3SOWA

Structure of uhrf1 phd finger in complex with histone h3k4me3 1-9 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3sowA00
2E6SA 1WEQA 5B79A 2I50A 3T6RA 4LADB 3N9PA 3N9QA 5H1TA 5TBNA 2ZETC 4YATA 4N4FA 4FJCA 3KNVA 2H0DB 2MD7B 2ECJA 2L43A 4YABA 2MT5A 4MSXA 1WEVA 4UI9B 2LRIC 2Y1MA 2YHOA 2HYED 1LDJB 2CSZA 2FUUA 5C11A 2CT2A 5AITA 4N3WA 3QZVA 2KGGA 2YREA 2ECTA 2ECIA 2VJFA 4YC9A 5TRBA 2L80A 4QF3A 3ZVYA 2VPGA 2ECGA 5I3LA 2MA5A 1JM7A 3L1XA 1E4UA 2VP7A 3MHHA 3LQHA 5D1KB 4TKPB 2EGPA 1MM2A 2L5UA 1WEUA 3N9LA 5D1MB 3HCUA 4V3LC 2ECVA 3ASLA 3EB5A 5DINA 2YQLA 5EYAF 1HYIA 2YURA 3VK6A 1WE9A 1N87A 1WEOA 4IC2A 4B86C 4B7YC 3HCTA 2KGIA 1K2FA 4W4UA 4A0CD 3O33A 3HTKC 1V87A 5C13A 1WIMA 4WZ2A 2YU4A 2FSAA 2KWOA 3M63A 4A4CA 4I7CA 1T1HA 4AYCA 2VJEA 3DQVR 2RSDA 2DX8A 2MUMA 4CCGX 3U5NA 2UZGA 3HCSA 4R2YA 4GNDA 2NAAA 3L1ZB 4R7EA 3MHSA 2JMJA 3SOUA 2EODA 4V3KC 1U6GB 1WEPA 5G05B 4GNGA 1WENA 3SOXA 3KV5A 3N9OA 4LKAA 5LKTA 1RMDA 2K1JA 3PURA 4A4BA 4L58A 5FB0A 1X4UA 5TDRA 3ZPVE 3SHBA 3RPGC 2VPDA 4S3OC 2VNFA 1XWHA 5B78A 1WGMA 1JOCA 2LGGA 3M99A 2YHNA 4I7BA 2KWKA 3IHPA 2JMDA 3U5PA 2L0BA 2KIZA 2EA6A 3EB6A 2LV9A 1X4JA 2G45A 2YW8A 3O35A 3RPGB 4S3OB 4AYCB 2CSYA 2F42A 3T7LA 5FB1A 2JMIA 1G25A 2D8SA 5DKAA 2G43A 2Y43A 3RTRB 1FP0A 3ZNIA 3C5KA 2HDPA 3GV4A 3U5MA 2KR4A 2L75A 3O34A 2M3HA 2E6RA 5G0FA 2YSJA 5LKXA 4FK5A 1Z6UA 5FEYA 4L7XA 4O64A 3ZTGA 3PHDA 1Z2QA 4YBMA 2IDAA 3GL6A 4WA6A 2JRJA 3LQIA 3L11A 2PNXA 5LCWB 4AP4A 5H9MA 3ZYQA 1DVPA 4FO9A 1Z60A 1WILA 4GNFA 4F52B 2CKLA 2G6QA 2RI7A 5LKUA 5KH7A 2M85A 5B76A 4MVTA 2F6NA 2VPEA 2VJFB 4BHWA 2BAYA 1LDKC 1JM7B 3N9NA 2ECWA 4GNEA 2C2VS 2QJ0A 1ZBDB 3M62A 1VD4A 2LGLA 4LLBA 5G04B 4YADA 4CA1A 3LQJA 2KWJA 3O37A 4FIPA 2MIQA 3PUQA 2QICA 2LXHC 4XI1A 4R8PK 1FBVA 5H1UA 2MNZA 2KREA 2LQ6A 4ZDTA 3SOWA 2KU3A 4I7DA 2LGKA 3O7AA 2YT5A 3DPLR 2VJEB 4NN2A 1F62A 3ZVZB 3KV6A 2LXPC 5TDWA 4UP5A 2PUYA 2CKLB 4WZ3B 3O70A 3V43A 1HYJA 2KFTA 2C2LA 4AVXA 4PPEA 4C9ZA 4PTBA 3FL2A 1X4IA 5B75A 4YBSA 2MD8C 4A49A 4Q6FA 1WFKA 2LGVA 5AIUA 2ECNA 2FUIA 5KH9A 2KYUA 2K16A 2K4DA 2Y1NA 2XB1A 2MNYA 2M6MA 4X3GA 4ZQLA 2F6JA 2AN6A 5H1VA 2KE1A 2YQMA 5JG6A 1WESA 3U5OA 1MM3A 4BBQA 2H0DA 4LJNA 5TABA 5FERA 1VFYA 4YAXA 3LRQA 2KWNA 5LKZA 4UP0A 1VYXA 2M1RA 1IYMA 4LK9A 1WEWA 1WEMA 3N9MA 3NG2A 3I2DA 2OXQC 2MA6A 4IC3A 2QIZA 2YYRA 4P5OB 1CHCA 3KQIA 4QF2A 3O36A 4ZUXU 2VPBA 2YUCA 2XEUA 2YSMA 4YBTA 5KH3A 3C6WA 2K17A 5J3XA 2LDRA 5B8DA 4WZ0A 4AUQB 2LN0A 1BORA 3ZPV1 5D1LB 5B77A 1WEEA 4GB0A
