3RTRB

A ring e3-substrate complex poised for ubiquitin-like protein transfer: structural insights into cullin-ring ligases
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
RFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Cullin-1
publication title A RING E3-substrate complex poised for ubiquitin-like protein transfer: structural insights into cullin-RING ligases.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 86
sequence length 86
chains with identical sequence D, F, H
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12678 zf-rbx1 RING-H2 zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3rtrB00
2RI7A 5TBNA 2PUYA 5FEYA 2KWKA 1RMDA 4A0CD 1DVPA 5LKZA 3ZTGA 2XB1A 1WEEA 3O33A 2C2VS 1VYXA 2YW8A 3PUQA 4YBMA 3O36A 3HTKC 3LRQA 4R7EA 2CKLB 5KH7A 5D1LB 4QF2A 3ASLA 4BBQA 2VPEA 2LDRA 3LQJA 3N9PA 3V43A 2KGGA 2KYUA 4FIPA 4FJCA 5C11A 4LJNA 4YATA 2ECNA 3SOUA 3MHSA 5TDWA 1Z2QA 5G0FA 3SOXA 4FO9A 1WESA 2KWJA 3O7AA 3U5PA 1IYMA 2F6NA 3N9QA 1CHCA 5B78A 2E6RA 3M63A 3DQVR 5TDRA 2BAYA 4L58A 4QF3A 3ZVZB 2JRJA 1X4JA 3C5KA 2VNFA 2YU4A 5C13A 2MIQA 2HYED 5LCWB 2YSMA 2K16A 2YSJA 1K2FA 2H0DB 4N3WA 2ECTA 4AVXA 4O64A 2M3HA 5J3XA 4X3GA 3KNVA 2E6SA 3N9NA 2L5UA 2LGGA 2C2LA 2VPGA 5G04B 4UP0A 2K17A 4WZ0A 3L1ZB 3FL2A 1LDKC 2K4DA 4WA6A 4YABA 1N87A 5H1UA 3HCTA 1Z60A 1WEVA 2G6QA 5LKTA 2EGPA 2FSAA 2YQMA 1WFKA 5LKXA 4N4FA 4Q6FA 1F62A 3L11A 4P5OB 3VK6A 1LDJB 4CA1A 2ECIA 1WIMA 2KGIA 5D1MB 4R8PK 2DX8A 2L80A 1JOCA 2F42A 5I3LA 4GNGA 3I2DA 4V3LC 1BORA 4LLBA 4FK5A 2LV9A 2LGVA 4A4CA 5B75A 4B7YC 2M1RA 3M99A 3U5OA 3U5NA 4C9ZA 3N9LA 2ECGA 2MD8C 3ZYQA 1E4UA 1WENA 1WE9A 1T1HA 1WEOA 4CCGX 2H0DA 3ZPVE 1MM2A 4YAXA 2NAAA 2Y1NA 3M62A 1WEWA 2LRIC 2CSYA 4AUQB 1X4UA 5H1TA 5EYAF 4AYCB 4LADB 2Y43A 4UP5A 5FERA 4TKPB 2JMIA 1JM7B 4I7CA 3N9MA 5B76A 2LN0A 4A49A 2KE1A 2KR4A 2VJEB 2MNYA 4UI9B 3GV4A 2ECWA 5D1KB 2FUUA 4NN2A 4GNDA 2XEUA 2KREA 5H9MA 2LGLA 4YBSA 1HYJA 4I7BA 4MSXA 2JMJA 3LQIA 5KH9A 5G05B 3DPLR 2OXQC 4ZDTA 2QIZA 3EB6A 1WEMA 2EA6A 5JG6A 3O37A 5AITA 5DKAA 2MA6A 2K1JA 3ZVYA 2AN6A 2KWNA 1WGMA 3NG2A 2MUMA 1VFYA 3KV6A 4YBTA 3U5MA 4ZUXU 1Z6UA 2VP7A 1WILA 2CT2A 2M6MA 3O70A 3T6RA 2L75A 5B79A 4W4UA 4GNEA 2KU3A 2YHNA 4XI1A 4WZ2A 3O35A 2MNZA 4S3OC 5KH3A 2VPDA 2EODA 1HYIA 2ECJA 4LKAA 1V87A 4GNFA 2CSZA 3C6WA 4IC3A 2YUCA 2QJ0A 3HCUA 1VD4A 4IC2A 3ZPV1 4AYCA 4AP4A 2LGKA 4GB0A 4B86C 5TABA 1JM7A 2D8SA 3SOWA 4S3OB 4YC9A 5TRBA 5LKUA 1G25A 3IHPA 2VPBA 