3DAIA 2H60A 3AQAA 4LZRA 4WHWA 1T1HA 4NQMA 4NUEA 5EISA 5EGUA 5HCLA 5EQ1A 3L1XA 5LJ2A 5I1QA 2DVSA 5A5RA 4TQNA 5LUUA 4IR6A 4C67A 4O7FA 5CGPA 4CFKA 5I88A 3RPGB 2ECIA 4BW4A 4ALGA 3GV4A 5D3SA 2L43A 4QR4A 2QIZA 5EWVA 5I83A 1F68A 4CLBA 2LXPC 3DDTA 4N3WA 5H1VA 5FE1A 1WGMA 3DWYA 5EWWA 3U5MA 4MR5A 3U5OA 5BT5A 4YH3A 1F62A 5ETDA 4NUDA 3QZSA 4UYFA 5SVYA 3HMFA 5EPBA 5DYCA 5LJ0A 5FE5A 5ENIA 4HXMA 4YYKA 3MUKA 2YURA 3P5OA 5FE3A 5J3XA 4NUCA 4TKPB 5DBMA 2DWWA 4TU4A 2G45A 2MKEA 5DFDA 5TDRA 5I3LA 4F52B 1MM3A 4QSPA 1WEVA 5AIUA 3SOXA 4YADA 4C66A 5L98A 2KKXA 2Y1NA 2VJEA 4UI9B 4ZUXU 2MJVB 3D7CA 5E74A 5D0CA 2MT5A 5SVXA 5G0FA 3VKGA 1JM7B 5L96A 5LKTA 3JUEA 2VPDA 4GB0A 5IBNA 4IR4A 4UYEA 5EA1A 5L8TA 4MVTA 1N87A 5F1HA 5E7DA 5FB0A 5HENA 2K4DA 2XOZA 4CCGX 3ZVYA 1E4UA 5AD3A 4N4IA 4YYMA 2KYUA 2EXUA 5DKDA 2CSYA 3C6WA 4MEQA 4A9MA 3PUQA 5CUEA 5A81A 5ENGA 2KKYA 3GL6A 5CUAA 3KDEC 2KE1A 4J1PA 4NR8A 5CUDA 5DLXA 5BT4A 4QF2A 5FBXA 4HXOA 4PKLA 3S91A 1X4JA 4Z6HA 2VP7A 5LVQA 4YY4A 5FE7A 3IU6A 4CUUA 2R0VA 4A9FA 4AP4A 2JRJA 3M99A 5F3AA 5CQ4A 2M13A 2PUYA 1VYXA 3ZPVE 4QBMA 2MA6A 4FIPA 4R2YA 5ENBA 4WZ3B 2YREA 4LZSA 5FE4A 4Z0OA 4NR4A 4YC9A 5E0RA 4TU6A 5DKCA 4YBSA 1FP0A 5CUBA 5D7XA 5G4RA 3IHPA 5FE9A 4BW1A 2K1JA 4I7CA 4TT2A 3ZVZB 3UVXA 4Z1QA 4IORA 4A9JA 5CQAA 5AMFA 4YYIA 4CUTA 5HQ5A 5SVIB 3MDBC 3S92A 3M62A 4QSSA 5KO4A 3H7HA 4TZ2A 5DYAA 2RI7A 4HBVA 4QSTA 2FSAA 4BW2A 5K29A 1WUMA 4TT4A 4A9KA 2JMJA 4QQ4A 5FEYA 2F42A 4HBXA 5KH3A 5IGKA 5C8GA 4O77A 1WIMA 2R0YA 4XYAA 2OWAA 5JG6A 5TBNA 2LGKA 4TS8A 5CZGA 2DX8A 3O36A 2F6NA 3LQIA 2JUNA 2GRCA 4XUAA 5AMEA 4BJXA 1RMDA 2YVRA 4X2IA 5D3HA 2Y1MA 5KH9A 2ZETC 5F61A 3HCSA 1G25A 5HFRA 5TDWA 3IU5A 5EPSA 5I7YA 2MIQA 1WEOA 1XWHA 5EP7A 4NRCA 4WHUA 5L99A 4UIUA 2OO1A 4TZ8A 5DKHA 5F36A 2JMDA 2VJFB 4LZ2A 2R10A 1WE9A 4FK5A 5EYAF 3PLWA 4A49A 5DYXA 1Z2QA 5FG5A 4YATA 1JOCA 4R8PK 2M3HA 2D8UA 5FE8A 4V3LC 3LJUX 3MXFA 4O7BA 3MHSA 4KV1A 4XUBA 4QEWA 1WFKA 3HCTA 3I3JA 1WEMA 5HLSA 3SVHA 4QYLA 5HRXA 3TLPA 5ETBA 3U5NA 4UP5A 2DSMA 2XB1A 2OSSA 2RS9B 3U5JA 3FEHA 5FE0A 4GPJA 3Q1DA 4AUQB 4J0SA 5EWHA 2CKLA 2E61A 5D26A 5LKXA 2IDAA 4MR4A 5ENEA 5II2A 5TRBA 5CTLA 1MBMA 1X4UA 3Q2EA 1PUOA 5DFBA 4QY4A 2LSPB 5FG6A 2C2LA 4P5OB 1WESA 1U6GB 2LGGA 4UIYA 2FUIA 3KV5A 5DYUA 2G6QA 4YYGA 2M1RA 2L85A 2L5UA 5DX4A 4S3OB 4AVXA 3RPGC 5HJCA 3ASLA 2MA5A 3HMHA 4IOOA 4XY8A 5LCWB 2L84A 4A9HA 1VD4A 5B79A 5A7CA 5E9LA 5F2PA 2IQJA 4Z6IA 4J0RA 5FB1A 5DW2A 4YK0A 4GNEA 1E6IA 4OGJA 4QSUA 2MD7B 2RR4A 1LDJB 5F63A 4ZW1A 2KR4A 3O47A 4L58A 4R7EA 3UV2A 3JVMA 5EWCA 1WILA 4GNGA 4PCIA 2OXQC 4FO9A 3UVYA 3N9NA 3ERRA 3O33A 3FAOA 1ZBDB 2NXBA 2RNYA 4AKNA 5D3TA 4QC3A 4RVRA 3I2DA 4I7BA 4YBTA 4YABA 5K3QA 2R0SA 4OGEA 4CURA 4LLBA 5C7NA 5EK9A 5HQ6A 4QSXA 4IC3A 5CQTA 4YYJA 4N4GA 5EPRA 4KCXA 2K17A 5CQ8A 2YQDA
chains in the Genus database with same CATH topology
5IGNA 5EI4A 5E3DA 4IR3A 4QR3A 2K16A 2YYNA 3HTKC 5ENFA 5I40A 1VFYA 4A9OA 2KWNA 4WZ2A 2NAAA 2YELA 5F5ZA 4UIWA 4WIVA 5EVAA 4Z1SA 5FG4A 4UYGA 5G05B 4ZQLA 3N9MA 5HRVA 5F1LA 3UV5A 3N9OA 4PPEA 5C13A 4CUPA 2L75A 3EB6A 4FLPA 4MEOA 4UYFB 5DY7A 5E9VA 1CHCA 2ECGA 5E3GA 4HXSA 5A5OA 3HCUA 4LADB 2KU3A 1WUGA 3SVFA 4FJCA 5FERA 4MR3A 4A4CA 2I8NA 4LC2A 5LVRA 5DLZA 5L8UA 1HYJA 5HRWA 5I89A 3P1CA 2I7KA 5F62A 5E9YA 5DW1A 5L97A 1WEPA 2WP1A 3MB3A 4NR9A 5D3JA 5CUCA 2N9GA 5COIA 2VNFA 4F3IA 2DATA 4PY6A 2VJEB 4HXRA 4A9IA 4CFLA 3T6RA 4LYSA 4J3IA 1Z6UA 3KNVA 5H1UA 2YEMA 2KTBB 2RO1A 4HXLA 5ENJA 2I50A 5C11A 2G43A 3P1DA 2YQLA 5D3PA 1X0JA 3MHHA 5CQ3A 3V43A 4YY6A 5E9IA 1V87A 5I7XA 1BORA 4Q0OA 2RSDA 2E7NA 5FE6A 2YDWA 4AYCA 4UIXA 4BHWA 4C9ZA 5LKZA 4IR5A 4ZC9A 4QZSA 4Q6FA 4A4BA 4B86C 4HBYA 3LRQA 1WEWA 2KREA 4PCEA 5HQ7A 2DKWA 2WP2A 4OUFA 4YYNA 2D8SA 4O7EA 2EODA 4MENA 3P1FA 2VPBA 5I80A 2KGIA 4X3GA 3RCWA 5FH8A 4QEVA 4QEUA 5KU3A 5AITA 4YYHA 4HXPA 4TTEA 3NXBA 3Q2FA 5EV9A 5II1A 4A9LA 2L80A 4YAXA 4GNDA 4MEPA 5A5PA 2E6RA 2ECTA 5A5NA 2QJ0A 5FFWA 5CU8A 5IG6A 5ACYA 5FH7A 5JWMA 5FFYA 4NYXA 1Z60A 5ENCA 2LRIC 4PTBA 5CRZA 4Z93A 3GG3A 4YYDA 5IGLA 1LDKC 5E73A 3KQIA 5FFVA 3N9LA 3DPLR 1F62A 4NXJA 3VK6A 2KIZA 3L11A 5C4QA 2LGLA 2YEKA 4BW3A 5D1KB 5HFQA 1HYIA 5CS8A 5E9KA 3LXJA 1JM4B 5F60A 2QICA 2YT5A 5D3LA 2YW8A 1MM2A 2MNZA 3SHBA 2YU4A 4AYCB 1JM7A 4LDFA 5CUGA 1WEQA 3O35A 4W4UA 5DINA 3G0LA 4NYVA 4O7AA 4N4FA 5EU1A 5G04B 4LJNA 4O78A 2Y43A 5EM3A 4CL9A 4S3OC 5KTUA 3JVKA 2YUCA 5HELA 3JVJA 3ZYUA 3SOUA 2ECJA 1WEUA 4ZDTA 4OGIA 5CQ5A 5CRMA 