chains in the Genus database with same CATH superfamily
2E6SA 2KKYA 3SUBA 1WEQA 5B79A 2I50A 3T6RA 3Q1DA 4LADB 3N9PA 3N9QA 5H1TA 3M7KA 5TBNA 2ZETC 4YATA 4N4FA 2P57A 4FJCA 3KNVA 2H0DB 2MD7B 2CRRA 2ECJA 2L43A 4YABA 2MT5A 4MSXA 1WEVA 3DWDA 4UI9B 2LRIC 2Y1MA 2YHOA 2HYED 1LDJB 2CSZA 2FUUA 5C11A 2CT2A 5AITA 4N3WA 2L7PA 3KDEC 3QZVA 2KGGA 2YREA 2ECTA 2ECIA 2VJFA 4O62A 4YC9A 2EXUA 5K3QA 5TRBA 2L80A 4QF3A 3ZVYA 2VPGA 2ECGA 5I3LA 2MA5A 1JM7A 3L1XA 1E4UA 2VP7A 3MHHA 3LQHA 5D1KB 2E61A 4TKPB 2EGPA 1MM2A 2L5UA 1WEUA 3N9LA 5D1MB 3HCUA 4V3LC 2ECVA 3ASLA 3EB5A 5DINA 2YQLA 3FANA 5EYAF 1HYIA 2YURA 3VK6A 1WE9A 1N87A 1WEOA 4IC2A 4B86C 4B7YC 3LDYA 3HCTA 2KGIA 1K2FA 4W4UA 4A0CD 3O33A 3HTKC 1V87A 5C13A 3FJUB 1WIMA 4WZ2A 2YU4A 2FSAA 2KWOA 3M63A 4A4CA 4I7CA 1T1HA 4AYCA 2VJEA 3DQVR 2RSDA 2DX8A 2MUMA 4CCGX 3U5NA 2UZGA 3HCSA 4R2YA 4GNDA 2NAAA 3L1ZB 4R7EA 3PLWA 3MHSA 2JMJA 3SOUA 2EODA 4V3KC 1U6GB 1WEPA 5G05B 4GNGA 1WENA 3SOXA 3KV5A 3N9OA 4LKAA 5LKTA 1RMDA 2K1JA 3PURA 4A4BA 3LVQE 4L58A 5FB0A 1X4UA 5TDRA 3ZPVE 3SHBA 3RPGC 2VPDA 4S3OC 2VNFA 1XWHA 5B78A 1WGMA 1JOCA 2LGGA 3M99A 2YHNA 4I7BA 2KWKA 3IHPA 2JMDA 3U5PA 2L0BA 2KIZA 2EA6A 3EB6A 4QQ4A 2LV9A 1X4JA 2XOZA 2G45A 2RR4A 2YW8A 3O35A 3RPGB 4S3OB 2FD4A 4AYCB 3E2DA 2CSYA 2F42A 3T7LA 5FB1A 2JMIA 1G25A 2D8SA 5DKAA 2G43A 2Y43A 2YVRA 3RTRB 1FP0A 3ZNIA 3C5KA 2HDPA 3GV4A 3U5MA 5SVIA 2KR4A 2L75A 3O34A 4OGCA 2M3HA 2E6RA 5G0FA 2YSJA 5LKXA 4FK5A 1Z6UA 5FEYA 4L7XA 4O64A 3ZTGA 3PHDA 1Z2QA 4YBMA 2IDAA 2IQJA 3GL6A 4WA6A 2JRJA 2JM3A 2XP0A 3LQIA 5SVXA 3L11A 3FAOA 2JUNA 2PNXA 5LCWB 4AP4A 5H9MA 3ZYQA 1DVPA 4FO9A 1Z60A 1WILA 4GNFA 4F52B 2EGMA 2CKLA 2G6QA 2RI7A 5LKUA 5KH7A 2M85A 2MKEA 2CSVA 5B76A 4MVTA 3T9KA 2F6NA 2VPEA 2VJFB 2KKXA 2OWAA 4BHWA 3JUEA 2BAYA 1LDKC 1JM7B 3N9NA 2ECWA 4GNEA 2C2VS 2QJ0A 1ZBDB 3M62A 2LAUA 1VD4A 2LGLA 4LLBA 2D8UA 5G04B 4YADA 4CA1A 3LQJA 2KWJA 3O37A 4FIPA 2MIQA 3PUQA 2QICA 1DCQA 2LXHC 4XI1A 4R8PK 1FBVA 5H1UA 2DJAA 2KREA 2MNZA 2XOCA 1MBMA 2LQ6A 4ZDTA 3SOWA 2KU3A 4I7DA 2LGKA 3DDTA 3O7AA 2YT5A 3DPLR 3O47A 2VJEB 4NN2A 1F62A 3ZVZB 3KV6A 2LXPC 5TDWA 4UP5A 2PUYA 2CKLB 4WZ3B 2CONA 3O70A 3V43A 1HYJA 2KFTA 2C2LA 4AVXA 4PPEA 4C9ZA 4PTBA 3FL2A 1X4IA 4Z0OA 2B0OE 5B75A 4YBSA 3LVRE 2MD8C 4A49A 4Q6FA 1WFKA 2LGVA 5AIUA 2M13A 2ECNA 2FUIA 4H9DA 