2IDAA 2VJEA 2MT5A 2YREA 4F52B 5AIUA 2UZGA 2VJFB 2YURA 1WEPA 4L7XA 2G45A 2FUIA 5DINA 3RTRB 4R2YA 5FB0A 2LXHC 2KIZA 3MHHA 3O34A 1ZBDB 3LQHA 2I50A 2RSDA 4BHWA 3GL6A 1WEQA 5H1VA 4I7DA 1FBVA 2JMDA 5B77A 3PURA 3PHDA 1FP0A 2LXPC 2MA5A 4PTBA 2ZETC 1XWHA 4PPEA 1X4IA 1MM3A 5FB1A 2YT5A 3T7LA 2YYRA 4LK9A 2PNXA 2G43A 2YQLA 3RPGC 3KQIA 4V3KC 3HCSA 2YHOA 4A4BA 5B8DA 3ZNIA 2KFTA 2LQ6A 2M85A 2HDPA 3KV5A 4YADA 4MVTA 2Y1MA 3EB5A 1U6GB 3RPGB 2KWOA 2CKLA 2QICA 4ZQLA 3SHBA 3L1XA 3N9OA 4WZ3B 2L43A 2MD7B 3QZVA 2L0BA 2VJFA 1WEUA 2F6JA 2ECVA
chains in the Genus database with same CATH superfamily
2RI7A 5TBNA 2PUYA 5FEYA 2KWKA 1RMDA 4A0CD 1DVPA 5LKZA 3ZTGA 2CSVA 2XB1A 1WEEA 3O33A 2C2VS 2LAUA 1VYXA 2YW8A 3PUQA 4YBMA 3O36A 3HTKC 3LRQA 4R7EA 2CKLB 5KH7A 5D1LB 4QF2A 3ASLA 4BBQA 2VPEA 2LDRA 3LQJA 3N9PA 3V43A 2KGGA 2KYUA 3DDTA 5SVYA 4FIPA 4FJCA 5C11A 4LJNA 4YATA 2ECNA 3SOUA 3MHSA 5TDWA 5SVIB 1Z2QA 5G0FA 2M13A 3SOXA 4FO9A 1WESA 2KWJA 3O7AA 4Z0OA 3U5PA 1IYMA 2F6NA 3N9QA 1CHCA 5B78A 2E6RA 3M63A 3DQVR 5TDRA 2OWAA 2BAYA 4L58A 4QF3A 3ZVZB 2JRJA 1X4JA 3C5KA 2VNFA 2YU4A 5C13A 3FEHA 2MIQA 2HYED 5LCWB 3T9KA 2YSMA 2K16A 2YSJA 3LVRE 1K2FA 2H0DB 4OGEA 4N3WA 2ECTA 4AVXA 4O64A 2M3HA 5J3XA 4X3GA 3KNVA 3DWDA 2E6SA 3FM8C 3N9NA 2L5UA 2LGGA 2C2LA 2VPGA 5G04B 4O62A 4UP0A 2K17A 4WZ0A 3L1ZB 3FL2A 1LDKC 2K4DA 4WA6A 2CRWA 4YABA 1N87A 5H1UA 3HCTA 1Z60A 1WEVA 2G6QA 5LKTA 2EGPA 2FSAA 2YQMA 3Q1DA 1WFKA 5LKXA 2EXUA 4N4FA 2XOCA 4Q6FA 1F62A 3L11A 4P5OB 3VK6A 3FAOA 1LDJB 4CA1A 2ECIA 2EGMA 2CONA 1WIMA 5SVIA 2KGIA 5D1MB 4R8PK 2DX8A 2L80A 1JOCA 2F42A 5I3LA 4GNGA 3I2DA 4V3LC 1BORA 4LLBA 4FK5A 2LV9A 2LGVA 2L7PA 4A4CA 5B75A 4B7YC 2M1RA 1DCQA 3M99A 3U5OA 3U5NA 4C9ZA 2XOZA 3O47A 3N9LA 2ECGA 2MD8C 3KDEC 3ZYQA 1E4UA 1WENA 1WE9A 1T1HA 3SUBA 1WEOA 4CCGX 2H0DA 3ZPVE 2RR4A 1MM2A 4YAXA 2NAAA 2IQJA 2Y1NA 3M62A 5SVXA 2D8UA 1WEWA 2LRIC 2CSYA 4AUQB 1X4UA 5H1TA 3M7KA 5EYAF 4AYCB 4LADB 2Y43A 4UP5A 5FERA 4TKPB 2JMIA 1JM7B 4I7CA 3N9MA 5B76A 2LN0A 4A49A 2KE1A 2KR4A 2VJEB 2MNYA 4UI9B 3GV4A 2ECWA 3FANA 2JUNA 5D1KB 2FUUA 2B0OE 4NN2A 4GNDA 2XEUA 1MBMA 2KREA 5H9MA 2LGLA 4YBSA 1HYJA 4I7BA 4MSXA 2JMJA 3LQIA 5KH9A 5G05B 3DPLR 2OXQC 4ZDTA 2QIZA 3EB6A 1WEMA 2DJAA 2EA6A 5JG6A 3O37A 5AITA 5DKAA 3LDYA 2FD4A 2MA6A 2K1JA 3ZVYA 3E2DA 2AN6A 2KWNA 1WGMA 3NG2A 2MUMA 1VFYA 3KV6A 4YBTA 3U5MA 4ZUXU 1Z6UA 2VP7A 1WILA 2CT2A 2M6MA 3O70A 5K3QA 3T6RA 2L75A 5B79A 4W4UA 4GNEA 2KU3A 2YHNA 4XI1A 2KKXA 4WZ2A 