2HDPA 3M63A 4O76A 4QR5A 4NYWA 3O37A 3T7LA 3PHDA 5KTWA 4NR5A 3JVLA 2KWKA 1IYMA 2KWOA 5E9MA 2YYRA 3NG2A 4MSXA 2L5EA 5EWDA 5C89A 4UIVA 2ECVA 1N72A 3P1EA 3KV6A 4NR7A 4LRGA 4NQNA 4TT6A 4QNSA 3EB5A 2JMIA 5TCMA 5B75A 4UIZA 1EQFA 4DONA 5IGMA 3DQVR 5H1TA 2CKLB 4O72A 4QSRA 2C2VS 2D9EA 4HBWA 3G0JA 4L7XA 5A5SA 3RTRB 3SOWA 2LGVA 5CFWA 3O34A 4QSQA 2DVVA 2LQ6A 2YHOA 4XI1A 4O7CA 4I7DA 2DVRA 4O71A 2D82A 3AADA 4ALHA 4XY9A 5HM0A 5CY9A 1JSPB 2MD8C 2E6SA 3ZPV1 2H0DA 4LYIA 5FDZA 3UVDA 3U5PA 4WA6A 2ECWA 4UYHA 5B8DA 2YW5A 4TYLA 2LXHC 5D3NA 3ZTGA 2F6JA 2RNXA 2L0BA 2PNXA 4NS5A 1WEEA 5D24A 4QB3A 5FE2A 1ZS5A 3L1ZB 5D3RA 3SVGA 3U5KA 2KGGA 4GNFA 2MUMA 4Y03A 4N4HA 2YSJA 3FL2A 5CPEA 5B76A 5I29A 4QSVA 4NN2A 5BT3A 4O70A 5CP5A 4A0CD 5I86A 2BAYA 5AD2A 5DKAA 2CT2A 4O64A 5G4SA 5TABA 2VJFA 2ECNA 5A5QA 5F25A 3LQHA 2YSMA 4NR6A 3UV4A 1FBVA 5C87A 4HXNA 5J0DA 2CSZA 2HYED 2UZGA 3FKMX 2RFJA 2XEUA 4QUTA 4HXKA 3O70A 4BBQA 2FUUA 5EICA 2AN6A 4WZ0A 5D1LB 3QZVA 4LR6A 5A82A 3UW9A 3QZTA 4NRBA 5D25A 4QSWA 2LV9A 5C85A 4LK9A 2OUOA 2DVQA 2KFTA 4QYDA 4NRAA 5TB6A 5HEMA 4A9EA 3LQJA 4V3KC 3MQMA 5JI8A 1DVPA 3C5KA 5IIDA 3O7AA 3K2JA 4KV4A 4MR6A 5A85A 5H85A 2H0DB 4UITA 5CQ7A 5ENHA 3ONIA 3N9PA 2MNYA 2YHNA 4YBMA 2EGPA 2LN0A 2VPGA 3N9QA 2G4AA 5CQ6A 2YQMA 4IOQA 5B78A 4QC1A 4UYDA 4Q0NA 3PURA 4O75A 3UVWA 3ZNIA 4QUUA 5A83A 2E7OA 3HMEA 4LYWA 1X4IA 4CUQA 2E3KA 4CA1A 4A9NA 4IC2A 4UP0A 3U5LA 4QF3A 2VPEA 5H9MA 3MB4A 4YH4A 4E96A 2LDRA 5LJ1A 2EA6A 3MULA 4CUSA 5KTXA 1WENA 2M85A 4O74A 2M6MA 2KWJA 5FH6A 5B77A 5D1MB 1K2FA 3LJWA 2RNWA 5DFCA 3ZYQA 4LKAA 5LKUA 4B7YC 5KH7A 4PS5A 5KHMA 3DAIA 2H60A 3AQAA 4LZRA 4WHWA 1T1HA 4NQMA 4NUEA 5EISA 5EGUA 5HCLA 5EQ1A 3L1XA 5LJ2A 5I1QA 2DVSA 5A5RA 4TQNA 5LUUA 4IR6A 4C67A 4O7FA 5CGPA 4CFKA 5I88A 3RPGB 2ECIA 4BW4A 4ALGA 3GV4A 5D3SA 2L43A 4QR4A 2QIZA 5EWVA 5I83A 1F68A 4CLBA 2LXPC 4N3WA 5H1VA 5FE1A 1WGMA 3DWYA 5EWWA 3U5MA 4MR5A 3U5OA 5BT5A 4YH3A 5ETDA 4NUDA 3QZSA 4UYFA 3HMFA 5EPBA 5DYCA 5LJ0A 5FE5A 5ENIA 4HXMA 4YYKA 3MUKA 2YURA 3P5OA 5FE3A 5J3XA 4NUCA 4TKPB 5DBMA 2DWWA 4TU4A 2G45A 5DFDA 5TDRA 5I3LA 4F52B 1MM3A 4QSPA 1WEVA 5AIUA 3SOXA 4YADA 4C66A 5L98A 2Y1NA 2VJEA 4UI9B 4ZUXU 2MJVB 3D7CA 5E74A 5D0CA 2MT5A 5G0FA 1JM7B 5L96A 5LKTA 2VPDA 4GB0A 5IBNA 4IR4A 4UYEA 5EA1A 5L8TA 4MVTA 1N87A 5F1HA 5E7DA 5FB0A 5HENA 2K4DA 4CCGX 1E4UA 3ZVYA 5AD3A 4N4IA 4YYMA 2KYUA 5DKDA 2CSYA 3C6WA 4MEQA 4A9MA 3PUQA 5CUEA 5A81A 5ENGA 3GL6A 5CUAA 2KE1A 4J1PA 4NR8A 5CUDA 5DLXA 5BT4A 4QF2A 5FBXA 4HXOA 4PKLA 3S91A 1X4JA 4Z6HA 2VP7A 5LVQA 4YY4A 5FE7A 3IU6A 4CUUA 2R0VA 4A9FA 4AP4A 2JRJA 3M99A 5F3AA 5CQ4A 2PUYA 1VYXA 3ZPVE 4QBMA 2MA6A 4FIPA 4R2YA 5ENBA 4WZ3B 2YREA 4LZSA 5FE4A 4NR4A 4YC9A 5E0RA 4TU6A 5DKCA 4YBSA 1FP0A 5CUBA 5D7XA 5G4RA 3IHPA 5FE9A 4BW1A 2K1JA 4I7CA 4TT2A 3ZVZB 3UVXA 4Z1QA 4IORA 4A9JA 5CQAA 5AMFA 4YYIA 4CUTA 5HQ5A 3S92A 3M62A 4QSSA 5KO4A 4TZ2A 5DYAA 2RI7A 4HBVA 4QSTA 2FSAA 4BW2A 5K29A 1WUMA 4TT4A 4A9KA 2JMJA 5FEYA 2F42A 4HBXA 5KH3A 5IGKA 5C8GA 4O77A 1WIMA 2R0YA 4XYAA 5JG6A 5TBNA 2LGKA 4TS8A 5CZGA 2DX8A 3O36A 2F6NA 3LQIA 2GRCA 4XUAA 5AMEA 4BJXA 1RMDA 4X2IA 5D3HA 2Y1MA 5KH9A 2ZETC 5F61A 3HCSA 1G25A 5HFRA 5TDWA 3IU5A 5EPSA 5I7YA 2MIQA 1WEOA 1XWHA 5EP7A 4NRCA 4WHUA 5L99A 4UIUA 2OO1A 4TZ8A 5DKHA 5F36A 2JMDA 2VJFB 4LZ2A 2R10A 1WE9A 4FK5A 5EYAF 4A49A 5DYXA 1Z2QA 5FG5A 4YATA 1JOCA 4R8PK 2M3HA 5FE8A 4V3LC 3MXFA 4O7BA 3MHSA 4KV1A 4XUBA 4QEWA 1WFKA 3HCTA 3I3JA 1WEMA 5HLSA 3SVHA 4QYLA 5HRXA 3TLPA 5ETBA 3U5NA 4UP5A 2XB1A 2OSSA 2RS9B 3U5JA 4AUQB 5FE0A 4GPJA 4J0SA 5EWHA 2CKLA 5D26A 5LKXA 2IDAA 4MR4A 5ENEA 5II2A 5TRBA 5CTLA 1X4UA 3Q2EA 5DFBA 4QY4A 2LSPB 5FG6A 2C2LA 4P5OB 1WESA 1U6GB 2LGGA 4UIYA 2FUIA 3KV5A 5DYUA 2G6QA 4YYGA 2M1RA 2L85A 2L5UA 5DX4A 4S3OB 4AVXA 3RPGC 5HJCA 3ASLA 2MA5A 3HMHA 4IOOA 4XY8A 5LCWB 2L84A 4A9HA 1VD4A 5B79A 5A7CA 5E9LA 5F2PA 4Z6IA 4J0RA 5FB1A 5DW2A 4YK0A 4GNEA 1E6IA 4OGJA 4QSUA 2MD7B 1LDJB 5F63A 4ZW1A 2KR4A 4L58A 4R7EA 3UV2A 3JVMA 5EWCA 1WILA 4GNGA 4PCIA 2OXQC 4FO9A 3UVYA 3N9NA 3O33A 1ZBDB 2NXBA 2RNYA 4AKNA 5D3TA 4QC3A 4RVRA 3I2DA 4I7BA 4YBTA 4YABA 2R0SA 4CURA 4LLBA 5C7NA 5EK9A 5HQ6A 4QSXA 4IC3A 5CQTA 4YYJA 4N4GA 5EPRA 4KCXA 2K17A 5CQ8A 2YQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGN A;  5EI4 A;  5E3D A;  4IR3 A;  4QR3 A;  2K16 A;  2YYN A;  3HTK C;  5ENF A;  5I40 A;  1VFY A;  4A9O A;  2KWN A;  4WZ2 A;  2NAA A;  2YEL A;  5F5Z A;  4UIW A;  4WIV A;  5EVA A;  4Z1S A;  5FG4 A;  