5KH9A 2KYUA 2K16A 3LJUX 2K4DA 2Y1NA 2XB1A 2MNYA 2FFWA 2M6MA 4X3GA 4ZQLA 2F6JA 2AN6A 5H1VA 2CRWA 2KE1A 2YQMA 5JG6A 1WESA 3U5OA 1MM3A 4BBQA 2H0DA 3MDBC 4LJNA 5TABA 5FERA 1VFYA 4YAXA 3LRQA 2KWNA 2DSMA 5LKZA 4UP0A 4Z0RA 1VYXA 2M1RA 1IYMA 4LK9A 1WEWA 1WEMA 3N9MA 3NG2A 3I2DA 2OXQC 2MA6A 4IC3A 2QIZA 2YYRA 4F1PA 4P5OB 1CHCA 5SVYA 3KQIA 4QF2A 3H7HA 3O36A 4ZUXU 2VPBA 2YUCA 3FEHA 2XEUA 2YSMA 4YBTA 3FM8C 5KH3A 3C6WA 5SVIB 2K17A 5J3XA 2LDRA 5B8DA 4WZ0A 4AUQB 2LN0A 4OGEA 1BORA 3ZPV1 5D1LB 5B77A 2XOYA 1WEEA 4GB0A
chains in the Genus database with same CATH topology
2E6SA 1WEQA 5B79A 2I50A 3T6RA 4LADB 3N9PA 3N9QA 5H1TA 5TBNA 2ZETC 4YATA 4N4FA 4FJCA 3KNVA 2H0DB 2MD7B 2ECJA 2L43A 4YABA 2MT5A 4MSXA 1WEVA 4UI9B 2LRIC 2Y1MA 2YHOA 2HYED 1LDJB 2CSZA 2FUUA 5C11A 2CT2A 5AITA 4N3WA 3QZVA 2KGGA 2YREA 2ECTA 2ECIA 2VJFA 4YC9A 5TRBA 2L80A 4QF3A 3ZVYA 2VPGA 2ECGA 5I3LA 2MA5A 1JM7A 3L1XA 1E4UA 2VP7A 3MHHA 3LQHA 5D1KB 4TKPB 2EGPA 1MM2A 2L5UA 1WEUA 3N9LA 5D1MB 3HCUA 4V3LC 2ECVA 3ASLA 3EB5A 5DINA 2YQLA 5EYAF 1HYIA 2YURA 3VK6A 1WE9A 1N87A 1WEOA 4IC2A 4B86C 4B7YC 3HCTA 2KGIA 1K2FA 4W4UA 4A0CD 3O33A 3HTKC 1V87A 5C13A 1WIMA 4WZ2A 2YU4A 2FSAA 2KWOA 3M63A 4A4CA 4I7CA 1T1HA 4AYCA 2VJEA 3DQVR 2RSDA 2DX8A 2MUMA 4CCGX 3U5NA 2UZGA 3HCSA 4R2YA 4GNDA 2NAAA 3L1ZB 4R7EA 3MHSA 2JMJA 3SOUA 2EODA 4V3KC 1U6GB 1WEPA 5G05B 4GNGA 1WENA 3SOXA 3KV5A 3N9OA 4LKAA 5LKTA 1RMDA 2K1JA 3PURA 4A4BA 4L58A 5FB0A 1X4UA 5TDRA 3ZPVE 3SHBA 3RPGC 2VPDA 4S3OC 2VNFA 1XWHA 5B78A 1WGMA 1JOCA 2LGGA 3M99A 2YHNA 4I7BA 2KWKA 3IHPA 2JMDA 3U5PA 2L0BA 2KIZA 2EA6A 3EB6A 2LV9A 1X4JA 2G45A 2YW8A 3O35A 3RPGB 4S3OB 4AYCB 2CSYA 2F42A 3T7LA 5FB1A 2JMIA 1G25A 2D8SA 5DKAA 2G43A 2Y43A 3RTRB 1FP0A 3ZNIA 3C5KA 2HDPA 3GV4A 3U5MA 2KR4A 2L75A 3O34A 2M3HA 2E6RA 5G0FA 2YSJA 5LKXA 4FK5A 1Z6UA 5FEYA 4L7XA 4O64A 3ZTGA 3PHDA 1Z2QA 4YBMA 2IDAA 3GL6A 4WA6A 2JRJA 3LQIA 3L11A 2PNXA 5LCWB 4AP4A 5H9MA 3ZYQA 1DVPA 4FO9A 1Z60A 1WILA 4GNFA 4F52B 2CKLA 2G6QA 2RI7A 5LKUA 5KH7A 2M85A 5B76A 4MVTA 2F6NA 2VPEA 2VJFB 4BHWA 2BAYA 1LDKC 1JM7B 3N9NA 2ECWA 4GNEA 2C2VS 2QJ0A 1ZBDB 3M62A 1VD4A 2LGLA 4LLBA 5G04B 4YADA 4CA1A 3LQJA 2KWJA 3O37A 4FIPA 2MIQA 3PUQA 2QICA 2LXHC 4XI1A 4R8PK 1FBVA 5H1UA 2MNZA 2KREA 2LQ6A 4ZDTA 3SOWA 2KU3A 4I7DA 2LGKA 3O7AA 2YT5A 3DPLR 2VJEB 4NN2A 1F62A 3ZVZB 3KV6A 2LXPC 5TDWA 4UP5A 2PUYA 2CKLB 4WZ3B 3O70A 3V43A 1HYJA 2KFTA 2C2LA 