3O35A 2MNZA 4S3OC 5KH3A 2VPDA 2EODA 1HYIA 2ECJA 4LKAA 1V87A 4GNFA 2CSZA 3C6WA 4H9DA 4IC3A 2YUCA 2P57A 2QJ0A 3HCUA 1VD4A 4IC2A 3ZPV1 4AYCA 4AP4A 2XP0A 2E61A 2LGKA 4GB0A 4B86C 5TABA 4Z0RA 1JM7A 2D8SA 3SOWA 4S3OB 4YC9A 5TRBA 5LKUA 1G25A 2MKEA 3H7HA 3IHPA 2VPBA 2IDAA 2VJEA 2MT5A 3JUEA 2YREA 4F52B 5AIUA 2UZGA 2VJFB 3MDBC 2YURA 1WEPA 4L7XA 2G45A 2DSMA 2FUIA 5DINA 3FJUB 3RTRB 2FFWA 4R2YA 5FB0A 2LXHC 2KIZA 2XOYA 3MHHA 3O34A 1ZBDB 3LQHA 2I50A 2RSDA 4OGCA 2CRRA 4BHWA 3GL6A 1WEQA 5H1VA 4I7DA 1FBVA 2JMDA 5B77A 3PURA 3PHDA 1FP0A 2LXPC 2MA5A 4PTBA 2ZETC 1XWHA 4PPEA 1X4IA 1MM3A 5FB1A 2YT5A 3T7LA 2YYRA 4LK9A 4QQ4A 2JM3A 3LVQE 2PNXA 2G43A 2YQLA 4F1PA 3RPGC 3KQIA 4V3KC 3HCSA 2YHOA 4A4BA 5B8DA 3ZNIA 2KFTA 2LQ6A 2M85A 2HDPA 3KV5A 4YADA 2KKYA 4MVTA 2YVRA 2Y1MA 3PLWA 3EB5A 1U6GB 3RPGB 2KWOA 2CKLA 2QICA 4ZQLA 3SHBA 3L1XA 3N9OA 4WZ3B 2L43A 2MD7B 3QZVA 2L0BA 2VJFA 1WEUA 3LJUX 2F6JA 2ECVA
chains in the Genus database with same CATH topology
2RI7A 5TBNA 2PUYA 5FEYA 2KWKA 1RMDA 4A0CD 1DVPA 5LKZA 3ZTGA 2XB1A 1WEEA 3O33A 2C2VS 1VYXA 2YW8A 3PUQA 4YBMA 3O36A 3HTKC 3LRQA 4R7EA 2CKLB 5KH7A 5D1LB 4QF2A 3ASLA 4BBQA 2VPEA 2LDRA 3LQJA 3N9PA 3V43A 2KGGA 2KYUA 4FIPA 4FJCA 5C11A 4LJNA 4YATA 2ECNA 3SOUA 3MHSA 5TDWA 1Z2QA 5G0FA 3SOXA 4FO9A 1WESA 2KWJA 3O7AA 3U5PA 1IYMA 2F6NA 3N9QA 1CHCA 5B78A 2E6RA 3M63A 3DQVR 5TDRA 2BAYA 4L58A 4QF3A 3ZVZB 2JRJA 1X4JA 3C5KA 2VNFA 2YU4A 5C13A 2MIQA 2HYED 5LCWB 2YSMA 2K16A 2YSJA 1K2FA 2H0DB 4N3WA 2ECTA 4AVXA 4O64A 2M3HA 5J3XA 4X3GA 3KNVA 2E6SA 3N9NA 2L5UA 2LGGA 2C2LA 2VPGA 5G04B 4UP0A 2K17A 4WZ0A 3L1ZB 3FL2A 1LDKC 2K4DA 4WA6A 4YABA 1N87A 5H1UA 3HCTA 1Z60A 1WEVA 2G6QA 5LKTA 2EGPA 2FSAA 2YQMA 1WFKA 5LKXA 4N4FA 4Q6FA 1F62A 3L11A 4P5OB 3VK6A 1LDJB 4CA1A 2ECIA 1WIMA 2KGIA 5D1MB 4R8PK 2DX8A 2L80A 1JOCA 2F42A 5I3LA 4GNGA 3I2DA 4V3LC 1BORA 4LLBA 4FK5A 2LV9A 2LGVA 4A4CA 5B75A 4B7YC 2M1RA 3M99A 3U5OA 3U5NA 4C9ZA 3N9LA 2ECGA 2MD8C 3ZYQA 1E4UA 1WENA 1WE9A 1T1HA 1WEOA 4CCGX 2H0DA 3ZPVE 1MM2A 4YAXA 2NAAA 2Y1NA 3M62A 1WEWA 2LRIC 2CSYA 4AUQB 1X4UA 5H1TA 5EYAF 4AYCB 4LADB 2Y43A 4UP5A 5FERA 4TKPB 2JMIA 1JM7B 4I7CA 3N9MA 5B76A 2LN0A 4A49A 2KE1A 2KR4A 2VJEB 2MNYA 4UI9B 3GV4A 2ECWA 5D1KB 2FUUA 4NN2A 4GNDA 2XEUA 2KREA 5H9MA 2LGLA 4YBSA 1HYJA 4I7BA 4MSXA 2JMJA 3LQIA 5KH9A 5G05B 3DPLR 2OXQC 4ZDTA 2QIZA 3EB6A 1WEMA 2EA6A 5JG6A 3O37A 5AITA 5DKAA 2MA6A 2K1JA 3ZVYA 2AN6A 2KWNA 1WGMA 3NG2A 2MUMA 1VFYA 3KV6A 4YBTA 3U5MA 4ZUXU 