4UYG A;  5G05 B;  4ZQL A;  3N9M A;  5HRV A;  5F1L A;  3UV5 A;  3N9O A;  4PPE A;  5C13 A;  4CUP A;  2L75 A;  3EB6 A;  4FLP A;  4MEO A;  4UYF B;  5DY7 A;  5E9V A;  1CHC A;  2ECG A;  5E3G A;  4HXS A;  5A5O A;  3HCU A;  4LAD B;  2KU3 A;  1WUG A;  3SVF A;  4FJC A;  5FER A;  4MR3 A;  4A4C A;  2I8N A;  4LC2 A;  5LVR A;  5DLZ A;  5L8U A;  1HYJ A;  5HRW A;  5I89 A;  3P1C A;  2I7K A;  5F62 A;  5E9Y A;  5DW1 A;  5L97 A;  1WEP A;  2WP1 A;  3MB3 A;  4NR9 A;  5D3J A;  5CUC A;  2N9G A;  5COI A;  2VNF A;  4F3I A;  2DAT A;  4PY6 A;  2VJE B;  4HXR A;  4A9I A;  4CFL A;  3T6R A;  4LYS A;  4J3I A;  1Z6U A;  3KNV A;  5H1U A;  2YEM A;  2KTB B;  2RO1 A;  4HXL A;  5ENJ A;  2I50 A;  5C11 A;  2G43 A;  3P1D A;  2YQL A;  5D3P A;  1X0J A;  3MHH A;  5CQ3 A;  3V43 A;  4YY6 A;  5E9I A;  1V87 A;  5I7X A;  1BOR A;  4Q0O A;  2RSD A;  2E7N A;  5FE6 A;  2YDW A;  4AYC A;  4UIX A;  4BHW A;  4C9Z A;  5LKZ A;  4IR5 A;  4ZC9 A;  4QZS A;  4Q6F A;  4A4B A;  4B86 C;  4HBY A;  3LRQ A;  1WEW A;  2KRE A;  4PCE A;  5HQ7 A;  2DKW A;  2WP2 A;  4OUF A;  4YYN A;  2D8S A;  4O7E A;  2EOD A;  4MEN A;  3P1F A;  2VPB A;  5I80 A;  2KGI A;  4X3G A;  3RCW A;  5FH8 A;  4QEV A;  4QEU A;  5KU3 A;  5AIT A;  4YYH A;  4HXP A;  4TTE A;  3NXB A;  3Q2F A;  5EV9 A;  5II1 A;  4A9L A;  2L80 A;  4YAX A;  4GND A;  4MEP A;  5A5P A;  2E6R A;  2ECT A;  5A5N A;  2QJ0 A;  5FFW A;  5CU8 A;  5IG6 A;  5ACY A;  5FH7 A;  5JWM A;  5FFY A;  4NYX A;  1Z60 A;  5ENC A;  2LRI C;  4PTB A;  5CRZ A;  4Z93 A;  3GG3 A;  4YYD A;  5IGL A;  1LDK C;  5E73 A;  3KQI A;  5FFV A;  3N9L A;  3DPL R;  1F62 A;  4NXJ A;  3VK6 A;  2KIZ A;  3L11 A;  5C4Q A;  2LGL A;  2YEK A;  4BW3 A;  5D1K B;  5HFQ A;  1HYI A;  5CS8 A;  5E9K A;  3LXJ A;  1JM4 B;  5F60 A;  2QIC A;  2YT5 A;  5D3L A;  2YW8 A;  1MM2 A;  2MNZ A;  3SHB A;  2YU4 A;  4AYC B;  1JM7 A;  4LDF A;  5CUG A;  1WEQ A;  3O35 A;  4W4U A;  5DIN A;  3G0L A;  4NYV A;  4O7A A;  4N4F A;  5EU1 A;  5G04 B;  4LJN A;  4O78 A;  2Y43 A;  5EM3 A;  4CL9 A;  4S3O C;  5KTU A;  3JVK A;  2YUC A;  5HEL A;  3JVJ A;  3ZYU A;  3SOU A;  2ECJ A;  1WEU A;  4ZDT A;  4OGI A;  5CQ5 A;  5CRM A;  2HDP A;  3M63 A;  4O76 A;  4QR5 A;  4NYW A;  3O37 A;  3T7L A;  3PHD A;  5KTW A;  4NR5 A;  3JVL A;  2KWK A;  1IYM A;  2KWO A;  5E9M A;  2YYR A;  3NG2 A;  4MSX A;  2L5E A;  5EWD A;  5C89 A;  4UIV A;  2ECV A;  1N72 A;  3P1E A;  3KV6 A;  4NR7 A;  4LRG A;  4NQN A;  4TT6 A;  4QNS A;  3EB5 A;  2JMI A;  5TCM A;  5B75 A;  4UIZ A;  1EQF A;  4DON A;  5IGM A;  3DQV R;  5H1T A;  2CKL B;  4O72 A;  4QSR A;  2C2V S;  2D9E A;  4HBW A;  3G0J A;  4L7X A;  5A5S A;  3RTR B;  3SOW A;  2LGV A;  5CFW A;  3O34 A;  4QSQ A;  2DVV A;  2LQ6 A;  2YHO A;  4XI1 A;  4O7C A;  4I7D A;  2DVR A;  4O71 A;  2D82 A;  3AAD A;  4ALH A;  4XY9 A;  5HM0 A;  5CY9 A;  1JSP B;  2MD8 C;  2E6S A;  3ZPV 1;  2H0D A;  4LYI A;  5FDZ A;  3UVD A;  3U5P A;  4WA6 A;  2ECW A;  4UYH A;  5B8D A;  2YW5 A;  4TYL A;  2LXH C;  5D3N A;  3ZTG A;  2F6J A;  2RNX A;  2L0B A;  2PNX A;  4NS5 A;  1WEE A;  5D24 A;  4QB3 A;  5FE2 A;  1ZS5 A;  3L1Z B;  5D3R A;  3SVG A;  3U5K A;  2KGG A;  4GNF A;  2MUM A;  4Y03 A;  4N4H A;  2YSJ A;  3FL2 A;  5CPE A;  5B76 A;  5I29 A;  4QSV A;  4NN2 A;  5BT3 A;  4O70 A;  5CP5 A;  4A0C D;  5I86 A;  2BAY A;  5AD2 A;  5DKA A;  2CT2 A;  4O64 A;  5G4S A;  5TAB A;  2VJF A;  2ECN A;  5A5Q A;  5F25 A;  3LQH A;  2YSM A;  4NR6 A;  3UV4 A;  1FBV A;  5C87 A;  4HXN A;  5J0D A;  2CSZ A;  2HYE D;  2UZG A;  3FKM X;  2RFJ A;  2XEU A;  4QUT A;  4HXK A;  3O70 A;  4BBQ A;  2FUU A;  5EIC A;  2AN6 A;  4WZ0 A;  5D1L B;  3QZV A;  4LR6 A;  5A82 A;  3UW9 A;  3QZT A;  4NRB A;  5D25 A;  4QSW A;  2LV9 A;  5C85 A;  4LK9 A;  2OUO A;  2DVQ A;  2KFT A;  4QYD A;  4NRA A;  5TB6 A;  5HEM A;  4A9E A;  3LQJ A;  4V3K C;  3MQM A;  5JI8 A;  1DVP A;  3C5K A;  5IID A;  3O7A A;  3K2J A;  4KV4 A;  4MR6 A;  5A85 A;  5H85 A;  2H0D B;  4UIT A;  5CQ7 A;  5ENH A;  3ONI A;  3N9P A;  2MNY A;  2YHN A;  4YBM A;  2EGP A;  2LN0 A;  2VPG A;  3N9Q A;  2G4A A;  5CQ6 A;  2YQM A;  4IOQ A;  5B78 A;  4QC1 A;  4UYD A;  4Q0N A;  3PUR A;  4O75 A;  3UVW A;  3ZNI A;  4QUU A;  5A83 A;  2E7O A;  3HME A;  4LYW A;  1X4I A;  4CUQ A;  2E3K A;  4CA1 A;  4A9N A;  4IC2 A;  4UP0 A;  3U5L A;  4QF3 A;  2VPE A;  5H9M A;  3MB4 A;  4YH4 A;  4E96 A;  2LDR A;  5LJ1 A;  2EA6 A;  3MUL A;  4CUS A;  5KTX A;  1WEN A;  2M85 A;  4O74 A;  2M6M A;  