3RTRB

A ring e3-substrate complex poised for ubiquitin-like protein transfer: structural insights into cullin-ring ligases
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
RFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cullin-1
publication title A RING E3-substrate complex poised for ubiquitin-like protein transfer: structural insights into cullin-RING ligases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 15
structure length 86
sequence length 86
chains with identical sequence D, F, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rtrB00
2LGKA 1WEUA 2F42A 2YSJA 2CT2A 5LCWB 2LV9A 2LXPC 1T1HA 4XI1A 4GNEA 3SHBA 3DQVR 2QICA 4AVXA 5B79A 5TBNA 2F6JA 2QJ0A 2YYRA 4C9ZA 2ECTA 3ZVZB 2YURA 2L0BA 2YW8A 3SOWA 5FERA 3L1ZB 4UI9B 3KQIA 3NG2A 5J3XA 4TKPB 3SOXA 1VFYA 4LLBA 3LQIA 5B75A 4IC3A 4N3WA 2UZGA 2MUMA 2YT5A 3LQHA 4GB0A 1CHCA 3RPGB 3V43A 1JM7B 4FIPA 2AN6A 2LXHC 3MHHA 4B7YC 2C2VS 5FEYA 2FUIA 3M62A 4YAXA 3HCSA 5LKXA 4LK9A 1X4IA 1WEOA 4L58A 4FK5A 2JMDA 2KWKA 2CSZA 1FBVA 3N9NA 2EGPA 1JOCA 2VP7A 3GL6A 2VJFA 2MA6A 5D1KB 2BAYA 3N9PA 4FO9A 2ECGA 2NAAA 3PHDA 4L7XA 2K17A 5I3LA 2KYUA 2CSYA 4A0CD 5KH7A 4FJCA 3U5MA 1RMDA 4X3GA 4BBQA 4I7BA 1DVPA 4W4UA 2LQ6A 4YBSA 3C6WA 2FSAA 2VPGA 2XEUA 3N9QA 3PURA 5TDRA 3LQJA 2I50A 2M6MA 2YSMA 2YUCA 4PPEA 4ZUXU 4BHWA 2VJEA 4I7CA 5DKAA 3KV5A 2YHOA 4Q6FA 2KGIA 1VYXA 2LN0A 2KGGA 3HCTA 2IDAA 2RSDA 1V87A 5H1TA 3O7AA 5AITA 4WZ0A 1X4JA 2EODA 4A4BA 3N9OA 2ECWA 4YC9A 5DINA 3O70A 1WENA 2KU3A 3VK6A 4S3OC 4B86C 3IHPA 4QF3A 2K16A 5D1LB 2G6QA 1F62A 3ZYQA 2KE1A 1G25A 2YHNA 2E6SA 2L80A 2M1RA 3I2DA 3RPGC 4AYCB 2L5UA 3T7LA 2OXQC 4YADA 1JM7A 2LDRA 2L43A 5G04B 3ZPVE 5FB1A 5LKZA 3QZVA 2KWOA 5C13A 4GNFA 3LRQA 4GNDA 4WZ3B 3KNVA 4AYCA 2ECIA 5FB0A 2XB1A 4N4FA 2RI7A 4PTBA 4R8PK 1WE9A 4MSXA 2YREA 1WESA 1Z2QA 2FUUA 2MT5A 3HTKC 1VD4A 4V3LC 5JG6A 2YU4A 4GNGA 2CKLB 1Z60A 2M85A 2MD7B 2VPBA 3O35A 4YATA 5H9MA 3ZTGA 5B78A 4F52B 5G0FA 4LKAA 4ZDTA 1WIMA 1HYIA 2HYED 2CKLA 1K2FA 3MHSA 4MVTA 2KWNA 2MNYA 3O34A 5B8DA 3T6RA 2HDPA 2PNXA 2ECVA 4UP5A 3O33A 2Y1NA 5TABA 1E4UA 3EB6A 5TRBA 2K4DA 2C2LA 1ZBDB 2KIZA 2JMIA 5KH9A 4CCGX 2YQMA 4YBTA 1WILA 5LKTA 4WZ2A 1WEPA 4NN2A 1LDJB 2VPEA 3ASLA 2Y43A 2D8SA 2LRIC 4P5OB 3EB5A 4O64A 4S3OB 5H1UA 2G45A 4UP0A 5AIUA 3C5KA 4A49A 1FP0A 4YABA 1WEQA 2LGGA 1WEVA 3M99A 2ECNA 4LADB 1LDKC 4AP4A 2KFTA 1WEMA 2G43A 2JMJA 1U6GB 4YBMA 1WFKA 3ZVYA 2QIZA 3L11A 4A4CA 2LGVA 2ECJA 