3SOWA

Structure of uhrf1 phd finger in complex with histone h3k4me3 1-9 peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
PSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHD Finger Recognition of Unmodified Histone H3R2 Links UHRF1 to Regulation of Euchromatic Gene Expression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 12
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3sowA00
4WA6A 1JM7B 3KQIA 3L11A 5DKAA 2VPBA 3EB5A 2HDPA 5LKZA 1X4IA 5H1UA 2RI7A 4O64A 4PTBA 2VPGA 5KH9A 2YREA 5D1LB 3L1XA 5G05B 2ECGA 2LGGA 2VPDA 4MSXA 2QICA 4YAXA 2L75A 2LRIC 2QJ0A 3M63A 3O33A 2XEUA 5FB0A 3QZVA 3V43A 3C6WA 3ZTGA 3ASLA 2MA6A 2MD7B 3U5NA 3O37A 3U5MA 4ZUXU 4ZQLA 2MIQA 3KNVA 2KU3A 2KFTA 2MT5A 1X4JA 4UP5A 2F6NA 5B79A 4L7XA 4MVTA 3L1ZB 2KWJA 3NG2A 4FO9A 4LJNA 4IC2A 4XI1A 3M62A 5KH7A 4GNDA 4V3LC 4YBTA 1WEWA 4WZ2A 2ECJA 4FIPA 2MD8C 3ZNIA 2UZGA 5TABA 2LDRA 4FJCA 1WENA 1RMDA 3N9QA 2KGGA 2K4DA 5D1KB 1JM7A 4F52B 4GNGA 1XWHA 2JRJA 4W4UA 2JMIA 1LDJB 2Y43A 2LQ6A 1U6GB 2L80A 2G43A 3LQJA 2VJFA 5DINA 2M1RA 4AP4A 2HYED 3U5PA 3PUQA 5JG6A 5C13A 2K16A 2VPEA 4B7YC 2ECIA 2MUMA 3KV5A 3SOXA 5B75A 1VD4A 4S3OB 2XB1A 4WZ0A 5H9MA 3KV6A 5B78A 1E4UA 1X4UA 3ZVYA 2YU4A 4C9ZA 1N87A 2CSYA 4AVXA 4ZDTA 5C11A 4TKPB 4YBMA 1T1HA 1G25A 2D8SA 1VYXA 2YSMA 2F42A 5LKXA 4IC3A 4I7DA 2KR4A 5LKUA 2YT5A 5H1VA 2CKLB 1BORA 4A49A 4N4FA 4YC9A 3LQIA 3PURA 4LKAA 2ECVA 1IYMA 1Z6UA 2JMJA 2I50A 2ZETC 5TRBA 2LGKA 3ZPV1 2MA5A 3MHSA 2YQLA 3SOWA 2ECWA 4I7BA 5B76A 4N3WA 2LGVA 4GB0A 2FUIA 2KGIA 1WEEA 3HCTA 3O34A 3N9MA 2YUCA 1F62A 4YABA 1ZBDB 4Q6FA 2G45A 2LGLA 2F6JA 3U5OA 2KIZA 1WEMA 2L0BA 3SOUA 5LCWB 2YHNA 2LXPC 1Z60A 1JOCA 2E6RA 2M85A 2L5UA 3IHPA 2MNZA 3N9OA 2ECTA 4LADB 1VFYA 1DVPA 2CSZA 2YW8A 4NN2A 4CCGX 4LLBA 1WFKA 4YADA 2Y1MA 4X3GA 1FP0A 2Y1NA 2ECNA 3DPLR 3HCUA 2KWNA 4GNEA 2MNYA 2LN0A 3EB6A 2FUUA 2C2LA 3DQVR 5EYAF 3O70A 1WEPA 3LQHA 5TDRA 4CA1A 4QF3A 4FK5A 3MHHA 3C5KA 5G04B 1WILA 3T7LA 3O7AA 3FL2A 2KWOA 2OXQC 2KE1A 5G0FA 2KYUA 2G6QA 5FERA 1HYJA 4LK9A 4B86C 5KH3A 3ZYQA 2M3HA 2VNFA 1WIMA 1FBVA 5B8DA 1CHCA 4AYCB 2AN6A 4BBQA 3PHDA 2RSDA 5TBNA 2VJEB 4V3KC 4AYCA 2BAYA 3ZVZB 4L58A 4P5OB 3O36A 2LV9A 4YATA 3SHBA 1MM3A 4R7EA 4A4BA 3GV4A 3VK6A 3ZPVE 2C2VS 2VP7A 2QIZA 1WEVA 5H1TA 1LDKC 