4AVXA 4PPEA 4C9ZA 4PTBA 3FL2A 1X4IA 5B75A 4YBSA 2MD8C 4A49A 4Q6FA 1WFKA 2LGVA 5AIUA 2ECNA 2FUIA 5KH9A 2KYUA 2K16A 2K4DA 2Y1NA 2XB1A 2MNYA 2M6MA 4X3GA 4ZQLA 2F6JA 2AN6A 5H1VA 2KE1A 2YQMA 5JG6A 1WESA 3U5OA 1MM3A 4BBQA 2H0DA 4LJNA 5TABA 5FERA 1VFYA 4YAXA 3LRQA 2KWNA 5LKZA 4UP0A 1VYXA 2M1RA 1IYMA 4LK9A 1WEWA 1WEMA 3N9MA 3NG2A 3I2DA 2OXQC 2MA6A 4IC3A 2QIZA 2YYRA 4P5OB 1CHCA 3KQIA 4QF2A 3O36A 4ZUXU 2VPBA 2YUCA 2XEUA 2YSMA 4YBTA 5KH3A 3C6WA 2K17A 5J3XA 2LDRA 5B8DA 4WZ0A 4AUQB 2LN0A 1BORA 3ZPV1 5D1LB 5B77A 1WEEA 4GB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6S A;  1WEQ A;  5B79 A;  2I50 A;  3T6R A;  4LAD B;  3N9P A;  3N9Q A;  5H1T A;  5TBN A;  2ZET C;  4YAT A;  4N4F A;  4FJC A;  3KNV A;  2H0D B;  2MD7 B;  2ECJ A;  2L43 A;  4YAB A;  2MT5 A;  4MSX A;  1WEV A;  4UI9 B;  2LRI C;  2Y1M A;  2YHO A;  2HYE D;  1LDJ B;  2CSZ A;  2FUU A;  5C11 A;  2CT2 A;  5AIT A;  4N3W A;  3QZV A;  2KGG A;  2YRE A;  2ECT A;  2ECI A;  2VJF A;  4YC9 A;  5TRB A;  2L80 A;  4QF3 A;  3ZVY A;  2VPG A;  2ECG A;  5I3L A;  2MA5 A;  1JM7 A;  3L1X A;  1E4U A;  2VP7 A;  3MHH A;  3LQH A;  5D1K B;  4TKP B;  2EGP A;  1MM2 A;  2L5U A;  1WEU A;  3N9L A;  5D1M B;  3HCU A;  4V3L C;  2ECV A;  3ASL A;  3EB5 A;  5DIN A;  2YQL A;  5EYA F;  1HYI A;  2YUR A;  3VK6 A;  1WE9 A;  1N87 A;  1WEO A;  4IC2 A;  4B86 C;  4B7Y C;  3HCT A;  2KGI A;  1K2F A;  4W4U A;  4A0C D;  3O33 A;  3HTK C;  1V87 A;  5C13 A;  1WIM A;  4WZ2 A;  2YU4 A;  2FSA A;  2KWO A;  3M63 A;  4A4C A;  4I7C A;  1T1H A;  4AYC A;  2VJE A;  3DQV R;  2RSD A;  2DX8 A;  2MUM A;  4CCG X;  3U5N A;  2UZG A;  3HCS A;  4R2Y A;  4GND A;  2NAA A;  3L1Z B;  4R7E A;  3MHS A;  2JMJ A;  3SOU A;  2EOD A;  4V3K C;  1U6G B;  1WEP A;  5G05 B;  4GNG A;  1WEN A;  3SOX A;  3KV5 A;  3N9O A;  4LKA A;  5LKT A;  1RMD A;  2K1J A;  3PUR A;  4A4B A;  4L58 A;  5FB0 A;  1X4U A;  5TDR A;  3ZPV E;  3SHB A;  3RPG C;  2VPD A;  4S3O C;  2VNF A;  1XWH A;  5B78 A;  1WGM A;  1JOC A;  2LGG A;  3M99 A;  2YHN A;  4I7B A;  2KWK A;  3IHP A;  2JMD A;  3U5P A;  2L0B A;  2KIZ A;  2EA6 A;  3EB6 A;  2LV9 A;  1X4J A;  2G45 A;  2YW8 A;  3O35 A;  3RPG B;  4S3O B;  4AYC B;  2CSY A;  2F42 A;  3T7L A;  5FB1 A;  2JMI A;  1G25 A;  2D8S A;  5DKA A;  2G43 A;  2Y43 A;  3RTR B;  1FP0 A;  3ZNI A;  3C5K A;  2HDP A;  3GV4 A;  3U5M A;  2KR4 A;  2L75 A;  3O34 A;  2M3H A;  2E6R A;  5G0F