3U5PA 1HYJA 5EYAF 3FL2A 4I7DA 5KH3A 2JRJA 2ZETC 1WEWA 2YQLA 4LJNA 2VNFA 3N9MA 2MIQA 2E6RA 3DPLR 3KV6A 2PUYA 3M63A 2VJFB 4CA1A 3HCUA 1WEEA 1Z6UA 3ZNIA 3O37A 5C11A 4WA6A 2H0DB 2F6NA 4ZQLA 5B76A 3N9LA 1N87A 5D1MB 2M3HA 2LGLA 3U5OA 2MA5A 2MNZA 2Y1MA 3RTRB 2H0DA 1X4UA 4IC2A 4R2YA 3SOUA 2DX8A 1IYMA 2K1JA 1BORA 1XWHA 5TDWA 4AUQB 4V3KC 4R7EA 3U5NA 3ZPV1 1WGMA 2VJEB 2L75A 1MM3A 5LKUA 2VPDA 4QF2A 2KWJA 5H1VA 3O36A 3GV4A 5G05B 3PUQA 5B77A 1MM2A 2EA6A 3L1XA 2MD8C 2KREA 2KR4A
chains in the Genus database with same CATH superfamily
2LGKA 2B0OE 1WEUA 2F42A 2YSJA 2CT2A 5LCWB 3KDEC 2LAUA 2LV9A 2LXPC 1T1HA 4XI1A 4GNEA 3SHBA 3DQVR 2QICA 4AVXA 5B79A 5TBNA 2F6JA 2QJ0A 2OWAA 2YYRA 4C9ZA 2ECTA 3ZVZB 2YURA 2L0BA 2YW8A 3SOWA 5FERA 3L1ZB 4UI9B 3KQIA 3NG2A 5J3XA 4TKPB 3SOXA 1VFYA 4LLBA 3LQIA 5B75A 4IC3A 4N3WA 2KKXA 2UZGA 2MUMA 2YT5A 3LQHA 4GB0A 1CHCA 3RPGB 3V43A 1JM7B 2D8UA 4FIPA 2AN6A 2LXHC 3MHHA 4B7YC 2C2VS 5FEYA 2FUIA 3M62A 4YAXA 3HCSA 5LKXA 4LK9A 2MKEA 1X4IA 1WEOA 4L58A 4F1PA 5K3QA 4FK5A 2YVRA 2JMDA 2KWKA 2CSZA 1FBVA 2CSVA 3N9NA 2EGPA 1JOCA 2VP7A 3GL6A 2VJFA 2MA6A 5D1KB 2BAYA 3N9PA 4FO9A 2ECGA 2NAAA 3LVRE 3PHDA 4L7XA 2K17A 3LJUX 5I3LA 2KYUA 2CSYA 4A0CD 5KH7A 3FEHA 4FJCA 3O47A 3U5MA 1RMDA 4X3GA 4BBQA 4H9DA 4I7BA 1DVPA 2FFWA 4W4UA 2LQ6A 4YBSA 3C6WA 2FSAA 2VPGA 2XEUA 3MDBC 3N9QA 3PURA 5TDRA 3T9KA 3LQJA 2I50A 2M6MA 2YSMA 2YUCA 4PPEA 4ZUXU 3LDYA 4BHWA 1DCQA 2VJEA 4I7CA 5DKAA 5SVIB 3KV5A 2YHOA 2XP0A 4Q6FA 2KGIA 1VYXA 2CRWA 2KGGA 2LN0A 3HCTA 4Z0OA 2IDAA 2RSDA 1V87A 5H1TA 3O7AA 5AITA 4Z0RA 3Q1DA 4WZ0A 1X4JA 2EODA 4A4BA 3N9OA 2ECWA 4YC9A 5DINA 3O70A 2CONA 3FANA 1WENA 2KU3A 2RR4A 3VK6A 4S3OC 4B86C 3IHPA 4QF3A 2K16A 5D1LB 2G6QA 1F62A 3ZYQA 2KE1A 1G25A 2YHNA 2DSMA 2E6SA 2L80A 2M1RA 2JUNA 3I2DA 3RPGC 4AYCB 2L5UA 3T7LA 2OXQC 4YADA 1JM7A 2LDRA 2L43A 5G04B 3ZPVE 5FB1A 5LKZA 3QZVA 2KWOA 5C13A 4GNFA 3LRQA 4GNDA 4WZ3B 3DWDA 3KNVA 2ECIA 4AYCA 5FB0A 2XOZA 2XB1A 2L7PA 4N4FA 2RI7A 4PTBA 4R8PK 1WE9A 4MSXA 2DJAA 2YREA 1WESA 1Z2QA 2FUUA 2MT5A 3HTKC 1VD4A 4V3LC 5JG6A 2YU4A 4GNGA 2CKLB 1Z60A 2M85A 2MD7B 2VPBA 3O35A 4YATA 5H9MA 3ZTGA 5B78A 4F52B 5G0FA 4LKAA 4ZDTA 1WIMA 1HYIA 2HYED 2CKLA 1K2FA 3MHSA 4MVTA 2KWNA 2MNYA 2M13A 3O34A 5B8DA 3T6RA 2HDPA 3LVQE 2PNXA 2ECVA 4UP5A 3O33A 3DDTA 2Y1NA 5TABA 2FD4A 1E4UA 4OGEA 3EB6A 5TRBA 2K4DA 5SVIA 2C2LA 1ZBDB 2KIZA 2JMIA 5KH9A 4CCGX 2YQMA 2E61A 4YBTA 1WILA 5LKTA 2IQJA 4WZ2A 1WEPA 4NN2A 1LDJB 