1V87A 5I3LA 2L43A 2IDAA 5B77A 5FEYA 2YYRA 2EGPA 2K1JA 1WESA 1WGMA 4QF2A 4A4CA 2H0DA 1WEQA 2M6MA 3RPGC 4R2YA 3N9NA 3M99A 2YQMA 2VJEA 3RTRB 4A0CD 1HYIA 2EODA 5J3XA 2VJFB 1WEUA 3I2DA 1Z2QA 2YURA 2LXHC 2JMDA 3LRQA 2DX8A 1MM2A 2YSJA 2CT2A 2K17A 1WE9A 4PPEA 3HCSA 3GL6A 1WEOA 2E6SA 2FSAA 3N9LA 2PNXA 2KWKA 2PUYA 1K2FA 4UP0A 4AUQB 5LKTA 4S3OC 4UI9B 2H0DB 3HTKC 5TDWA 4BHWA 3N9PA 4R8PK 5AIUA 5FB1A 3RPGB 2KREA 2EA6A 2CKLA 5AITA 4WZ3B 4YBSA 4GNFA 3O35A 5D1MB 3T6RA 2YHOA 4I7CA 2NAAA
chains in the Genus database with same CATH superfamily
2RR4A 4WA6A 1JM7B 3KQIA 3L11A 5DKAA 2VPBA 3EB5A 3FM8C 2HDPA 2DSMA 3JUEA 5LKZA 1X4IA 5H1UA 2RI7A 4O64A 4PTBA 2VPGA 5KH9A 2YREA 5D1LB 3E2DA 3L1XA 5G05B 2ECGA 2LGGA 3MDBC 2VPDA 4H9DA 4MSXA 2QICA 4YAXA 2L75A 4O62A 2JM3A 2LRIC 2QJ0A 3M63A 3O33A 2XEUA 2XOZA 5FB0A 3QZVA 3V43A 3C6WA 3ZTGA 3ASLA 2MA6A 2MD7B 3U5NA 3O37A 3U5MA 4ZUXU 4ZQLA 2CRWA 2MIQA 3KNVA 2KU3A 4Z0RA 2KFTA 2MT5A 1X4JA 5SVXA 4UP5A 2F6NA 5B79A 4L7XA 4MVTA 2FFWA 3L1ZB 2KWJA 3NG2A 4FO9A 4LJNA 4IC2A 4XI1A 3M62A 5KH7A 4GNDA 4V3LC 4YBTA 1WEWA 4WZ2A 2ECJA 3LVRE 4FIPA 2MD8C 4F1PA 3ZNIA 2UZGA 5TABA 2LDRA 4FJCA 1WENA 1RMDA 3N9QA 2KGGA 2K4DA 5D1KB 1JM7A 4F52B 4GNGA 1XWHA 2JRJA 4W4UA 2LAUA 2JMIA 1LDJB 2Y43A 2LQ6A 1U6GB 2L80A 2G43A 2KKXA 2VJFA 3LQJA 5DINA 2M1RA 4AP4A 2HYED 3U5PA 3PUQA 5JG6A 5C13A 5SVYA 2K16A 2VPEA 4B7YC 2ECIA 2MUMA 2B0OE 3KV5A 3LVQE 3SOXA 5B75A 1VD4A 3DDTA 2P57A 4S3OB 2XB1A 4WZ0A 5H9MA 3KV6A 2CONA 5B78A 2JUNA 1E4UA 1X4UA 3ZVYA 2YU4A 4C9ZA 1N87A 2CSYA 4AVXA 4ZDTA 5C11A 4OGEA 4TKPB 4YBMA 1T1HA 1G25A 2XOCA 2D8SA 3SUBA 1VYXA 2YSMA 2F42A 5LKXA 4IC3A 4I7DA 2KR4A 5LKUA 2YT5A 5H1VA 2EGMA 2CKLB 1BORA 4A49A 4N4FA 4YC9A 3LQIA 3PURA 4LKAA 5SVIB 2ECVA 1IYMA 1Z6UA 2JMJA 2I50A 2ZETC 5TRBA 2LGKA 3ZPV1 2MA5A 3MHSA 2XP0A 2YQLA 3SOWA 4OGCA 2ECWA 3DWDA 2D8UA 4I7BA 5B76A 4N3WA 2LGVA 2DJAA 3O47A 4GB0A 2M13A 2FUIA 3M7KA 2KGIA 1WEEA 3HCTA 3O34A 3N9MA 2YUCA 2OWAA 3H7HA 1F62A 4YABA 1ZBDB 4Q6FA 2G45A 2LGLA 2F6JA 3U5OA 2KIZA 1WEMA 2L0BA 3FEHA 3SOUA 5LCWB 2YHNA 2LXPC 1Z60A 1JOCA 2E6RA 2M85A 2L5UA 3IHPA 1MBMA 2MNZA 3N9OA 2E61A 2ECTA 4LADB 1VFYA 1DVPA 2CSZA 2YW8A 4NN2A 4CCGX 4LLBA 1WFKA 4YADA 3LJUX 2Y1MA 4X3GA 1FP0A 2Y1NA 2ECNA 3DPLR 2CRRA 2KWNA 3HCUA 4GNEA 2MNYA 2LN0A 