A;  2YSJ A;  5LKX A;  4FK5 A;  1Z6U A;  5FEY A;  4L7X A;  4O64 A;  3ZTG A;  3PHD A;  1Z2Q A;  4YBM A;  2IDA A;  3GL6 A;  4WA6 A;  2JRJ A;  3LQI A;  3L11 A;  2PNX A;  5LCW B;  4AP4 A;  5H9M A;  3ZYQ A;  1DVP A;  4FO9 A;  1Z60 A;  1WIL A;  4GNF A;  4F52 B;  2CKL A;  2G6Q A;  2RI7 A;  5LKU A;  5KH7 A;  2M85 A;  5B76 A;  4MVT A;  2F6N A;  2VPE A;  2VJF B;  4BHW A;  2BAY A;  1LDK C;  1JM7 B;  3N9N A;  2ECW A;  4GNE A;  2C2V S;  2QJ0 A;  1ZBD B;  3M62 A;  1VD4 A;  2LGL A;  4LLB A;  5G04 B;  4YAD A;  4CA1 A;  3LQJ A;  2KWJ A;  3O37 A;  4FIP A;  2MIQ A;  3PUQ A;  2QIC A;  2LXH C;  4XI1 A;  4R8P K;  1FBV A;  5H1U A;  2MNZ A;  2KRE A;  2LQ6 A;  4ZDT A;  3SOW A;  2KU3 A;  4I7D A;  2LGK A;  3O7A A;  2YT5 A;  3DPL R;  2VJE B;  4NN2 A;  1F62 A;  3ZVZ B;  3KV6 A;  2LXP C;  5TDW A;  4UP5 A;  2PUY A;  2CKL B;  4WZ3 B;  3O70 A;  3V43 A;  1HYJ A;  2KFT A;  2C2L A;  4AVX A;  4PPE A;  4C9Z A;  4PTB A;  3FL2 A;  1X4I A;  5B75 A;  4YBS A;  2MD8 C;  4A49 A;  4Q6F A;  1WFK A;  2LGV A;  5AIU A;  2ECN A;  2FUI A;  5KH9 A;  2KYU A;  2K16 A;  2K4D A;  2Y1N A;  2XB1 A;  2MNY A;  2M6M A;  4X3G A;  4ZQL A;  2F6J A;  2AN6 A;  5H1V A;  2KE1 A;  2YQM A;  5JG6 A;  1WES A;  3U5O A;  1MM3 A;  4BBQ A;  2H0D A;  4LJN A;  5TAB A;  5FER A;  1VFY A;  4YAX A;  3LRQ A;  2KWN A;  5LKZ A;  4UP0 A;  1VYX A;  2M1R A;  1IYM A;  4LK9 A;  1WEW A;  1WEM A;  3N9M A;  3NG2 A;  3I2D A;  2OXQ C;  2MA6 A;  4IC3 A;  2QIZ A;  2YYR A;  4P5O B;  1CHC A;  3KQI A;  4QF2 A;  3O36 A;  4ZUX U;  2VPB A;  2YUC A;  2XEU A;  2YSM A;  4YBT A;  5KH3 A;  3C6W A;  2K17 A;  5J3X A;  2LDR A;  5B8D A;  4WZ0 A;  4AUQ B;  2LN0 A;  1BOR A;  3ZPV 1;  5D1L B;  5B77 A;  1WEE A;  4GB0 A; 
#chains in the Genus database with same CATH topology
 2E6S A;  2KKY A;  3SUB A;  1WEQ A;  5B79 A;  2I50 A;  3T6R A;  3Q1D A;  4LAD B;  3N9P A;  3N9Q A;  5H1T A;  3M7K A;  5TBN A;  2ZET C;  4YAT A;  4N4F A;  2P57 A;  4FJC A;  3KNV A;  2H0D B;  2MD7 B;  2CRR A;  2ECJ A;  2L43 A;  4YAB A;  2MT5 A;  4MSX A;  1WEV A;  3DWD A;  4UI9 B;  2LRI C;  2Y1M A;  2YHO A;  2HYE D;  1LDJ B;  2CSZ A;  2FUU A;  5C11 A;  2CT2 A;  5AIT A;  4N3W A;  2L7P A;  3KDE C;  3QZV A;  2KGG A;  2YRE A;  2ECT A;  2ECI A;  2VJF A;  4O62 A;  4YC9 A;  2EXU A;  5K3Q A;  5TRB A;  2L80 A;  4QF3 A;  3ZVY A;  2VPG A;  2ECG A;  5I3L A;  2MA5 A;  1JM7 A;  3L1X A;  1E4U