2VPEA 3ASLA 2Y43A 2D8SA 2LRIC 4P5OB 3EB5A 4O64A 4S3OB 5H1UA 2G45A 4UP0A 5AIUA 3C5KA 4A49A 1FP0A 4YABA 2CRRA 1WEQA 2LGGA 1WEVA 3M99A 2ECNA 4LADB 5SVXA 1LDKC 4AP4A 2KFTA 1WEMA 2G43A 2JMJA 1U6GB 4YBMA 2KKYA 2XOCA 1WFKA 3JUEA 2QIZA 3ZVYA 3L11A 4A4CA 2P57A 2LGVA 2ECJA 3U5PA 1HYJA 5EYAF 3FL2A 4I7DA 5KH3A 2JRJA 2ZETC 4O62A 2EGMA 1WEWA 2YQLA 4LJNA 3SUBA 2VNFA 3N9MA 2EXUA 2MIQA 2E6RA 3DPLR 3KV6A 2PUYA 3M63A 2VJFB 4CA1A 3HCUA 1WEEA 1Z6UA 3ZNIA 3FM8C 3O37A 5C11A 4WA6A 2H0DB 4QQ4A 2F6NA 4ZQLA 5B76A 3N9LA 1N87A 2XOYA 5D1MB 2M3HA 2LGLA 3PLWA 3U5OA 2MA5A 2MNZA 2Y1MA 3RTRB 2H0DA 1MBMA 1X4UA 4IC2A 4R2YA 3SOUA 2DX8A 1IYMA 2K1JA 3FJUB 4OGCA 1BORA 1XWHA 3E2DA 3FAOA 5TDWA 4AUQB 4V3KC 4R7EA 3U5NA 3ZPV1 1WGMA 2VJEB 2L75A 5SVYA 1MM3A 5LKUA 2VPDA 4QF2A 2KWJA 5H1VA 3O36A 3GV4A 5G05B 2JM3A 3PUQA 5B77A 1MM2A 2EA6A 3H7HA 3L1XA 2MD8C 3M7KA 2KREA 2KR4A
chains in the Genus database with same CATH topology
2LGKA 1WEUA 2F42A 2YSJA 2CT2A 5LCWB 2LV9A 2LXPC 1T1HA 4XI1A 4GNEA 3SHBA 3DQVR 2QICA 4AVXA 5B79A 5TBNA 2F6JA 2QJ0A 2YYRA 4C9ZA 2ECTA 3ZVZB 2YURA 2L0BA 2YW8A 3SOWA 5FERA 3L1ZB 4UI9B 3KQIA 3NG2A 5J3XA 4TKPB 3SOXA 1VFYA 4LLBA 3LQIA 5B75A 4IC3A 4N3WA 2UZGA 2MUMA 2YT5A 3LQHA 4GB0A 1CHCA 3RPGB 3V43A 1JM7B 4FIPA 2AN6A 2LXHC 3MHHA 4B7YC 2C2VS 5FEYA 2FUIA 3M62A 4YAXA 3HCSA 5LKXA 4LK9A 1X4IA 1WEOA 4L58A 4FK5A 2JMDA 2KWKA 2CSZA 1FBVA 3N9NA 2EGPA 1JOCA 2VP7A 3GL6A 2VJFA 2MA6A 5D1KB 2BAYA 3N9PA 4FO9A 2ECGA 2NAAA 3PHDA 4L7XA 2K17A 5I3LA 2KYUA 2CSYA 4A0CD 5KH7A 4FJCA 3U5MA 1RMDA 4X3GA 4BBQA 4I7BA 1DVPA 4W4UA 2LQ6A 4YBSA 3C6WA 2FSAA 2VPGA 2XEUA 3N9QA 3PURA 5TDRA 3LQJA 2I50A 2M6MA 2YSMA 2YUCA 4PPEA 4ZUXU 4BHWA 2VJEA 4I7CA 5DKAA 3KV5A 2YHOA 4Q6FA 2KGIA 1VYXA 2LN0A 2KGGA 3HCTA 2IDAA 2RSDA 1V87A 5H1TA 3O7AA 5AITA 4WZ0A 1X4JA 2EODA 4A4BA 3N9OA 2ECWA 4YC9A 5DINA 3O70A 1WENA 2KU3A 3VK6A 4S3OC 4B86C 3IHPA 4QF3A 2K16A 5D1LB 2G6QA 1F62A 3ZYQA 2KE1A 1G25A 2YHNA 2E6SA 2L80A 2M1RA 3I2DA 3RPGC 4AYCB 2L5UA 3T7LA 2OXQC 4YADA 1JM7A 2LDRA 2L43A 5G04B 3ZPVE 5FB1A 5LKZA 3QZVA 2KWOA 5C13A 4GNFA 3LRQA 4GNDA 4WZ3B 3KNVA 4AYCA 2ECIA 5FB0A 2XB1A 4N4FA 2RI7A 4PTBA 4R8PK 1WE9A 4MSXA 2YREA 1WESA 1Z2QA 2FUUA 2MT5A 3HTKC 1VD4A 4V3LC 5JG6A 2YU4A 4GNGA 2CKLB 1Z60A 2M85A 2MD7B 2VPBA 3O35A 4YATA 5H9MA 3ZTGA 5B78A 4F52B 5G0FA 4LKAA 4ZDTA 1WIMA 1HYIA 2HYED 2CKLA 1K2FA 3MHSA 4MVTA 2KWNA 2MNYA 3O34A 5B8DA 3T6RA 2HDPA 2PNXA 2ECVA 4UP5A 3O33A 2Y1NA 5TABA 1E4UA 3EB6A 5TRBA 