2KWJ A;  5FH6 A;  5B77 A;  5D1M B;  1K2F A;  3LJW A;  2RNW A;  5DFC A;  3ZYQ A;  4LKA A;  5LKU A;  4B7Y C;  5KH7 A;  4PS5 A;  5KHM A;  3DAI A;  2H60 A;  3AQA A;  4LZR A;  4WHW A;  1T1H A;  4NQM A;  4NUE A;  5EIS A;  5EGU A;  5HCL A;  5EQ1 A;  3L1X A;  5LJ2 A;  5I1Q A;  2DVS A;  5A5R A;  4TQN A;  5LUU A;  4IR6 A;  4C67 A;  4O7F A;  5CGP A;  4CFK A;  5I88 A;  3RPG B;  2ECI A;  4BW4 A;  4ALG A;  3GV4 A;  5D3S A;  2L43 A;  4QR4 A;  2QIZ A;  5EWV A;  5I83 A;  1F68 A;  4CLB A;  2LXP C;  4N3W A;  5H1V A;  5FE1 A;  1WGM A;  3DWY A;  5EWW A;  3U5M A;  4MR5 A;  3U5O A;  5BT5 A;  4YH3 A;  5ETD A;  4NUD A;  3QZS A;  4UYF A;  3HMF A;  5EPB A;  5DYC A;  5LJ0 A;  5FE5 A;  5ENI A;  4HXM A;  4YYK A;  3MUK A;  2YUR A;  3P5O A;  5FE3 A;  5J3X A;  4NUC A;  4TKP B;  5DBM A;  2DWW A;  4TU4 A;  2G45 A;  5DFD A;  5TDR A;  5I3L A;  4F52 B;  1MM3 A;  4QSP A;  1WEV A;  5AIU A;  3SOX A;  4YAD A;  4C66 A;  5L98 A;  2Y1N A;  2VJE A;  4UI9 B;  4ZUX U;  2MJV B;  3D7C A;  5E74 A;  5D0C A;  2MT5 A;  5G0F A;  1JM7 B;  5L96 A;  5LKT A;  2VPD A;  4GB0 A;  5IBN A;  4IR4 A;  4UYE A;  5EA1 A;  5L8T A;  4MVT A;  1N87 A;  5F1H A;  5E7D A;  5FB0 A;  5HEN A;  2K4D A;  4CCG X;  1E4U A;  3ZVY A;  5AD3 A;  4N4I A;  4YYM A;  2KYU A;  5DKD A;  2CSY A;  3C6W A;  4MEQ A;  4A9M A;  3PUQ A;  5CUE A;  5A81 A;  5ENG A;  3GL6 A;  5CUA A;  2KE1 A;  4J1P A;  4NR8 A;  5CUD A;  5DLX A;  5BT4 A;  4QF2 A;  5FBX A;  4HXO A;  4PKL A;  3S91 A;  1X4J A;  4Z6H A;  2VP7 A;  5LVQ A;  4YY4 A;  5FE7 A;  3IU6 A;  4CUU A;  2R0V A;  4A9F A;  4AP4 A;  2JRJ A;  3M99 A;  5F3A A;  5CQ4 A;  2PUY A;  1VYX A;  3ZPV E;  4QBM A;  2MA6 A;  4FIP A;  4R2Y A;  5ENB A;  4WZ3 B;  2YRE A;  4LZS A;  5FE4 A;  4NR4 A;  4YC9 A;  5E0R A;  4TU6 A;  5DKC A;  4YBS A;  1FP0 A;  5CUB A;  5D7X A;  5G4R A;  3IHP A;  5FE9 A;  4BW1 A;  2K1J A;  4I7C A;  4TT2 A;  3ZVZ B;  3UVX A;  4Z1Q A;  4IOR A;  4A9J A;  5CQA A;  5AMF A;  4YYI A;  4CUT A;  5HQ5 A;  3S92 A;  3M62 A;  4QSS A;  5KO4 A;  4TZ2 A;  5DYA A;  2RI7 A;  4HBV A;  4QST A;  2FSA A;  4BW2 A;  5K29 A;  1WUM A;  4TT4 A;  4A9K A;  2JMJ A;  5FEY A;  2F42 A;  4HBX A;  5KH3 A;  5IGK A;  5C8G A;  4O77 A;  1WIM A;  2R0Y A;  4XYA A;  5JG6 A;  5TBN A;  2LGK A;  4TS8 A;  5CZG A;  2DX8 A;  3O36 A;  2F6N A;  3LQI A;  2GRC A;  4XUA A;  5AME A;  4BJX A;  1RMD A;  4X2I A;  5D3H A;  2Y1M A;  5KH9 A;  2ZET C;  5F61 A;  3HCS A;  1G25 A;  5HFR A;  5TDW A;  3IU5 A;  5EPS A;  5I7Y A;  2MIQ A;  1WEO A;  1XWH A;  5EP7 A;  4NRC A;  4WHU A;  5L99 A;  4UIU A;  2OO1 A;  4TZ8 A;  5DKH A;  5F36 A;  2JMD A;  2VJF B;  4LZ2 A;  2R10 A;  1WE9 A;  4FK5 A;  5EYA F;  4A49 A;  5DYX A;  1Z2Q A;  5FG5 A;  4YAT A;  1JOC A;  4R8P K;  2M3H A;  5FE8 A;  4V3L C;  3MXF A;  4O7B A;  3MHS A;  4KV1 A;  4XUB A;  4QEW A;  1WFK A;  3HCT A;  3I3J A;  1WEM A;  5HLS A;  3SVH A;  4QYL A;  5HRX A;  3TLP A;  5ETB A;  3U5N A;  4UP5 A;  2XB1 A;  2OSS A;  2RS9 B;  3U5J A;  4AUQ B;  5FE0 A;  4GPJ A;  4J0S A;  5EWH A;  2CKL A;  5D26 A;  5LKX A;  2IDA A;  4MR4 A;  5ENE A;  5II2 A;  5TRB A;  5CTL A;  1X4U A;  3Q2E A;  5DFB A;  4QY4 A;  2LSP B;  5FG6 A;  2C2L A;  4P5O B;  1WES A;  1U6G B;  2LGG A;  4UIY A;  2FUI A;  3KV5 A;  5DYU A;  2G6Q A;  4YYG A;  2M1R A;  2L85 A;  2L5U A;  5DX4 A;  4S3O B;  4AVX A;  3RPG C;  5HJC A;  3ASL A;  2MA5 A;  3HMH A;  4IOO A;  4XY8 A;  5LCW B;  2L84 A;  4A9H A;  1VD4 A;  5B79 A;  5A7C A;  5E9L A;  5F2P A;  4Z6I A;  4J0R A;  5FB1 A;  5DW2 A;  4YK0 A;  4GNE A;  1E6I A;  4OGJ A;  4QSU A;  2MD7 B;  1LDJ B;  5F63 A;  4ZW1 A;  2KR4 A;  4L58 A;  4R7E A;  3UV2 A;  3JVM A;  5EWC A;  1WIL A;  4GNG A;  4PCI A;  2OXQ C;  4FO9 A;  3UVY A;  3N9N A;  3O33 A;  1ZBD B;  2NXB A;  2RNY A;  4AKN A;  5D3T A;  4QC3 A;  4RVR A;  3I2D A;  4I7B A;  4YBT A;  4YAB A;  2R0S A;  4CUR A;  4LLB A;  5C7N A;  5EK9 A;  5HQ6 A;  4QSX A;  4IC3 A;  5CQT A;  4YYJ A;  4N4G A;  5EPR A;  4KCX A;  2K17 A;  5CQ8 A;  2YQD A; 
#chains in the Genus database with same CATH topology