A;  2VP7 A;  3MHH A;  3LQH A;  5D1K B;  2E61 A;  4TKP B;  2EGP A;  1MM2 A;  2L5U A;  1WEU A;  3N9L A;  5D1M B;  3HCU A;  4V3L C;  2ECV A;  3ASL A;  3EB5 A;  5DIN A;  2YQL A;  3FAN A;  5EYA F;  1HYI A;  2YUR A;  3VK6 A;  1WE9 A;  1N87 A;  1WEO A;  4IC2 A;  4B86 C;  4B7Y C;  3LDY A;  3HCT A;  2KGI A;  1K2F A;  4W4U A;  4A0C D;  3O33 A;  3HTK C;  1V87 A;  5C13 A;  3FJU B;  1WIM A;  4WZ2 A;  2YU4 A;  2FSA A;  2KWO A;  3M63 A;  4A4C A;  4I7C A;  1T1H A;  4AYC A;  2VJE A;  3DQV R;  2RSD A;  2DX8 A;  2MUM A;  4CCG X;  3U5N A;  2UZG A;  3HCS A;  4R2Y A;  4GND A;  2NAA A;  3L1Z B;  4R7E A;  3PLW A;  3MHS A;  2JMJ A;  3SOU A;  2EOD A;  4V3K C;  1U6G B;  1WEP A;  5G05 B;  4GNG A;  1WEN A;  3SOX A;  3KV5 A;  3N9O A;  4LKA A;  5LKT A;  1RMD A;  2K1J A;  3PUR A;  4A4B A;  3LVQ E;  4L58 A;  5FB0 A;  1X4U A;  5TDR A;  3ZPV E;  3SHB A;  3RPG C;  2VPD A;  4S3O C;  2VNF A;  1XWH A;  5B78 A;  1WGM A;  1JOC A;  2LGG A;  3M99 A;  2YHN A;  4I7B A;  2KWK A;  3IHP A;  2JMD A;  3U5P A;  2L0B A;  2KIZ A;  2EA6 A;  3EB6 A;  4QQ4 A;  2LV9 A;  1X4J A;  2XOZ A;  2G45 A;  2RR4 A;  2YW8 A;  3O35 A;  3RPG B;  4S3O B;  2FD4 A;  4AYC B;  3E2D A;  2CSY A;  2F42 A;  3T7L A;  5FB1 A;  2JMI A;  1G25 A;  2D8S A;  5DKA A;  2G43 A;  2Y43 A;  2YVR A;  3RTR B;  1FP0 A;  3ZNI A;  3C5K A;  2HDP A;  3GV4 A;  3U5M A;  5SVI A;  2KR4 A;  2L75 A;  3O34 A;  4OGC A;  2M3H A;  2E6R A;  5G0F A;  2YSJ A;  5LKX A;  4FK5 A;  1Z6U A;  5FEY A;  4L7X A;  4O64 A;  3ZTG A;  3PHD A;  1Z2Q A;  4YBM A;  2IDA A;  2IQJ A;  3GL6 A;  4WA6 A;  2JRJ A;  2JM3 A;  2XP0 A;  3LQI A;  5SVX A;  3L11 A;  3FAO A;  2JUN A;  2PNX A;  5LCW B;  4AP4 A;  5H9M A;  3ZYQ A;  1DVP A;  4FO9 A;  1Z60 A;  1WIL A;  4GNF A;  4F52 B;  2EGM A;  2CKL A;  2G6Q A;  2RI7 A;  5LKU A;  5KH7 A;  2M85 A;  2MKE A;  2CSV A;  5B76 A;  4MVT A;  3T9K A;  2F6N A;  2VPE A;  2VJF B;  2KKX A;  2OWA A;  4BHW A;  3JUE A;  2BAY A;  1LDK C;  1JM7 B;  3N9N A;  2ECW A;  4GNE A;  2C2V S;  2QJ0 A;  1ZBD B;  3M62 A;  2LAU A;  1VD4 A;  2LGL A;  4LLB A;  2D8U A;  5G04 B;  4YAD A;  4CA1 A;  3LQJ A;  2KWJ A;  3O37 A;  4FIP A;  2MIQ A;  3PUQ A;  2QIC A;  1DCQ A;  2LXH C;  4XI1 A;  4R8P K;  1FBV A;  5H1U A;  2DJA A;  2KRE A;  2MNZ A;  2XOC A;  1MBM A;  2LQ6 A;  4ZDT A;  3SOW A;  2KU3 A;  4I7D A;  2LGK A;  3DDT A;  3O7A A;  2YT5 A;  3DPL R;  3O47 A;  2VJE