2K4DA 2C2LA 1ZBDB 2KIZA 2JMIA 5KH9A 4CCGX 2YQMA 4YBTA 1WILA 5LKTA 4WZ2A 1WEPA 4NN2A 1LDJB 2VPEA 3ASLA 2Y43A 2D8SA 2LRIC 4P5OB 3EB5A 4O64A 4S3OB 5H1UA 2G45A 4UP0A 5AIUA 3C5KA 4A49A 1FP0A 4YABA 1WEQA 2LGGA 1WEVA 3M99A 2ECNA 4LADB 1LDKC 4AP4A 2KFTA 1WEMA 2G43A 2JMJA 1U6GB 4YBMA 1WFKA 3ZVYA 2QIZA 3L11A 4A4CA 2LGVA 2ECJA 3U5PA 1HYJA 5EYAF 3FL2A 4I7DA 5KH3A 2JRJA 2ZETC 1WEWA 2YQLA 4LJNA 2VNFA 3N9MA 2MIQA 2E6RA 3DPLR 3KV6A 2PUYA 3M63A 2VJFB 4CA1A 3HCUA 1WEEA 1Z6UA 3ZNIA 3O37A 5C11A 4WA6A 2H0DB 2F6NA 4ZQLA 5B76A 3N9LA 1N87A 5D1MB 2M3HA 2LGLA 3U5OA 2MA5A 2MNZA 2Y1MA 3RTRB 2H0DA 1X4UA 4IC2A 4R2YA 3SOUA 2DX8A 1IYMA 2K1JA 1BORA 1XWHA 5TDWA 4AUQB 4V3KC 4R7EA 3U5NA 3ZPV1 1WGMA 2VJEB 2L75A 1MM3A 5LKUA 2VPDA 4QF2A 2KWJA 5H1VA 3O36A 3GV4A 5G05B 3PUQA 5B77A 1MM2A 2EA6A 3L1XA 2MD8C 2KREA 2KR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGK A;  1WEU A;  2F42 A;  2YSJ A;  2CT2 A;  5LCW B;  2LV9 A;  2LXP C;  1T1H A;  4XI1 A;  4GNE A;  3SHB A;  3DQV R;  2QIC A;  4AVX A;  5B79 A;  5TBN A;  2F6J A;  2QJ0 A;  2YYR A;  4C9Z A;  2ECT A;  3ZVZ B;  2YUR A;  2L0B A;  2YW8 A;  3SOW A;  5FER A;  3L1Z B;  4UI9 B;  3KQI A;  3NG2 A;  5J3X A;  4TKP B;  3SOX A;  1VFY A;  4LLB A;  3LQI A;  5B75 A;  4IC3 A;  4N3W A;  2UZG A;  2MUM A;  2YT5 A;  3LQH A;  4GB0 A;  1CHC A;  3RPG B;  3V43 A;  1JM7 B;  4FIP A;  2AN6 A;  2LXH C;  3MHH A;  4B7Y C;  2C2V S;  5FEY A;  2FUI A;  3M62 A;  4YAX A;  3HCS A;  5LKX A;  4LK9 A;  1X4I A;  1WEO A;  4L58 A;  4FK5 A;  2JMD A;  2KWK A;  2CSZ A;  1FBV A;  3N9N A;  2EGP A;  1JOC A;  2VP7 A;  3GL6 A;  2VJF A;  2MA6 A;  5D1K B;  2BAY A;  3N9P A;  4FO9 A;  2ECG A;  2NAA A;  3PHD A;  4L7X A;  2K17 A;  5I3L A;  2KYU A;  2CSY A;  4A0C D;  5KH7 A;  4FJC A;  3U5M A;  1RMD A;  4X3G A;  4BBQ A;  4I7B A;  1DVP A;  4W4U A;  2LQ6 A;  4YBS A;  3C6W A;  2FSA A;  2VPG A;  2XEU A;  3N9Q A;  3PUR A;  5TDR A;  3LQJ A;  2I50 A;  2M6M A;  2YSM A;  2YUC A;  4PPE A;  4ZUX U;  4BHW A;  2VJE A;  4I7C A;  5DKA A;  3KV5 A;  2YHO A;  4Q6F A;  2KGI A;  1VYX A;  2LN0 A;  2KGG A;  3HCT A;  2IDA A;  2RSD A;  1V87 A;  5H1T A;  3O7A A;  5AIT A;  4WZ0 A;  1X4J A;  2EOD A;  4A4B A;  3N9O A;  2ECW A;  4YC9 A;  5DIN A;  3O70 A;  1WEN A;  2KU3 A;  3VK6 A;  4S3O C;  4B86 C;  3IHP A;  4QF3 A;  2K16 A;  5D1L B;  2G6Q A;  1F62 A;  3ZYQ A;  2KE1 A;  1G25 A;  2YHN A;  2E6S A;  2L80 A;  2M1R A;  3I2D A;  3RPG C;  4AYC B;  2L5U A;  