 5IGN A;  5EI4 A;  5E3D A;  4IR3 A;  4QR3 A;  2K16 A;  2YYN A;  3HTK C;  5ENF A;  5I40 A;  1VFY A;  4A9O A;  2KWN A;  4WZ2 A;  2NAA A;  2YEL A;  5F5Z A;  4UIW A;  4WIV A;  5EVA A;  4Z1S A;  5FG4 A;  4UYG A;  5G05 B;  4ZQL A;  3N9M A;  5HRV A;  5F1L A;  3UV5 A;  3N9O A;  4PPE A;  5C13 A;  4CUP A;  2L75 A;  2XP0 A;  3EB6 A;  4FLP A;  4MEO A;  4UYF B;  5DY7 A;  5E9V A;  1CHC A;  2ECG A;  3E2D A;  5E3G A;  4HXS A;  5A5O A;  3HCU A;  4LAD B;  2KU3 A;  1WUG A;  3SVF A;  4FJC A;  5FER A;  4MR3 A;  4A4C A;  3T9K A;  2I8N A;  4LC2 A;  5LVR A;  5DLZ A;  5L8U A;  1HYJ A;  5HRW A;  5I89 A;  3P1C A;  3FJU B;  2I7K A;  5F62 A;  5E9Y A;  5DW1 A;  5L97 A;  1WEP A;  2WP1 A;  2B0O E;  3MB3 A;  4NR9 A;  5D3J A;  5CUC A;  2N9G A;  5COI A;  2VNF A;  4F3I A;  2DAT A;  4PY6 A;  2VJE B;  4HXR A;  4A9I A;  4CFL A;  3T6R A;  4LYS A;  4J3I A;  1Z6U A;  3KNV A;  5H1U A;  2CRR A;  2YEM A;  2KTB B;  2RO1 A;  4HXL A;  5ENJ A;  2I50 A;  5C11 A;  2G43 A;  3P1D A;  2YQL A;  3M7K A;  5D3P A;  1X0J A;  3MHH A;  5CQ3 A;  3V43 A;  4YY6 A;  5E9I A;  1V87 A;  5I7X A;  1BOR A;  4Q0O A;  2RSD A;  2E7N A;  5FE6 A;  2YDW A;  4AYC A;  4UIX A;  4BHW A;  4C9Z A;  5LKZ A;  4IR5 A;  4ZC9 A;  4QZS A;  4Q6F A;  4A4B A;  4B86 C;  4HBY A;  3LRQ A;  1WEW A;  2KRE A;  4PCE A;  5HQ7 A;  2FD4 A;  2DKW A;  2WP2 A;  4OUF A;  4YYN A;  2D8S A;  4O7E A;  2EOD A;  4MEN A;  3P1F A;  2VPB A;  5I80 A;  2KGI A;  4X3G A;  3RCW A;  5FH8 A;  4QEV A;  4QEU A;  5KU3 A;  5AIT A;  4YYH A;  4HXP A;  4TTE A;  3NXB A;  3Q2F A;  5EV9 A;  5II1 A;  4A9L A;  2L80 A;  4YAX A;  4GND A;  4MEP A;  5A5P A;  2E6R A;  2ECT A;  5A5N A;  2QJ0 A;  5FFW A;  5CU8 A;  5IG6 A;  5ACY A;  5FH7 A;  4F1P A;  5JWM A;  5FFY A;  4NYX A;  1Z60 A;  5ENC A;  2LRI C;  4PTB A;  5CRZ A;  4Z93 A;  3GG3 A;  4YYD A;  5IGL A;  1LDK C;  5E73 A;  2FFW A;  5FFV A;  3KQI A;  3DPL R;  2DJA A;  4NXJ A;  3N9L A;  3VK6 A;  3D1D A;  2KIZ A;  3L11 A;  5C4Q A;  2LGL A;  2YEK A;  4BW3 A;  5D1K B;  5HFQ A;  1HYI A;  5CS8 A;  5E9K A;  3LXJ A;  1JM4 B;  5F60 A;  2QIC A;  2YT5 A;  5D3L A;  2YW8 A;  1MM2 A;  2MNZ A;  3SHB A;  2YU4 A;  4AYC B;  1JM7 A;  2CSV A;  4LDF A;  5CUG A;  1WEQ A;  2L7P A;  4AKI A;  3O35 A;  4Z0R A;  4W4U A;  5DIN A;  3G0L A;  4NYV A;  4O7A A;  4N4F A;  5EU1 A;  5G04 B;  4LJN A;  4O78 A;  2Y43 A;  5EM3 A;  4CL9 A;  4S3O C;  5KTU A;  3JVK A;  2YUC A;  5HEL A;  3JVJ A;  3ZYU A;  3SOU A;  2ECJ A;  2EJN A;  1WEU A;  4ZDT A;  4OGI A;  5CQ5 A;  5CRM A;  2HDP A;  3M63 A;  4O76 A;  4QR5 A;  4NYW A;  3O37 A;  3T7L A;  3PHD A;  5KTW A;  4NR5 A;  3JVL A;  2KWK A;  1IYM A;  2KWO A;  5E9M A;  2YYR A;  2EGM A;  3NG2 A;  4MSX A;  2L5E A;  5EWD A;  5C89 A;  4UIV A;  2ECV A;  1N72 A;  3P1E A;  3KV6 A;  4NR7 A;  4LRG A;  4NQN A;  4TT6 A;  4QNS A;  2JM3 A;  2JMI A;  3EB5 A;  5TCM A;  5B75 A;  4UIZ A;  1EQF A;  4DON A;  5IGM A;  3DQV R;  5H1T A;  2CKL B;  4O72 A;  4QSR A;  2C2V S;  2D9E A;  5SVI A;  3SUB A;  4HBW A;  1DCQ A;  3G0J A;  4L7X A;  5A5S A;  3RTR B;  3SOW A;  2LGV A;  5CFW A;  3O34 A;  4QSQ A;  2DVV A;  2LQ6 A;  2YHO A;  4XI1 A;  4O7C A;  4I7D A;  2DVR A;  4O71 A;  2D82 A;  3AAD A;  4ALH A;  4XY9 A;  5HM0 A;  5CY9 A;  1JSP B;  2MD8 C;  2E6S A;  3ZPV 1;  2H0D A;  4LYI A;  5FDZ A;  3UVD A;  3U5P A;  3LVQ E;  4WA6 A;  2ECW A;  4UYH A;  4AI6 A;  5B8D A;  2YW5 A;  4TYL A;  2LXH C;  5D3N A;  3ZTG A;  2F6J A;  2RNX A;  2L0B A;  2PNX A;  4NS5 A;  1WEE A;  5D24 A;  4QB3 A;  5FE2 A;  1ZS5 A;  2CON A;  5D3R A;  3SVG A;  3U5K A;  2CRW A;  2KGG A;  3L1Z B;  3LVR E;  4GNF A;  2MUM A;  4Y03 A;  4N4H A;  2YSJ A;  3FL2 A;  5CPE A;  5B76 A;  5I29 A;  4QSV A;  4NN2 A;  5BT3 A;  4O70 A;  5CP5 A;  4A0C D;  5I86 A;  2BAY A;  5AD2 A;  5DKA A;  2CT2 A;  4O64 A;  5G4S A;  5TAB A;  2VJF A;  2ECN A;  5A5Q A;  5F25 A;  3LQH A;  2YSM A;  4NR6 A;  1ZKR A;  3UV4 A;  1FBV A;  5C87 A;  4HXN A;  5J0D A;  2CSZ A;  2HYE D;  2UZG A;  3FKM X;  2RFJ A;  2XEU A;  4QUT A;  4HXK A;  3O70 A;  4BBQ A;  4AKG A;  5EIC A;  2AN6 A;  2FUU A;  4WZ0 A;  5D1L B;  3QZV A;  4LR6 A;  5A82 A;  3UW9 A;  3QZT A;  4NRB A;  5D25 A;  3VKH A;  3FM8 C;  2XOY A;  4QSW A;  2LV9 A;  5C85 A;  2XOC A;  4LK9 A;  2OUO A;  2DVQ A;  3LDY A;  2KFT A;  4QYD A;  4NRA A;  5TB6 A;  5HEM A;  4A9E A;  3LQJ A;  3FAN A;  3MQM A;  4OGC A;  5JI8 A;  4V3K C;  1DVP A;  3C5K A;  5IID A;  3O7A A;  3K2J A;  4KV4 A;  4MR6 A;  5A85 A;  5H85 A;  2H0D B;  4UIT A;  5CQ7 A;  5ENH A;  3ONI A;  3N9P A;  2MNY A;  2YHN A;  4YBM A;  2P57 A;  2EGP A;  2LN0 A;  4H9D A;  2VPG A;  3N9Q A;  2G4A A;  5CQ6 A;  2YQM A;  4O62 A;  4IOQ A;  5B78 A;  4QC1 A;  4UYD A;  4Q0N A;  3PUR A;  4O75 A;  3UVW A;  3ZNI A;  4QUU A;  2LAU A;  5A83 A;  2E7O A;  3HME A;  4LYW A;  1X4I A;  4CUQ A;  2E3K A;  4CA1 A;  