B;  4NN2 A;  1F62 A;  3ZVZ B;  3KV6 A;  2LXP C;  5TDW A;  4UP5 A;  2PUY A;  2CKL B;  4WZ3 B;  2CON A;  3O70 A;  3V43 A;  1HYJ A;  2KFT A;  2C2L A;  4AVX A;  4PPE A;  4C9Z A;  4PTB A;  3FL2 A;  1X4I A;  4Z0O A;  2B0O E;  5B75 A;  4YBS A;  3LVR E;  2MD8 C;  4A49 A;  4Q6F A;  1WFK A;  2LGV A;  5AIU A;  2M13 A;  2ECN A;  2FUI A;  4H9D A;  5KH9 A;  2KYU A;  2K16 A;  3LJU X;  2K4D A;  2Y1N A;  2XB1 A;  2MNY A;  2FFW A;  2M6M A;  4X3G A;  4ZQL A;  2F6J A;  2AN6 A;  5H1V A;  2CRW A;  2KE1 A;  2YQM A;  5JG6 A;  1WES A;  3U5O A;  1MM3 A;  4BBQ A;  2H0D A;  3MDB C;  4LJN A;  5TAB A;  5FER A;  1VFY A;  4YAX A;  3LRQ A;  2KWN A;  2DSM A;  5LKZ A;  4UP0 A;  4Z0R A;  1VYX A;  2M1R A;  1IYM A;  4LK9 A;  1WEW A;  1WEM A;  3N9M A;  3NG2 A;  3I2D A;  2OXQ C;  2MA6 A;  4IC3 A;  2QIZ A;  2YYR A;  4F1P A;  4P5O B;  1CHC A;  5SVY A;  3KQI A;  4QF2 A;  3H7H A;  3O36 A;  4ZUX U;  2VPB A;  2YUC A;  3FEH A;  2XEU A;  2YSM A;  4YBT A;  3FM8 C;  5KH3 A;  3C6W A;  5SVI B;  2K17 A;  5J3X A;  2LDR A;  5B8D A;  4WZ0 A;  4AUQ B;  2LN0 A;  4OGE A;  1BOR A;  3ZPV 1;  5D1L B;  5B77 A;  2XOY A;  1WEE A;  4GB0 A; 
#chains in the Genus database with same CATH homology
 2E6S A;  1WEQ A;  5B79 A;  2I50 A;  3T6R A;  4LAD B;  3N9P A;  3N9Q A;  5H1T A;  5TBN A;  2ZET C;  4YAT A;  4N4F A;  4FJC A;  3KNV A;  2H0D B;  2MD7 B;  2ECJ A;  2L43 A;  4YAB A;  2MT5 A;  4MSX A;  1WEV A;  4UI9 B;  2LRI C;  2Y1M A;  2YHO A;  2HYE D;  1LDJ B;  2CSZ A;  2FUU A;  5C11 A;  2CT2 A;  5AIT A;  4N3W A;  3QZV A;  2KGG A;  2YRE A;  2ECT A;  2ECI A;  2VJF A;  4YC9 A;  5TRB A;  2L80 A;  4QF3 A;  3ZVY A;  2VPG A;  2ECG A;  5I3L A;  2MA5 A;  1JM7 A;  3L1X A;  1E4U A;  2VP7 A;  3MHH A;  3LQH A;  5D1K B;  4TKP B;  2EGP A;  1MM2 A;  2L5U A;  1WEU A;  3N9L A;  5D1M B;  3HCU A;  4V3L C;  2ECV A;  3ASL A;  3EB5 A;  5DIN A;  2YQL A;  5EYA F;  1HYI A;  2YUR A;  3VK6 A;  1WE9 A;  1N87 A;  1WEO A;  4IC2 A;  4B86 C;  4B7Y C;  3HCT A;  2KGI A;  1K2F A;  4W4U A;  4A0C D;  3O33 A;  3HTK C;  1V87 A;  5C13 A;  1WIM A;  4WZ2 A;  2YU4 A;  2FSA A;  2KWO A;  3M63 A;  4A4C A;  4I7C A;  1T1H A;  4AYC A;  2VJE A;  3DQV R;  2RSD A;  2DX8 A;  2MUM A;  4CCG X;  3U5N A;  2UZG A;  3HCS A;  4R2Y A;  4GND A;  2NAA A;  3L1Z B;  4R7E A;  3MHS A;  2JMJ A;  3SOU A;  2EOD A;  4V3K C;  1U6G B;  1WEP A;  5G05 B;  4GNG A;  1WEN A;  3SOX