3T7L A;  2OXQ C;  4YAD A;  1JM7 A;  2LDR A;  2L43 A;  5G04 B;  3ZPV E;  5FB1 A;  5LKZ A;  3QZV A;  2KWO A;  5C13 A;  4GNF A;  3LRQ A;  4GND A;  4WZ3 B;  3KNV A;  4AYC A;  2ECI A;  5FB0 A;  2XB1 A;  4N4F A;  2RI7 A;  4PTB A;  4R8P K;  1WE9 A;  4MSX A;  2YRE A;  1WES A;  1Z2Q A;  2FUU A;  2MT5 A;  3HTK C;  1VD4 A;  4V3L C;  5JG6 A;  2YU4 A;  4GNG A;  2CKL B;  1Z60 A;  2M85 A;  2MD7 B;  2VPB A;  3O35 A;  4YAT A;  5H9M A;  3ZTG A;  5B78 A;  4F52 B;  5G0F A;  4LKA A;  4ZDT A;  1WIM A;  1HYI A;  2HYE D;  2CKL A;  1K2F A;  3MHS A;  4MVT A;  2KWN A;  2MNY A;  3O34 A;  5B8D A;  3T6R A;  2HDP A;  2PNX A;  2ECV A;  4UP5 A;  3O33 A;  2Y1N A;  5TAB A;  1E4U A;  3EB6 A;  5TRB A;  2K4D A;  2C2L A;  1ZBD B;  2KIZ A;  2JMI A;  5KH9 A;  4CCG X;  2YQM A;  4YBT A;  1WIL A;  5LKT A;  4WZ2 A;  1WEP A;  4NN2 A;  1LDJ B;  2VPE A;  3ASL A;  2Y43 A;  2D8S A;  2LRI C;  4P5O B;  3EB5 A;  4O64 A;  4S3O B;  5H1U A;  2G45 A;  4UP0 A;  5AIU A;  3C5K A;  4A49 A;  1FP0 A;  4YAB A;  1WEQ A;  2LGG A;  1WEV A;  3M99 A;  2ECN A;  4LAD B;  1LDK C;  4AP4 A;  2KFT A;  1WEM A;  2G43 A;  2JMJ A;  1U6G B;  4YBM A;  1WFK A;  3ZVY A;  2QIZ A;  3L11 A;  4A4C A;  2LGV A;  2ECJ A;  3U5P A;  1HYJ A;  5EYA F;  3FL2 A;  4I7D A;  5KH3 A;  2JRJ A;  2ZET C;  1WEW A;  2YQL A;  4LJN A;  2VNF A;  3N9M A;  2MIQ A;  2E6R A;  3DPL R;  3KV6 A;  2PUY A;  3M63 A;  2VJF B;  4CA1 A;  3HCU A;  1WEE A;  1Z6U A;  3ZNI A;  3O37 A;  5C11 A;  4WA6 A;  2H0D B;  2F6N A;  4ZQL A;  5B76 A;  3N9L A;  1N87 A;  5D1M B;  2M3H A;  2LGL A;  3U5O A;  2MA5 A;  2MNZ A;  2Y1M A;  3RTR B;  2H0D A;  1X4U A;  4IC2 A;  4R2Y A;  3SOU A;  2DX8 A;  1IYM A;  2K1J A;  1BOR A;  1XWH A;  5TDW A;  4AUQ B;  4V3K C;  4R7E A;  3U5N A;  3ZPV 1;  1WGM A;  2VJE B;  2L75 A;  1MM3 A;  5LKU A;  2VPD A;  4QF2 A;  2KWJ A;  5H1V A;  3O36 A;  3GV4 A;  5G05 B;  3PUQ A;  5B77 A;  1MM2 A;  2EA6 A;  3L1X A;  2MD8 C;  2KRE A;  2KR4 A; 
#chains in the Genus database with same CATH topology
 2LGK A;  2B0O E;  1WEU A;  2F42 A;  2YSJ A;  2CT2 A;  5LCW B;  3KDE C;  2LAU A;  2LV9 A;  2LXP C;  1T1H A;  4XI1 A;  4GNE A;  3SHB A;  3DQV R;  2QIC A;  4AVX A;  5B79 A;  5TBN A;  2F6J A;  2QJ0 A;  2OWA A;  2YYR A;  4C9Z A;  2ECT A;  3ZVZ B;  2YUR A;  2L0B A;  2YW8 A;  3SOW A;  5FER A;  3L1Z B;  4UI9 B;  3KQI A;  3NG2 A;  5J3X A;  4TKP B;  3SOX A;  1VFY A;  4LLB A;  3LQI A;  5B75 A;  4IC3 A;  4N3W A;  2KKX A;  2UZG