4A9N A;  4IC2 A;  4UP0 A;  3U5L A;  4QF3 A;  2VPE A;  5H9M A;  3MB4 A;  4YH4 A;  4E96 A;  2LDR A;  5LJ1 A;  2EA6 A;  3MUL A;  4CUS A;  5KTX A;  3DWD A;  1WEN A;  2M85 A;  4AKH A;  4O74 A;  2M6M A;  2KWJ A;  5FH6 A;  5B77 A;  5D1M B;  1K2F A;  3LJW A;  2RNW A;  5DFC A;  3ZYQ A;  4LKA A;  5LKU A;  3D1B A;  4B7Y C;  5KH7 A;  4PS5 A;  5KHM A;  3DAI A;  2H60 A;  3AQA A;  4LZR A;  4WHW A;  1T1H A;  4NQM A;  4NUE A;  5EIS A;  5EGU A;  5HCL A;  5EQ1 A;  3L1X A;  5LJ2 A;  5I1Q A;  2DVS A;  5A5R A;  4TQN A;  5LUU A;  4IR6 A;  4C67 A;  4O7F A;  5CGP A;  4CFK A;  5I88 A;  3RPG B;  2ECI A;  4BW4 A;  4ALG A;  3GV4 A;  5D3S A;  2L43 A;  4QR4 A;  2QIZ A;  5EWV A;  5I83 A;  1F68 A;  4CLB A;  2LXP C;  3DDT A;  4N3W A;  5H1V A;  5FE1 A;  1WGM A;  3DWY A;  5EWW A;  3U5M A;  4MR5 A;  3U5O A;  5BT5 A;  4YH3 A;  1F62 A;  5ETD A;  4NUD A;  3QZS A;  4UYF A;  5SVY A;  3HMF A;  5EPB A;  5DYC A;  5LJ0 A;  5FE5 A;  5ENI A;  4HXM A;  4YYK A;  3MUK A;  2YUR A;  3P5O A;  5FE3 A;  5J3X A;  4NUC A;  4TKP B;  5DBM A;  2DWW A;  4TU4 A;  2G45 A;  2MKE A;  5DFD A;  5TDR A;  5I3L A;  4F52 B;  1MM3 A;  4QSP A;  1WEV A;  5AIU A;  3SOX A;  4YAD A;  4C66 A;  5L98 A;  2KKX A;  2Y1N A;  2VJE A;  4UI9 B;  4ZUX U;  2MJV B;  3D7C A;  5E74 A;  5D0C A;  2MT5 A;  5SVX A;  5G0F A;  3VKG A;  1JM7 B;  5L96 A;  5LKT A;  3JUE A;  2VPD A;  4GB0 A;  5IBN A;  4IR4 A;  4UYE A;  5EA1 A;  5L8T A;  4MVT A;  1N87 A;  5F1H A;  5E7D A;  5FB0 A;  5HEN A;  2K4D A;  2XOZ A;  4CCG X;  3ZVY A;  1E4U A;  5AD3 A;  4N4I A;  4YYM A;  2KYU A;  2EXU A;  5DKD A;  2CSY A;  3C6W A;  4MEQ A;  4A9M A;  3PUQ A;  5CUE A;  5A81 A;  5ENG A;  2KKY A;  3GL6 A;  5CUA A;  3KDE C;  2KE1 A;  4J1P A;  4NR8 A;  5CUD A;  5DLX A;  5BT4 A;  4QF2 A;  5FBX A;  4HXO A;  4PKL A;  3S91 A;  1X4J A;  4Z6H A;  2VP7 A;  5LVQ A;  4YY4 A;  5FE7 A;  3IU6 A;  4CUU A;  2R0V A;  4A9F A;  4AP4 A;  2JRJ A;  3M99 A;  5F3A A;  5CQ4 A;  2M13 A;  2PUY A;  1VYX A;  3ZPV E;  4QBM A;  2MA6 A;  4FIP A;  4R2Y A;  5ENB A;  4WZ3 B;  2YRE A;  4LZS A;  5FE4 A;  4Z0O A;  4NR4 A;  4YC9 A;  5E0R A;  4TU6 A;  5DKC A;  4YBS A;  1FP0 A;  5CUB A;  5D7X A;  5G4R A;  3IHP A;  5FE9 A;  4BW1 A;  2K1J A;  4I7C A;  4TT2 A;  3ZVZ B;  3UVX A;  4Z1Q A;  4IOR A;  4A9J A;  5CQA A;  5AMF A;  4YYI A;  4CUT A;  5HQ5 A;  5SVI B;  3MDB C;  3S92 A;  3M62 A;  4QSS A;  5KO4 A;  3H7H A;  4TZ2 A;  5DYA A;  2RI7 A;  4HBV A;  4QST A;  2FSA A;  4BW2 A;  5K29 A;  1WUM A;  4TT4 A;  4A9K A;  2JMJ A;  4QQ4 A;  5FEY A;  2F42 A;  4HBX A;  5KH3 A;  5IGK A;  5C8G A;  4O77 A;  1WIM A;  2R0Y A;  4XYA A;  2OWA A;  5JG6 A;  5TBN A;  2LGK A;  4TS8 A;  5CZG A;  2DX8 A;  3O36 A;  2F6N A;  3LQI A;  2JUN A;  2GRC A;  4XUA A;  5AME A;  4BJX A;  1RMD A;  2YVR A;  4X2I A;  5D3H A;  2Y1M A;  5KH9 A;  2ZET C;  5F61 A;  3HCS A;  1G25 A;  5HFR A;  5TDW A;  3IU5 A;  5EPS A;  5I7Y A;  2MIQ A;  1WEO A;  1XWH A;  5EP7 A;  4NRC A;  4WHU A;  5L99 A;  4UIU A;  2OO1 A;  4TZ8 A;  5DKH A;  5F36 A;  2JMD A;  2VJF B;  4LZ2 A;  2R10 A;  1WE9 A;  4FK5 A;  5EYA F;  3PLW A;  4A49 A;  5DYX A;  1Z2Q A;  5FG5 A;  4YAT A;  1JOC A;  4R8P K;  2M3H A;  2D8U A;  5FE8 A;  4V3L C;  3LJU X;  3MXF A;  4O7B A;  3MHS A;  4KV1 A;  4XUB A;  4QEW A;  1WFK A;  3HCT A;  3I3J A;  1WEM A;  5HLS A;  3SVH A;  4QYL A;  5HRX A;  3TLP A;  5ETB A;  3U5N A;  4UP5 A;  2DSM A;  2XB1 A;  2OSS A;  2RS9 B;  3U5J A;  3FEH A;  5FE0 A;  4GPJ A;  3Q1D A;  4AUQ B;  4J0S A;  5EWH A;  2CKL A;  2E61 A;  5D26 A;  5LKX A;  2IDA A;  4MR4 A;  5ENE A;  5II2 A;  5TRB A;  5CTL A;  1MBM A;  1X4U A;  3Q2E A;  1PUO A;  5DFB A;  4QY4 A;  2LSP B;  5FG6 A;  2C2L A;  4P5O B;  1WES A;  1U6G B;  2LGG A;  4UIY A;  2FUI A;  3KV5 A;  5DYU A;  2G6Q A;  4YYG A;  2M1R A;  2L85 A;  2L5U A;  5DX4 A;  4S3O B;  4AVX A;  3RPG C;  5HJC A;  3ASL A;  2MA5 A;  3HMH A;  4IOO A;  4XY8 A;  5LCW B;  2L84 A;  4A9H A;  1VD4 A;  5B79 A;  5A7C A;  5E9L A;  5F2P A;  2IQJ A;  4Z6I A;  4J0R A;  5FB1 A;  5DW2 A;  4YK0 A;  4GNE A;  1E6I A;  4OGJ A;  4QSU A;  2MD7 B;  2RR4 A;  1LDJ B;  5F63 A;  4ZW1 A;  2KR4 A;  3O47 A;  4L58 A;  4R7E A;  3UV2 A;  3JVM A;  5EWC A;  1WIL A;  4GNG A;  4PCI A;  2OXQ C;  4FO9 A;  3UVY A;  3N9N A;  3ERR A;  3O33 A;  3FAO A;  1ZBD B;  2NXB A;  2RNY A;  4AKN A;  5D3T A;  4QC3 A;  4RVR A;  3I2D A;  4I7B A;  4YBT A;  4YAB A;  5K3Q A;  2R0S A;  4OGE A;  4CUR A;  4LLB A;  5C7N A;  5EK9 A;  5HQ6 A;  4QSX A;  4IC3 A;  5CQT A;  4YYJ A;  4N4G A;  5EPR A;  4KCX A;  2K17 A;  5CQ8 A;  2YQD A; 