A;  3KV5 A;  3N9O A;  4LKA A;  5LKT A;  1RMD A;  2K1J A;  3PUR A;  4A4B A;  4L58 A;  5FB0 A;  1X4U A;  5TDR A;  3ZPV E;  3SHB A;  3RPG C;  2VPD A;  4S3O C;  2VNF A;  1XWH A;  5B78 A;  1WGM A;  1JOC A;  2LGG A;  3M99 A;  2YHN A;  4I7B A;  2KWK A;  3IHP A;  2JMD A;  3U5P A;  2L0B A;  2KIZ A;  2EA6 A;  3EB6 A;  2LV9 A;  1X4J A;  2G45 A;  2YW8 A;  3O35 A;  3RPG B;  4S3O B;  4AYC B;  2CSY A;  2F42 A;  3T7L A;  5FB1 A;  2JMI A;  1G25 A;  2D8S A;  5DKA A;  2G43 A;  2Y43 A;  3RTR B;  1FP0 A;  3ZNI A;  3C5K A;  2HDP A;  3GV4 A;  3U5M A;  2KR4 A;  2L75 A;  3O34 A;  2M3H A;  2E6R A;  5G0F A;  2YSJ A;  5LKX A;  4FK5 A;  1Z6U A;  5FEY A;  4L7X A;  4O64 A;  3ZTG A;  3PHD A;  1Z2Q A;  4YBM A;  2IDA A;  3GL6 A;  4WA6 A;  2JRJ A;  3LQI A;  3L11 A;  2PNX A;  5LCW B;  4AP4 A;  5H9M A;  3ZYQ A;  1DVP A;  4FO9 A;  1Z60 A;  1WIL A;  4GNF A;  4F52 B;  2CKL A;  2G6Q A;  2RI7 A;  5LKU A;  5KH7 A;  2M85 A;  5B76 A;  4MVT A;  2F6N A;  2VPE A;  2VJF B;  4BHW A;  2BAY A;  1LDK C;  1JM7 B;  3N9N A;  2ECW A;  4GNE A;  2C2V S;  2QJ0 A;  1ZBD B;  3M62 A;  1VD4 A;  2LGL A;  4LLB A;  5G04 B;  4YAD A;  4CA1 A;  3LQJ A;  2KWJ A;  3O37 A;  4FIP A;  2MIQ A;  3PUQ A;  2QIC A;  2LXH C;  4XI1 A;  4R8P K;  1FBV A;  5H1U A;  2MNZ A;  2KRE A;  2LQ6 A;  4ZDT A;  3SOW A;  2KU3 A;  4I7D A;  2LGK A;  3O7A A;  2YT5 A;  3DPL R;  2VJE B;  4NN2 A;  1F62 A;  3ZVZ B;  3KV6 A;  2LXP C;  5TDW A;  4UP5 A;  2PUY A;  2CKL B;  4WZ3 B;  3O70 A;  3V43 A;  1HYJ A;  2KFT A;  2C2L A;  4AVX A;  4PPE A;  4C9Z A;  4PTB A;  3FL2 A;  1X4I A;  5B75 A;  4YBS A;  2MD8 C;  4A49 A;  4Q6F A;  1WFK A;  2LGV A;  5AIU A;  2ECN A;  2FUI A;  5KH9 A;  2KYU A;  2K16 A;  2K4D A;  2Y1N A;  2XB1 A;  2MNY A;  2M6M A;  4X3G A;  4ZQL A;  2F6J A;  2AN6 A;  5H1V A;  2KE1 A;  2YQM A;  5JG6 A;  1WES A;  3U5O A;  1MM3 A;  4BBQ A;  2H0D A;  4LJN A;  5TAB A;  5FER A;  1VFY A;  4YAX A;  3LRQ A;  2KWN A;  5LKZ A;  4UP0 A;  1VYX A;  2M1R A;  1IYM A;  4LK9 A;  1WEW A;  1WEM A;  3N9M A;  3NG2 A;  3I2D A;  2OXQ C;  2MA6 A;  4IC3 A;  2QIZ A;  2YYR A;  4P5O B;  1CHC A;  3KQI A;  4QF2 A;  3O36 A;  4ZUX U;  2VPB A;  2YUC A;  2XEU A;  2YSM A;  4YBT A;  5KH3 A;  3C6W A;  2K17 A;  5J3X A;  2LDR A;  5B8D A;  4WZ0 A;  4AUQ B;  2LN0 A;  1BOR A;  3ZPV 1;  5D1L B;  5B77 A;  1WEE A;  4GB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...