A;  2MUM A;  2YT5 A;  3LQH A;  4GB0 A;  1CHC A;  3RPG B;  3V43 A;  1JM7 B;  2D8U A;  4FIP A;  2AN6 A;  2LXH C;  3MHH A;  4B7Y C;  2C2V S;  5FEY A;  2FUI A;  3M62 A;  4YAX A;  3HCS A;  5LKX A;  4LK9 A;  2MKE A;  1X4I A;  1WEO A;  4L58 A;  4F1P A;  5K3Q A;  4FK5 A;  2YVR A;  2JMD A;  2KWK A;  2CSZ A;  1FBV A;  2CSV A;  3N9N A;  2EGP A;  1JOC A;  2VP7 A;  3GL6 A;  2VJF A;  2MA6 A;  5D1K B;  2BAY A;  3N9P A;  4FO9 A;  2ECG A;  2NAA A;  3LVR E;  3PHD A;  4L7X A;  2K17 A;  3LJU X;  5I3L A;  2KYU A;  2CSY A;  4A0C D;  5KH7 A;  3FEH A;  4FJC A;  3O47 A;  3U5M A;  1RMD A;  4X3G A;  4BBQ A;  4H9D A;  4I7B A;  1DVP A;  2FFW A;  4W4U A;  2LQ6 A;  4YBS A;  3C6W A;  2FSA A;  2VPG A;  2XEU A;  3MDB C;  3N9Q A;  3PUR A;  5TDR A;  3T9K A;  3LQJ A;  2I50 A;  2M6M A;  2YSM A;  2YUC A;  4PPE A;  4ZUX U;  3LDY A;  4BHW A;  1DCQ A;  2VJE A;  4I7C A;  5DKA A;  5SVI B;  3KV5 A;  2YHO A;  2XP0 A;  4Q6F A;  2KGI A;  1VYX A;  2CRW A;  2KGG A;  2LN0 A;  3HCT A;  4Z0O A;  2IDA A;  2RSD A;  1V87 A;  5H1T A;  3O7A A;  5AIT A;  4Z0R A;  3Q1D A;  4WZ0 A;  1X4J A;  2EOD A;  4A4B A;  3N9O A;  2ECW A;  4YC9 A;  5DIN A;  3O70 A;  2CON A;  3FAN A;  1WEN A;  2KU3 A;  2RR4 A;  3VK6 A;  4S3O C;  4B86 C;  3IHP A;  4QF3 A;  2K16 A;  5D1L B;  2G6Q A;  1F62 A;  3ZYQ A;  2KE1 A;  1G25 A;  2YHN A;  2DSM A;  2E6S A;  2L80 A;  2M1R A;  2JUN A;  3I2D A;  3RPG C;  4AYC B;  2L5U A;  3T7L A;  2OXQ C;  4YAD A;  1JM7 A;  2LDR A;  2L43 A;  5G04 B;  3ZPV E;  5FB1 A;  5LKZ A;  3QZV A;  2KWO A;  5C13 A;  4GNF A;  3LRQ A;  4GND A;  4WZ3 B;  3DWD A;  3KNV A;  2ECI A;  4AYC A;  5FB0 A;  2XOZ A;  2XB1 A;  2L7P A;  4N4F A;  2RI7 A;  4PTB A;  4R8P K;  1WE9 A;  4MSX A;  2DJA A;  2YRE A;  1WES A;  1Z2Q A;  2FUU A;  2MT5 A;  3HTK C;  1VD4 A;  4V3L C;  5JG6 A;  2YU4 A;  4GNG A;  2CKL B;  1Z60 A;  2M85 A;  2MD7 B;  2VPB A;  3O35 A;  4YAT A;  5H9M A;  3ZTG A;  5B78 A;  4F52 B;  5G0F A;  4LKA A;  4ZDT A;  1WIM A;  1HYI A;  2HYE D;  2CKL A;  1K2F A;  3MHS A;  4MVT A;  2KWN A;  2MNY A;  2M13 A;  3O34 A;  5B8D A;  3T6R A;  2HDP A;  3LVQ E;  2PNX A;  2ECV A;  4UP5 A;  3O33 A;  3DDT A;  2Y1N A;  5TAB A;  2FD4 A;  1E4U A;  4OGE A;  3EB6 A;  5TRB A;  2K4D A;  5SVI A;  2C2L A;  1ZBD B;  2KIZ A;  2JMI A;  5KH9 A;  4CCG X;  2YQM A;  2E61 A;  4YBT A;  1WIL A;  5LKT A;  2IQJ A;  4WZ2 A;  1WEP A;  4NN2 A;  1LDJ B;  2VPE A;  3ASL A;  2Y43 A;  2D8S A;  2LRI C;  4P5O