#chains in the Genus database with same CATH homology
 5IGN A;  5EI4 A;  5E3D A;  4IR3 A;  4QR3 A;  2K16 A;  2YYN A;  3HTK C;  5ENF A;  5I40 A;  1VFY A;  4A9O A;  2KWN A;  4WZ2 A;  2NAA A;  2YEL A;  5F5Z A;  4UIW A;  4WIV A;  5EVA A;  4Z1S A;  5FG4 A;  4UYG A;  5G05 B;  4ZQL A;  3N9M A;  5HRV A;  5F1L A;  3UV5 A;  3N9O A;  4PPE A;  5C13 A;  4CUP A;  2L75 A;  3EB6 A;  4FLP A;  4MEO A;  4UYF B;  5DY7 A;  5E9V A;  1CHC A;  2ECG A;  5E3G A;  4HXS A;  5A5O A;  3HCU A;  4LAD B;  2KU3 A;  1WUG A;  3SVF A;  4FJC A;  5FER A;  4MR3 A;  4A4C A;  2I8N A;  4LC2 A;  5LVR A;  5DLZ A;  5L8U A;  1HYJ A;  5HRW A;  5I89 A;  3P1C A;  2I7K A;  5F62 A;  5E9Y A;  5DW1 A;  5L97 A;  1WEP A;  2WP1 A;  3MB3 A;  4NR9 A;  5D3J A;  5CUC A;  2N9G A;  5COI A;  2VNF A;  4F3I A;  2DAT A;  4PY6 A;  2VJE B;  4HXR A;  4A9I A;  4CFL A;  3T6R A;  4LYS A;  4J3I A;  1Z6U A;  3KNV A;  5H1U A;  2YEM A;  2KTB B;  2RO1 A;  4HXL A;  5ENJ A;  2I50 A;  5C11 A;  2G43 A;  3P1D A;  2YQL A;  5D3P A;  1X0J A;  3MHH A;  5CQ3 A;  3V43 A;  4YY6 A;  5E9I A;  1V87 A;  5I7X A;  1BOR A;  4Q0O A;  2RSD A;  2E7N A;  5FE6 A;  2YDW A;  4AYC A;  4UIX A;  4BHW A;  4C9Z A;  5LKZ A;  4IR5 A;  4ZC9 A;  4QZS A;  4Q6F A;  4A4B A;  4B86 C;  4HBY A;  3LRQ A;  1WEW A;  2KRE A;  4PCE A;  5HQ7 A;  2DKW A;  2WP2 A;  4OUF A;  4YYN A;  2D8S A;  4O7E A;  2EOD A;  4MEN A;  3P1F A;  2VPB A;  5I80 A;  2KGI A;  4X3G A;  3RCW A;  5FH8 A;  4QEV A;  4QEU A;  5KU3 A;  5AIT A;  4YYH A;  4HXP A;  4TTE A;  3NXB A;  3Q2F A;  5EV9 A;  5II1 A;  4A9L A;  2L80 A;  4YAX A;  4GND A;  4MEP A;  5A5P A;  2E6R A;  2ECT A;  5A5N A;  2QJ0 A;  5FFW A;  5CU8 A;  5IG6 A;  5ACY A;  5FH7 A;  5JWM A;  5FFY A;  4NYX A;  1Z60 A;  5ENC A;  2LRI C;  4PTB A;  5CRZ A;  4Z93 A;  3GG3 A;  4YYD A;  5IGL A;  1LDK C;  5E73 A;  3KQI A;  5FFV A;  3N9L A;  3DPL R;  1F62 A;  4NXJ A;  3VK6 A;  2KIZ A;  3L11 A;  5C4Q A;  2LGL A;  2YEK A;  4BW3 A;  5D1K B;  5HFQ A;  1HYI A;  5CS8 A;  5E9K A;  3LXJ A;  1JM4 B;  5F60 A;  2QIC A;  2YT5 A;  5D3L A;  2YW8 A;  1MM2 A;  2MNZ A;  3SHB A;  2YU4 A;  4AYC B;  1JM7 A;  4LDF A;  5CUG A;  1WEQ A;  3O35 A;  4W4U A;  5DIN A;  3G0L A;  4NYV A;  4O7A A;  4N4F A;  5EU1 A;  5G04 B;  4LJN A;  4O78 A;  2Y43 A;  5EM3 A;  4CL9 A;  4S3O C;  5KTU A;  3JVK A;  2YUC A;  5HEL A;  3JVJ A;  3ZYU A;  3SOU A;  2ECJ A;  1WEU A;  4ZDT A;  4OGI A;  5CQ5 A;  5CRM A;  2HDP A;  3M63 A;  4O76 A;  4QR5 A;  4NYW A;  3O37 A;  3T7L A;  3PHD A;  5KTW A;  4NR5 A;  3JVL A;  2KWK A;  1IYM A;  2KWO A;  5E9M A;  2YYR A;  3NG2 A;  4MSX A;  2L5E A;  5EWD A;  5C89 A;  4UIV A;  2ECV A;  1N72 A;  3P1E A;  3KV6 A;  4NR7 A;  4LRG A;  4NQN A;  4TT6 A;  4QNS A;  3EB5 A;  2JMI A;  5TCM A;  5B75 A;  4UIZ A;  1EQF A;  4DON A;  5IGM A;  3DQV R;  5H1T A;  2CKL B;  4O72 A;  4QSR A;  2C2V S;  2D9E A;  4HBW A;  3G0J A;  4L7X A;  5A5S A;  3RTR B;  3SOW A;  2LGV A;  5CFW A;  3O34 A;  4QSQ A;  2DVV A;  2LQ6 A;  2YHO A;  4XI1 A;  4O7C A;  4I7D A;  2DVR A;  4O71 A;  2D82 A;  3AAD A;  4ALH A;  4XY9 A;  5HM0 A;  5CY9 A;  1JSP B;  2MD8 C;  2E6S A;  3ZPV 1;  2H0D A;  4LYI A;  5FDZ A;  3UVD A;  3U5P A;  4WA6 A;  2ECW A;  4UYH A;  5B8D A;  2YW5 A;  4TYL A;  2LXH C;  5D3N A;  3ZTG A;  2F6J A;  2RNX A;  2L0B A;  2PNX A;  4NS5 A;  1WEE A;  5D24 A;  4QB3 A;  5FE2 A;  1ZS5 A;  3L1Z B;  5D3R A;  3SVG A;  3U5K A;  2KGG A;  4GNF A;  2MUM A;  4Y03 A;  4N4H A;  2YSJ A;  3FL2 A;  5CPE A;  5B76 A;  5I29 A;  4QSV A;  4NN2 A;  5BT3 A;  4O70 A;  5CP5 A;  4A0C D;  5I86 A;  2BAY A;  5AD2 A;  5DKA A;  2CT2 A;  4O64 A;  5G4S A;  5TAB A;  2VJF A;  2ECN A;  5A5Q A;  5F25 A;  3LQH A;  2YSM A;  4NR6 A;  3UV4 A;  1FBV A;  5C87 A;  4HXN A;  5J0D A;  2CSZ A;  2HYE D;  2UZG A;  3FKM X;  2RFJ A;  2XEU A;  4QUT A;  4HXK A;  3O70 A;  4BBQ A;  2FUU A;  5EIC A;  2AN6 A;  4WZ0 A;  5D1L B;  3QZV A;  4LR6 A;  5A82 A;  3UW9 A;  3QZT A;  4NRB A;  5D25 A;  4QSW A;  2LV9 A;  5C85 A;  4LK9 A;  2OUO A;  2DVQ A;  2KFT A;  4QYD A;  4NRA A;  5TB6 A;  5HEM A;  4A9E A;  3LQJ A;  4V3K C;  3MQM A;  5JI8 A;  1DVP A;  3C5K A;  5IID A;  3O7A A;  3K2J A;  4KV4 A;  4MR6 A;  5A85 A;  5H85 A;  2H0D B;  4UIT A;  5CQ7 A;  5ENH A;  3ONI A;  3N9P A;  2MNY A;  2YHN A;  4YBM A;  2EGP A;  2LN0 A;  2VPG A;  3N9Q