1Z6UA 2VP7A 1WILA 2CT2A 2M6MA 3O70A 3T6RA 2L75A 5B79A 4W4UA 4GNEA 2KU3A 2YHNA 4XI1A 4WZ2A 3O35A 2MNZA 4S3OC 5KH3A 2VPDA 2EODA 1HYIA 2ECJA 4LKAA 1V87A 4GNFA 2CSZA 3C6WA 4IC3A 2YUCA 2QJ0A 3HCUA 1VD4A 4IC2A 3ZPV1 4AYCA 4AP4A 2LGKA 4GB0A 4B86C 5TABA 1JM7A 2D8SA 3SOWA 4S3OB 4YC9A 5TRBA 5LKUA 1G25A 3IHPA 2VPBA 2IDAA 2VJEA 2MT5A 2YREA 4F52B 5AIUA 2UZGA 2VJFB 2YURA 1WEPA 4L7XA 2G45A 2FUIA 5DINA 3RTRB 4R2YA 5FB0A 2LXHC 2KIZA 3MHHA 3O34A 1ZBDB 3LQHA 2I50A 2RSDA 4BHWA 3GL6A 1WEQA 5H1VA 4I7DA 1FBVA 2JMDA 5B77A 3PURA 3PHDA 1FP0A 2LXPC 2MA5A 4PTBA 2ZETC 1XWHA 4PPEA 1X4IA 1MM3A 5FB1A 2YT5A 3T7LA 2YYRA 4LK9A 2PNXA 2G43A 2YQLA 3RPGC 3KQIA 4V3KC 3HCSA 2YHOA 4A4BA 5B8DA 3ZNIA 2KFTA 2LQ6A 2M85A 2HDPA 3KV5A 4YADA 4MVTA 2Y1MA 3EB5A 1U6GB 3RPGB 2KWOA 2CKLA 2QICA 4ZQLA 3SHBA 3L1XA 3N9OA 4WZ3B 2L43A 2MD7B 3QZVA 2L0BA 2VJFA 1WEUA 2F6JA 2ECVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI7 A;  5TBN A;  2PUY A;  5FEY A;  2KWK A;  1RMD A;  4A0C D;  1DVP A;  5LKZ A;  3ZTG A;  2XB1 A;  1WEE A;  3O33 A;  2C2V S;  1VYX A;  2YW8 A;  3PUQ A;  4YBM A;  3O36 A;  3HTK C;  3LRQ A;  4R7E A;  2CKL B;  5KH7 A;  5D1L B;  4QF2 A;  3ASL A;  4BBQ A;  2VPE A;  2LDR A;  3LQJ A;  3N9P A;  3V43 A;  2KGG A;  2KYU A;  4FIP A;  4FJC A;  5C11 A;  4LJN A;  4YAT A;  2ECN A;  3SOU A;  3MHS A;  5TDW A;  1Z2Q A;  5G0F A;  3SOX A;  4FO9 A;  1WES A;  2KWJ A;  3O7A A;  3U5P A;  1IYM A;  2F6N A;  3N9Q A;  1CHC A;  5B78 A;  2E6R A;  3M63 A;  3DQV R;  5TDR A;  2BAY A;  4L58 A;  4QF3 A;  3ZVZ B;  2JRJ A;  1X4J A;  3C5K A;  2VNF A;  2YU4 A;  5C13 A;  2MIQ A;  2HYE D;  5LCW B;  2YSM A;  2K16 A;  2YSJ A;  1K2F A;  2H0D B;  4N3W A;  2ECT A;  4AVX A;  4O64 A;  2M3H A;  5J3X A;  4X3G A;  3KNV A;  2E6S A;  3N9N A;  2L5U A;  2LGG A;  2C2L A;  2VPG A;  5G04 B;  4UP0 A;  2K17 A;  4WZ0 A;  3L1Z B;  3FL2 A;  1LDK C;  2K4D A;  4WA6 A;  4YAB A;  1N87 A;  5H1U A;  3HCT A;  1Z60 A;  1WEV A;  2G6Q A;  5LKT A;  2EGP A;  2FSA A;  2YQM A;  1WFK A;  5LKX A;  4N4F A;  4Q6F A;  1F62 A;  3L11 A;  4P5O B;  3VK6 A;  1LDJ B;  4CA1 A;  2ECI A;  1WIM A;  2KGI A;  5D1M B;  4R8P K;  2DX8 A;  2L80 A;  1JOC A;  2F42 A;  5I3L A;  4GNG A;  3I2D A;  4V3L C;  1BOR A;  4LLB A;  4FK5 A;  2LV9 A;  2LGV A;  4A4C A;  5B75 A;  4B7Y C;  2M1R A;  3M99 A;  3U5O A;  3U5N A;  4C9Z A;  3N9L A;  2ECG A;  2MD8 C;  3ZYQ A;  1E4U A;  1WEN A;  1WE9 A;  1T1H A;  1WEO A;  4CCG X;  2H0D A;  3ZPV E;  1MM2 A;  