B;  3EB5 A;  4O64 A;  4S3O B;  5H1U A;  2G45 A;  4UP0 A;  5AIU A;  3C5K A;  4A49 A;  1FP0 A;  4YAB A;  2CRR A;  1WEQ A;  2LGG A;  1WEV A;  3M99 A;  2ECN A;  4LAD B;  5SVX A;  1LDK C;  4AP4 A;  2KFT A;  1WEM A;  2G43 A;  2JMJ A;  1U6G B;  4YBM A;  2KKY A;  2XOC A;  1WFK A;  3JUE A;  2QIZ A;  3ZVY A;  3L11 A;  4A4C A;  2P57 A;  2LGV A;  2ECJ A;  3U5P A;  1HYJ A;  5EYA F;  3FL2 A;  4I7D A;  5KH3 A;  2JRJ A;  2ZET C;  4O62 A;  2EGM A;  1WEW A;  2YQL A;  4LJN A;  3SUB A;  2VNF A;  3N9M A;  2EXU A;  2MIQ A;  2E6R A;  3DPL R;  3KV6 A;  2PUY A;  3M63 A;  2VJF B;  4CA1 A;  3HCU A;  1WEE A;  1Z6U A;  3ZNI A;  3FM8 C;  3O37 A;  5C11 A;  4WA6 A;  2H0D B;  4QQ4 A;  2F6N A;  4ZQL A;  5B76 A;  3N9L A;  1N87 A;  2XOY A;  5D1M B;  2M3H A;  2LGL A;  3PLW A;  3U5O A;  2MA5 A;  2MNZ A;  2Y1M A;  3RTR B;  2H0D A;  1MBM A;  1X4U A;  4IC2 A;  4R2Y A;  3SOU A;  2DX8 A;  1IYM A;  2K1J A;  3FJU B;  4OGC A;  1BOR A;  1XWH A;  3E2D A;  3FAO A;  5TDW A;  4AUQ B;  4V3K C;  4R7E A;  3U5N A;  3ZPV 1;  1WGM A;  2VJE B;  2L75 A;  5SVY A;  1MM3 A;  5LKU A;  2VPD A;  4QF2 A;  2KWJ A;  5H1V A;  3O36 A;  3GV4 A;  5G05 B;  2JM3 A;  3PUQ A;  5B77 A;  1MM2 A;  2EA6 A;  3H7H A;  3L1X A;  2MD8 C;  3M7K A;  2KRE A;  2KR4 A; 
#chains in the Genus database with same CATH homology
 2LGK A;  1WEU A;  2F42 A;  2YSJ A;  2CT2 A;  5LCW B;  2LV9 A;  2LXP C;  1T1H A;  4XI1 A;  4GNE A;  3SHB A;  3DQV R;  2QIC A;  4AVX A;  5B79 A;  5TBN A;  2F6J A;  2QJ0 A;  2YYR A;  4C9Z A;  2ECT A;  3ZVZ B;  2YUR A;  2L0B A;  2YW8 A;  3SOW A;  5FER A;  3L1Z B;  4UI9 B;  3KQI A;  3NG2 A;  5J3X A;  4TKP B;  3SOX A;  1VFY A;  4LLB A;  3LQI A;  5B75 A;  4IC3 A;  4N3W A;  2UZG A;  2MUM A;  2YT5 A;  3LQH A;  4GB0 A;  1CHC A;  3RPG B;  3V43 A;  1JM7 B;  4FIP A;  2AN6 A;  2LXH C;  3MHH A;  4B7Y C;  2C2V S;  5FEY A;  2FUI A;  3M62 A;  4YAX A;  3HCS A;  5LKX A;  4LK9 A;  1X4I A;  1WEO A;  4L58 A;  4FK5 A;  2JMD A;  2KWK A;  2CSZ A;  1FBV A;  3N9N A;  2EGP A;  1JOC A;  2VP7 A;  3GL6 A;  2VJF A;  2MA6 A;  5D1K B;  2BAY A;  3N9P A;  4FO9 A;  2ECG A;  2NAA A;  3PHD A;  4L7X A;  2K17 A;  5I3L A;  2KYU A;  2CSY A;  4A0C D;  5KH7 A;  4FJC A;  3U5M A;  1RMD A;  4X3G A;  4BBQ A;  4I7B A;  1DVP A;  4W4U A;  2LQ6 A;  4YBS A;  3C6W A;  2FSA A;  2VPG A;  2XEU A;  3N9Q A;  3PUR A;  5TDR A;  3LQJ A;  2I50 A;  2M6M A;  2YSM A;  2YUC A;  4PPE A;  4ZUX U;  4BHW A;  2VJE A;  4I7C