A;  2G4A A;  5CQ6 A;  2YQM A;  4IOQ A;  5B78 A;  4QC1 A;  4UYD A;  4Q0N A;  3PUR A;  4O75 A;  3UVW A;  3ZNI A;  4QUU A;  5A83 A;  2E7O A;  3HME A;  4LYW A;  1X4I A;  4CUQ A;  2E3K A;  4CA1 A;  4A9N A;  4IC2 A;  4UP0 A;  3U5L A;  4QF3 A;  2VPE A;  5H9M A;  3MB4 A;  4YH4 A;  4E96 A;  2LDR A;  5LJ1 A;  2EA6 A;  3MUL A;  4CUS A;  5KTX A;  1WEN A;  2M85 A;  4O74 A;  2M6M A;  2KWJ A;  5FH6 A;  5B77 A;  5D1M B;  1K2F A;  3LJW A;  2RNW A;  5DFC A;  3ZYQ A;  4LKA A;  5LKU A;  4B7Y C;  5KH7 A;  4PS5 A;  5KHM A;  3DAI A;  2H60 A;  3AQA A;  4LZR A;  4WHW A;  1T1H A;  4NQM A;  4NUE A;  5EIS A;  5EGU A;  5HCL A;  5EQ1 A;  3L1X A;  5LJ2 A;  5I1Q A;  2DVS A;  5A5R A;  4TQN A;  5LUU A;  4IR6 A;  4C67 A;  4O7F A;  5CGP A;  4CFK A;  5I88 A;  3RPG B;  2ECI A;  4BW4 A;  4ALG A;  3GV4 A;  5D3S A;  2L43 A;  4QR4 A;  2QIZ A;  5EWV A;  5I83 A;  1F68 A;  4CLB A;  2LXP C;  4N3W A;  5H1V A;  5FE1 A;  1WGM A;  3DWY A;  5EWW A;  3U5M A;  4MR5 A;  3U5O A;  5BT5 A;  4YH3 A;  5ETD A;  4NUD A;  3QZS A;  4UYF A;  3HMF A;  5EPB A;  5DYC A;  5LJ0 A;  5FE5 A;  5ENI A;  4HXM A;  4YYK A;  3MUK A;  2YUR A;  3P5O A;  5FE3 A;  5J3X A;  4NUC A;  4TKP B;  5DBM A;  2DWW A;  4TU4 A;  2G45 A;  5DFD A;  5TDR A;  5I3L A;  4F52 B;  1MM3 A;  4QSP A;  1WEV A;  5AIU A;  3SOX A;  4YAD A;  4C66 A;  5L98 A;  2Y1N A;  2VJE A;  4UI9 B;  4ZUX U;  2MJV B;  3D7C A;  5E74 A;  5D0C A;  2MT5 A;  5G0F A;  1JM7 B;  5L96 A;  5LKT A;  2VPD A;  4GB0 A;  5IBN A;  4IR4 A;  4UYE A;  5EA1 A;  5L8T A;  4MVT A;  1N87 A;  5F1H A;  5E7D A;  5FB0 A;  5HEN A;  2K4D A;  4CCG X;  1E4U A;  3ZVY A;  5AD3 A;  4N4I A;  4YYM A;  2KYU A;  5DKD A;  2CSY A;  3C6W A;  4MEQ A;  4A9M A;  3PUQ A;  5CUE A;  5A81 A;  5ENG A;  3GL6 A;  5CUA A;  2KE1 A;  4J1P A;  4NR8 A;  5CUD A;  5DLX A;  5BT4 A;  4QF2 A;  5FBX A;  4HXO A;  4PKL A;  3S91 A;  1X4J A;  4Z6H A;  2VP7 A;  5LVQ A;  4YY4 A;  5FE7 A;  3IU6 A;  4CUU A;  2R0V A;  4A9F A;  4AP4 A;  2JRJ A;  3M99 A;  5F3A A;  5CQ4 A;  2PUY A;  1VYX A;  3ZPV E;  4QBM A;  2MA6 A;  4FIP A;  4R2Y A;  5ENB A;  4WZ3 B;  2YRE A;  4LZS A;  5FE4 A;  4NR4 A;  4YC9 A;  5E0R A;  4TU6 A;  5DKC A;  4YBS A;  1FP0 A;  5CUB A;  5D7X A;  5G4R A;  3IHP A;  5FE9 A;  4BW1 A;  2K1J A;  4I7C A;  4TT2 A;  3ZVZ B;  3UVX A;  4Z1Q A;  4IOR A;  4A9J A;  5CQA A;  5AMF A;  4YYI A;  4CUT A;  5HQ5 A;  3S92 A;  3M62 A;  4QSS A;  5KO4 A;  4TZ2 A;  5DYA A;  2RI7 A;  4HBV A;  4QST A;  2FSA A;  4BW2 A;  5K29 A;  1WUM A;  4TT4 A;  4A9K A;  2JMJ A;  5FEY A;  2F42 A;  4HBX A;  5KH3 A;  5IGK A;  5C8G A;  4O77 A;  1WIM A;  2R0Y A;  4XYA A;  5JG6 A;  5TBN A;  2LGK A;  4TS8 A;  5CZG A;  2DX8 A;  3O36 A;  2F6N A;  3LQI A;  2GRC A;  4XUA A;  5AME A;  4BJX A;  1RMD A;  4X2I A;  5D3H A;  2Y1M A;  5KH9 A;  2ZET C;  5F61 A;  3HCS A;  1G25 A;  5HFR A;  5TDW A;  3IU5 A;  5EPS A;  5I7Y A;  2MIQ A;  1WEO A;  1XWH A;  5EP7 A;  4NRC A;  4WHU A;  5L99 A;  4UIU A;  2OO1 A;  4TZ8 A;  5DKH A;  5F36 A;  2JMD A;  2VJF B;  4LZ2 A;  2R10 A;  1WE9 A;  4FK5 A;  5EYA F;  4A49 A;  5DYX A;  1Z2Q A;  5FG5 A;  4YAT A;  1JOC A;  4R8P K;  2M3H A;  5FE8 A;  4V3L C;  3MXF A;  4O7B A;  3MHS A;  4KV1 A;  4XUB A;  4QEW A;  1WFK A;  3HCT A;  3I3J A;  1WEM A;  5HLS A;  3SVH A;  4QYL A;  5HRX A;  3TLP A;  5ETB A;  3U5N A;  4UP5 A;  2XB1 A;  2OSS A;  2RS9 B;  3U5J A;  4AUQ B;  5FE0 A;  4GPJ A;  4J0S A;  5EWH A;  2CKL A;  5D26 A;  5LKX A;  2IDA A;  4MR4 A;  5ENE A;  5II2 A;  5TRB A;  5CTL A;  1X4U A;  3Q2E A;  5DFB A;  4QY4 A;  2LSP B;  5FG6 A;  2C2L A;  4P5O B;  1WES A;  1U6G B;  2LGG A;  4UIY A;  2FUI A;  3KV5 A;  5DYU A;  2G6Q A;  4YYG A;  2M1R A;  2L85 A;  2L5U A;  5DX4 A;  4S3O B;  4AVX A;  3RPG C;  5HJC A;  3ASL A;  2MA5 A;  3HMH A;  4IOO A;  4XY8 A;  5LCW B;  2L84 A;  4A9H A;  1VD4 A;  5B79 A;  5A7C A;  5E9L A;  5F2P A;  4Z6I A;  4J0R A;  5FB1 A;  5DW2 A;  4YK0 A;  4GNE A;  1E6I A;  4OGJ A;  4QSU A;  2MD7 B;  1LDJ B;  5F63 A;  4ZW1 A;  2KR4 A;  4L58 A;  4R7E A;  3UV2 A;  3JVM A;  5EWC A;  1WIL A;  4GNG A;  4PCI A;  2OXQ C;  4FO9 A;  3UVY A;  3N9N A;  3O33 A;  1ZBD B;  2NXB A;  2RNY A;  4AKN A;  5D3T A;  4QC3 A;  4RVR A;  3I2D A;  4I7B A;  4YBT A;  4YAB A;  2R0S A;  4CUR A;  4LLB A;  5C7N A;  5EK9 A;  5HQ6 A;  4QSX A;  4IC3 A;  5CQT A;  4YYJ A;  4N4G A;  5EPR A;  4KCX A;  2K17 A;  5CQ8 A;  2YQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...