4YAX A;  2NAA A;  2Y1N A;  3M62 A;  1WEW A;  2LRI C;  2CSY A;  4AUQ B;  1X4U A;  5H1T A;  5EYA F;  4AYC B;  4LAD B;  2Y43 A;  4UP5 A;  5FER A;  4TKP B;  2JMI A;  1JM7 B;  4I7C A;  3N9M A;  5B76 A;  2LN0 A;  4A49 A;  2KE1 A;  2KR4 A;  2VJE B;  2MNY A;  4UI9 B;  3GV4 A;  2ECW A;  5D1K B;  2FUU A;  4NN2 A;  4GND A;  2XEU A;  2KRE A;  5H9M A;  2LGL A;  4YBS A;  1HYJ A;  4I7B A;  4MSX A;  2JMJ A;  3LQI A;  5KH9 A;  5G05 B;  3DPL R;  2OXQ C;  4ZDT A;  2QIZ A;  3EB6 A;  1WEM A;  2EA6 A;  5JG6 A;  3O37 A;  5AIT A;  5DKA A;  2MA6 A;  2K1J A;  3ZVY A;  2AN6 A;  2KWN A;  1WGM A;  3NG2 A;  2MUM A;  1VFY A;  3KV6 A;  4YBT A;  3U5M A;  4ZUX U;  1Z6U A;  2VP7 A;  1WIL A;  2CT2 A;  2M6M A;  3O70 A;  3T6R A;  2L75 A;  5B79 A;  4W4U A;  4GNE A;  2KU3 A;  2YHN A;  4XI1 A;  4WZ2 A;  3O35 A;  2MNZ A;  4S3O C;  5KH3 A;  2VPD A;  2EOD A;  1HYI A;  2ECJ A;  4LKA A;  1V87 A;  4GNF A;  2CSZ A;  3C6W A;  4IC3 A;  2YUC A;  2QJ0 A;  3HCU A;  1VD4 A;  4IC2 A;  3ZPV 1;  4AYC A;  4AP4 A;  2LGK A;  4GB0 A;  4B86 C;  5TAB A;  1JM7 A;  2D8S A;  3SOW A;  4S3O B;  4YC9 A;  5TRB A;  5LKU A;  1G25 A;  3IHP A;  2VPB A;  2IDA A;  2VJE A;  2MT5 A;  2YRE A;  4F52 B;  5AIU A;  2UZG A;  2VJF B;  2YUR A;  1WEP A;  4L7X A;  2G45 A;  2FUI A;  5DIN A;  3RTR B;  4R2Y A;  5FB0 A;  2LXH C;  2KIZ A;  3MHH A;  3O34 A;  1ZBD B;  3LQH A;  2I50 A;  2RSD A;  4BHW A;  3GL6 A;  1WEQ A;  5H1V A;  4I7D A;  1FBV A;  2JMD A;  5B77 A;  3PUR A;  3PHD A;  1FP0 A;  2LXP C;  2MA5 A;  4PTB A;  2ZET C;  1XWH A;  4PPE A;  1X4I A;  1MM3 A;  5FB1 A;  2YT5 A;  3T7L A;  2YYR A;  4LK9 A;  2PNX A;  2G43 A;  2YQL A;  3RPG C;  3KQI A;  4V3K C;  3HCS A;  2YHO A;  4A4B A;  5B8D A;  3ZNI A;  2KFT A;  2LQ6 A;  2M85 A;  2HDP A;  3KV5 A;  4YAD A;  4MVT A;  2Y1M A;  3EB5 A;  1U6G B;  3RPG B;  2KWO A;  2CKL A;  2QIC A;  4ZQL A;  3SHB A;  3L1X A;  3N9O A;  4WZ3 B;  2L43 A;  2MD7 B;  3QZV A;  2L0B A;  2VJF A;  1WEU A;  2F6J A;  2ECV A; 
#chains in the Genus database with same CATH topology
 2RI7 A;  5TBN A;  2PUY A;  5FEY A;  2KWK A;  1RMD A;  4A0C D;  1DVP A;  5LKZ A;  3ZTG A;  2CSV A;  2XB1 A;  1WEE A;  3O33 A;  2C2V S;  2LAU A;  1VYX A;  2YW8 A;  3PUQ A;  4YBM A;  3O36 A;  3HTK C;  3LRQ A;  4R7E A;  2CKL B;  5KH7 A;  5D1L B;  4QF2 A;  3ASL A;  4BBQ A;  2VPE A;  2LDR A;  3LQJ A;  3N9P A;  3V43 A;  2KGG A;  2KYU A;  3DDT A;  5SVY A;  4FIP A;  4FJC A;  5C11 A;  4LJN A;  4YAT