A;  5DKA A;  3KV5 A;  2YHO A;  4Q6F A;  2KGI A;  1VYX A;  2LN0 A;  2KGG A;  3HCT A;  2IDA A;  2RSD A;  1V87 A;  5H1T A;  3O7A A;  5AIT A;  4WZ0 A;  1X4J A;  2EOD A;  4A4B A;  3N9O A;  2ECW A;  4YC9 A;  5DIN A;  3O70 A;  1WEN A;  2KU3 A;  3VK6 A;  4S3O C;  4B86 C;  3IHP A;  4QF3 A;  2K16 A;  5D1L B;  2G6Q A;  1F62 A;  3ZYQ A;  2KE1 A;  1G25 A;  2YHN A;  2E6S A;  2L80 A;  2M1R A;  3I2D A;  3RPG C;  4AYC B;  2L5U A;  3T7L A;  2OXQ C;  4YAD A;  1JM7 A;  2LDR A;  2L43 A;  5G04 B;  3ZPV E;  5FB1 A;  5LKZ A;  3QZV A;  2KWO A;  5C13 A;  4GNF A;  3LRQ A;  4GND A;  4WZ3 B;  3KNV A;  4AYC A;  2ECI A;  5FB0 A;  2XB1 A;  4N4F A;  2RI7 A;  4PTB A;  4R8P K;  1WE9 A;  4MSX A;  2YRE A;  1WES A;  1Z2Q A;  2FUU A;  2MT5 A;  3HTK C;  1VD4 A;  4V3L C;  5JG6 A;  2YU4 A;  4GNG A;  2CKL B;  1Z60 A;  2M85 A;  2MD7 B;  2VPB A;  3O35 A;  4YAT A;  5H9M A;  3ZTG A;  5B78 A;  4F52 B;  5G0F A;  4LKA A;  4ZDT A;  1WIM A;  1HYI A;  2HYE D;  2CKL A;  1K2F A;  3MHS A;  4MVT A;  2KWN A;  2MNY A;  3O34 A;  5B8D A;  3T6R A;  2HDP A;  2PNX A;  2ECV A;  4UP5 A;  3O33 A;  2Y1N A;  5TAB A;  1E4U A;  3EB6 A;  5TRB A;  2K4D A;  2C2L A;  1ZBD B;  2KIZ A;  2JMI A;  5KH9 A;  4CCG X;  2YQM A;  4YBT A;  1WIL A;  5LKT A;  4WZ2 A;  1WEP A;  4NN2 A;  1LDJ B;  2VPE A;  3ASL A;  2Y43 A;  2D8S A;  2LRI C;  4P5O B;  3EB5 A;  4O64 A;  4S3O B;  5H1U A;  2G45 A;  4UP0 A;  5AIU A;  3C5K A;  4A49 A;  1FP0 A;  4YAB A;  1WEQ A;  2LGG A;  1WEV A;  3M99 A;  2ECN A;  4LAD B;  1LDK C;  4AP4 A;  2KFT A;  1WEM A;  2G43 A;  2JMJ A;  1U6G B;  4YBM A;  1WFK A;  3ZVY A;  2QIZ A;  3L11 A;  4A4C A;  2LGV A;  2ECJ A;  3U5P A;  1HYJ A;  5EYA F;  3FL2 A;  4I7D A;  5KH3 A;  2JRJ A;  2ZET C;  1WEW A;  2YQL A;  4LJN A;  2VNF A;  3N9M A;  2MIQ A;  2E6R A;  3DPL R;  3KV6 A;  2PUY A;  3M63 A;  2VJF B;  4CA1 A;  3HCU A;  1WEE A;  1Z6U A;  3ZNI A;  3O37 A;  5C11 A;  4WA6 A;  2H0D B;  2F6N A;  4ZQL A;  5B76 A;  3N9L A;  1N87 A;  5D1M B;  2M3H A;  2LGL A;  3U5O A;  2MA5 A;  2MNZ A;  2Y1M A;  3RTR B;  2H0D A;  1X4U A;  4IC2 A;  4R2Y A;  3SOU A;  2DX8 A;  1IYM A;  2K1J A;  1BOR A;  1XWH A;  5TDW A;  4AUQ B;  4V3K C;  4R7E A;  3U5N A;  3ZPV 1;  1WGM A;  2VJE B;  2L75 A;  1MM3 A;  5LKU A;  2VPD A;  4QF2 A;  2KWJ A;  5H1V A;  3O36 A;  3GV4 A;  5G05 B;  3PUQ A;  5B77 A;  1MM2 A;  2EA6 A;  3L1X A;  2MD8 C;  2KRE A;  2KR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...