A;  2ECN A;  3SOU A;  3MHS A;  5TDW A;  5SVI B;  1Z2Q A;  5G0F A;  2M13 A;  3SOX A;  4FO9 A;  1WES A;  2KWJ A;  3O7A A;  4Z0O A;  3U5P A;  1IYM A;  2F6N A;  3N9Q A;  1CHC A;  5B78 A;  2E6R A;  3M63 A;  3DQV R;  5TDR A;  2OWA A;  2BAY A;  4L58 A;  4QF3 A;  3ZVZ B;  2JRJ A;  1X4J A;  3C5K A;  2VNF A;  2YU4 A;  5C13 A;  3FEH A;  2MIQ A;  2HYE D;  5LCW B;  3T9K A;  2YSM A;  2K16 A;  2YSJ A;  3LVR E;  1K2F A;  2H0D B;  4OGE A;  4N3W A;  2ECT A;  4AVX A;  4O64 A;  2M3H A;  5J3X A;  4X3G A;  3KNV A;  3DWD A;  2E6S A;  3FM8 C;  3N9N A;  2L5U A;  2LGG A;  2C2L A;  2VPG A;  5G04 B;  4O62 A;  4UP0 A;  2K17 A;  4WZ0 A;  3L1Z B;  3FL2 A;  1LDK C;  2K4D A;  4WA6 A;  2CRW A;  4YAB A;  1N87 A;  5H1U A;  3HCT A;  1Z60 A;  1WEV A;  2G6Q A;  5LKT A;  2EGP A;  2FSA A;  2YQM A;  3Q1D A;  1WFK A;  5LKX A;  2EXU A;  4N4F A;  2XOC A;  4Q6F A;  1F62 A;  3L11 A;  4P5O B;  3VK6 A;  3FAO A;  1LDJ B;  4CA1 A;  2ECI A;  2EGM A;  2CON A;  1WIM A;  5SVI A;  2KGI A;  5D1M B;  4R8P K;  2DX8 A;  2L80 A;  1JOC A;  2F42 A;  5I3L A;  4GNG A;  3I2D A;  4V3L C;  1BOR A;  4LLB A;  4FK5 A;  2LV9 A;  2LGV A;  2L7P A;  4A4C A;  5B75 A;  4B7Y C;  2M1R A;  1DCQ A;  3M99 A;  3U5O A;  3U5N A;  4C9Z A;  2XOZ A;  3O47 A;  3N9L A;  2ECG A;  2MD8 C;  3KDE C;  3ZYQ A;  1E4U A;  1WEN A;  1WE9 A;  1T1H A;  3SUB A;  1WEO A;  4CCG X;  2H0D A;  3ZPV E;  2RR4 A;  1MM2 A;  4YAX A;  2NAA A;  2IQJ A;  2Y1N A;  3M62 A;  5SVX A;  2D8U A;  1WEW A;  2LRI C;  2CSY A;  4AUQ B;  1X4U A;  5H1T A;  3M7K A;  5EYA F;  4AYC B;  4LAD B;  2Y43 A;  4UP5 A;  5FER A;  4TKP B;  2JMI A;  1JM7 B;  4I7C A;  3N9M A;  5B76 A;  2LN0 A;  4A49 A;  2KE1 A;  2KR4 A;  2VJE B;  2MNY A;  4UI9 B;  3GV4 A;  2ECW A;  3FAN A;  2JUN A;  5D1K B;  2FUU A;  2B0O E;  4NN2 A;  4GND A;  2XEU A;  1MBM A;  2KRE A;  5H9M A;  2LGL A;  4YBS A;  1HYJ A;  4I7B A;  4MSX A;  2JMJ A;  3LQI A;  5KH9 A;  5G05 B;  3DPL R;  2OXQ C;  4ZDT A;  2QIZ A;  3EB6 A;  1WEM A;  2DJA A;  2EA6 A;  5JG6 A;  3O37 A;  5AIT A;  5DKA A;  3LDY A;  2FD4 A;  2MA6 A;  2K1J A;  3ZVY A;  3E2D A;  2AN6 A;  2KWN A;  1WGM A;  3NG2 A;  2MUM A;  1VFY A;  3KV6 A;  4YBT A;  3U5M A;  4ZUX U;  1Z6U A;  2VP7 A;  1WIL A;  2CT2 A;  2M6M A;  3O70 A;  5K3Q A;  3T6R A;  2L75 A;  5B79 A;  4W4U A;  4GNE A;  2KU3 A;  2YHN A;  4XI1 A;  2KKX A;  4WZ2 A;  3O35 A;  2MNZ A;  4S3O C;  5KH3 A;  2VPD A;  2EOD A;  1HYI A;  2ECJ A;  4LKA A;  1V87 A;  4GNF A;  2CSZ A;  3C6W A;  4H9D A;  4IC3 A;  2YUC A;  2P57 A;  2QJ0 A;  3HCU A;  1VD4 A;  4IC2 A;  3ZPV 1;  4AYC A;  4AP4 A;  2XP0 A;  2E61 A;  2LGK A;  4GB0 A;  4B86 C;  5TAB A;  4Z0R A;  1JM7 A;  2D8S A;  3SOW A;  4S3O B;  4YC9 A;  5TRB A;  5LKU A;  1G25 A;  2MKE A;  3H7H A;  3IHP A;  2VPB A;  2IDA A;  2VJE A;  2MT5 A;  3JUE A;  2YRE A;  4F52 B;  5AIU A;  2UZG A;  2VJF B;  3MDB C;  2YUR A;  1WEP A;  4L7X A;  2G45 A;  2DSM A;  2FUI A;  5DIN A;  3FJU B;  3RTR B;  2FFW A;  4R2Y A;  5FB0 A;  2LXH C;  2KIZ A;  2XOY A;  3MHH A;  3O34 A;  1ZBD B;  3LQH A;  2I50 A;  2RSD A;  4OGC A;  2CRR A;  4BHW A;  3GL6 A;  1WEQ A;  5H1V A;  4I7D A;  1FBV A;  2JMD A;  5B77 A;  3PUR A;  3PHD A;  1FP0 A;  2LXP C;  2MA5 A;  4PTB A;  2ZET C;  1XWH A;  4PPE A;  1X4I A;  1MM3 A;  5FB1 A;  2YT5 A;  3T7L A;  2YYR A;  4LK9 A;  4QQ4 A;  2JM3 A;  3LVQ E;  2PNX A;  2G43 A;  2YQL A;  4F1P A;  3RPG C;  3KQI A;  4V3K C;  3HCS A;  2YHO A;  4A4B A;  5B8D A;  3ZNI A;  2KFT A;  2LQ6 A;  2M85 A;  2HDP A;  3KV5 A;  4YAD A;  2KKY A;  4MVT A;  2YVR A;  2Y1M A;  3PLW A;  3EB5 A;  1U6G B;  3RPG B;  2KWO A;  2CKL A;  2QIC A;  4ZQL A;  3SHB A;  3L1X A;  3N9O A;  4WZ3 B;  2L43 A;  2MD7 B;  3QZV A;  2L0B A;  2VJF A;  1WEU A;  3LJU X;  2F6J A;  2ECV A; 
#chains in the Genus database with same CATH homology
 2RI7 A;  5TBN A;  2PUY A;  5FEY A;  2KWK A;  1RMD A;  4A0C D;  1DVP A;  5LKZ A;  3ZTG A;  2XB1 A;  1WEE A;  3O33 A;  2C2V S;  1VYX A;  2YW8 A;  3PUQ A;  4YBM A;  3O36 A;  3HTK C;  3LRQ A;  4R7E A;  2CKL B;  5KH7 A;  5D1L B;  4QF2 A;  3ASL A;  4BBQ A;  2VPE A;  2LDR A;  3LQJ A;  3N9P A;  3V43 A;  2KGG A;  2KYU A;  4FIP A;  4FJC A;  5C11 A;  4LJN A;  4YAT A;  2ECN A;  3SOU A;  3MHS A;  5TDW A;  1Z2Q A;  5G0F A;  3SOX A;  4FO9 A;  1WES A;  2KWJ A;  3O7A A;  3U5P A;  1IYM A;  2F6N A;  3N9Q A;  1CHC A;  5B78 A;  2E6R A;  3M63 A;  3DQV R;  5TDR A;  2BAY A;  4L58 A;  4QF3 A;  3ZVZ B;  2JRJ A;  1X4J A;  3C5K A;  2VNF A;  2YU4 A;  5C13 A;  2MIQ A;  2HYE D;  5LCW B;  2YSM A;  2K16 A;  2YSJ A;  1K2F A;  2H0D B;  4N3W A;  2ECT A;  4AVX A;  4O64 A;  2M3H A;  5J3X A;  4X3G A;  3KNV A;  2E6S A;  3N9N A;  2L5U A;  2LGG A;  2C2L A;  2VPG A;  5G04 B;  4UP0 A;  2K17 A;  4WZ0 A;  3L1Z B;  3FL2 A;  1LDK C;  2K4D A;  4WA6 A;  4YAB A;  1N87 A;  5H1U A;  3HCT A;  1Z60 A;  1WEV A;  2G6Q A;  5LKT A;  2EGP A;  2FSA A;  2YQM A;  1WFK A;  5LKX A;  4N4F A;  4Q6F A;  1F62 A;  3L11 A;  4P5O B;  3VK6 A;  1LDJ B;  4CA1 A;  2ECI A;  1WIM A;  2KGI A;  5D1M B;  4R8P K;  2DX8 A;  2L80 A;  1JOC A;  2F42 A;  5I3L A;  4GNG A;  3I2D A;  4V3L C;  1BOR A;  4LLB A;  4FK5 A;  2LV9 A;  2LGV A;  4A4C A;  5B75 A;  4B7Y C;  2M1R A;  3M99 A;  3U5O A;  3U5N A;  4C9Z A;  3N9L A;  2ECG A;  2MD8 C;  3ZYQ A;  1E4U A;  1WEN A;  1WE9 A;  1T1H A;  1WEO A;  4CCG X;  2H0D A;  3ZPV E;  1MM2 A;  4YAX A;  2NAA A;  2Y1N A;  3M62 A;  1WEW A;  2LRI C;  2CSY A;  4AUQ B;  1X4U A;  5H1T A;  5EYA F;  4AYC B;  4LAD B;  2Y43 A;  4UP5 A;  5FER A;  4TKP B;  2JMI A;  1JM7 B;  4I7C A;  3N9M A;  5B76 A;  2LN0 A;  4A49 A;  2KE1 A;  2KR4 A;  2VJE B;  2MNY A;  4UI9 B;  3GV4 A;  2ECW A;  5D1K B;  2FUU A;  4NN2 A;  4GND A;  2XEU A;  2KRE A;  5H9M A;  2LGL A;  4YBS A;  1HYJ A;  4I7B A;  4MSX A;  2JMJ A;  3LQI A;  5KH9 A;  5G05 B;  3DPL R;  2OXQ C;  4ZDT A;  2QIZ A;  3EB6 A;  1WEM A;  2EA6 A;  5JG6 A;  3O37 A;  5AIT A;  5DKA A;  2MA6 A;  2K1J A;  3ZVY A;  2AN6 A;  2KWN A;  1WGM A;  3NG2 A;  2MUM A;  1VFY A;  3KV6 A;  4YBT A;  3U5M A;  4ZUX U;  1Z6U A;  2VP7 A;  1WIL A;  2CT2 A;  2M6M A;  3O70 A;  3T6R A;  2L75 A;  5B79 A;  4W4U A;  4GNE A;  2KU3 A;  2YHN A;  4XI1 A;  4WZ2 A;  3O35 A;  2MNZ A;  4S3O C;  5KH3 A;  2VPD A;  2EOD A;  1HYI A;  2ECJ A;  4LKA A;  1V87 A;  4GNF A;  2CSZ A;  3C6W A;  4IC3 A;  2YUC A;  2QJ0 A;  3HCU A;  1VD4 A;  4IC2 A;  3ZPV 1;  4AYC A;  4AP4 A;  2LGK A;  4GB0 A;  4B86 C;  5TAB A;  1JM7 A;  2D8S A;  3SOW A;  4S3O B;  4YC9 A;  5TRB A;  5LKU A;  1G25 A;  3IHP A;  2VPB A;  2IDA A;  2VJE A;  2MT5 A;  2YRE A;  4F52 B;  5AIU A;  2UZG A;  2VJF B;  2YUR A;  1WEP A;  4L7X A;  2G45 A;  2FUI A;  5DIN A;  3RTR B;  4R2Y A;  5FB0 A;  2LXH C;  2KIZ A;  3MHH A;  3O34 A;  1ZBD B;  3LQH A;  2I50 A;  2RSD A;  4BHW A;  3GL6 A;  1WEQ A;  5H1V A;  4I7D A;  1FBV A;  2JMD A;  5B77 A;  3PUR A;  3PHD A;  1FP0 A;  2LXP C;  2MA5 A;  4PTB A;  2ZET C;  1XWH A;  4PPE A;  1X4I A;  1MM3 A;  5FB1 A;  2YT5 A;  3T7L A;  2YYR A;  4LK9 A;  2PNX A;  2G43 A;  2YQL A;  3RPG C;  3KQI A;  4V3K C;  3HCS A;  2YHO A;  4A4B A;  5B8D A;  3ZNI A;  2KFT A;  2LQ6 A;  2M85 A;  2HDP A;  3KV5 A;  4YAD A;  4MVT A;  2Y1M A;  3EB5 A;  1U6G B;  3RPG B;  2KWO A;  2CKL A;  2QIC A;  4ZQL A;  3SHB A;  3L1X A;  3N9O A;  4WZ3 B;  2L43 A;  2MD7 B;  3QZV A;  2L0B A;  2VJF A;  1WEU A;  2F6J A;  2ECV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...