3EB6A 2FUUA 2C2LA 3DQVR 5EYAF 3O70A 1WEPA 3LQHA 5TDRA 3Q1DA 4CA1A 4QF3A 4FK5A 3MHHA 3C5KA 5G04B 1WILA 3T7LA 3O7AA 3FL2A 2KWOA 2OXQC 2KE1A 5G0FA 2KYUA 2G6QA 5FERA 1HYJA 4LK9A 2IQJA 4B86C 5KH3A 3PLWA 3ZYQA 2M3HA 2KKYA 2VNFA 1WIMA 1FBVA 5B8DA 1CHCA 4AYCB 2AN6A 4BBQA 3PHDA 2RSDA 5TBNA 1DCQA 2VJEB 4V3KC 4AYCA 2BAYA 3ZVZB 4L58A 4P5OB 3O36A 2LV9A 4YATA 3SHBA 1MM3A 4R7EA 4A4BA 3GV4A 3VK6A 3ZPVE 2C2VS 2VP7A 2QIZA 1WEVA 5H1TA 1LDKC 1V87A 5I3LA 2L43A 2IDAA 5B77A 2CSVA 5FEYA 2YYRA 2XOYA 2EGPA 2K1JA 1WESA 1WGMA 4QF2A 4A4CA 2H0DA 1WEQA 5SVIA 4Z0OA 2M6MA 3RPGC 5K3QA 4R2YA 3FAOA 3N9NA 3M99A 2YQMA 2VJEA 3T9KA 3RTRB 4A0CD 1HYIA 2EODA 5J3XA 2MKEA 2EXUA 2VJFB 1WEUA 3I2DA 1Z2QA 2YURA 2LXHC 2JMDA 3KDEC 3LRQA 2DX8A 1MM2A 2YSJA 2CT2A 2K17A 1WE9A 4PPEA 3HCSA 3GL6A 1WEOA 2E6SA 2FSAA 3N9LA 2PNXA 2KWKA 2PUYA 3FJUB 2YVRA 1K2FA 4UP0A 4AUQB 5LKTA 4S3OC 4QQ4A 2FD4A 4UI9B 2H0DB 3HTKC 5TDWA 2L7PA 4BHWA 3N9PA 4R8PK 5AIUA 5FB1A 3RPGB 3FANA 2KREA 2EA6A 2CKLA 5AITA 4WZ3B 4YBSA 4GNFA 3O35A 5D1MB 3T6RA 2YHOA 4I7CA 2NAAA 3LDYA
chains in the Genus database with same CATH topology
4WA6A 1JM7B 3KQIA 3L11A 5DKAA 2VPBA 3EB5A 2HDPA 5LKZA 1X4IA 5H1UA 2RI7A 4O64A 4PTBA 2VPGA 5KH9A 2YREA 5D1LB 3L1XA 5G05B 2ECGA 2LGGA 2VPDA 4MSXA 2QICA 4YAXA 2L75A 2LRIC 2QJ0A 3M63A 3O33A 2XEUA 5FB0A 3QZVA 3V43A 3C6WA 3ZTGA 3ASLA 2MA6A 2MD7B 3U5NA 3O37A 3U5MA 4ZUXU 4ZQLA 2MIQA 3KNVA 2KU3A 2KFTA 2MT5A 1X4JA 4UP5A 2F6NA 5B79A 4L7XA 4MVTA 3L1ZB 2KWJA 3NG2A 4FO9A 4LJNA 4IC2A 4XI1A 3M62A 5KH7A 4GNDA 4V3LC 4YBTA 1WEWA 4WZ2A 2ECJA 4FIPA 2MD8C 3ZNIA 2UZGA 5TABA 2LDRA 4FJCA 1WENA 1RMDA 3N9QA 2KGGA 2K4DA 5D1KB 1JM7A 4F52B 4GNGA 1XWHA 2JRJA 4W4UA 2JMIA 1LDJB 2Y43A 2LQ6A 1U6GB 2L80A 2G43A 3LQJA 2VJFA 5DINA 2M1RA 4AP4A 2HYED 3U5PA 3PUQA 5JG6A 5C13A 2K16A 2VPEA 4B7YC 2ECIA 2MUMA 3KV5A 3SOXA 5B75A 1VD4A 4S3OB 2XB1A 4WZ0A 5H9MA 3KV6A 5B78A 1E4UA 1X4UA 3ZVYA 2YU4A 4C9ZA 1N87A 2CSYA 4AVXA 4ZDTA 5C11A 4TKPB 4YBMA 1T1HA 1G25A 2D8SA 1VYXA 2YSMA 2F42A 5LKXA 4IC3A 4I7DA 2KR4A 5LKUA 2YT5A 5H1VA 2CKLB 1BORA 4A49A 4N4FA 4YC9A 3LQIA 3PURA 4LKAA 2ECVA 1IYMA 1Z6UA 2JMJA 2I50A 2ZETC 5TRBA 2LGKA 3ZPV1 2MA5A 3MHSA 2YQLA 3SOWA 2ECWA 4I7BA 5B76A 4N3WA 2LGVA 4GB0A 2FUIA 2KGIA 1WEEA 3HCTA 3O34A 3N9MA 2YUCA 1F62A 4YABA 1ZBDB 4Q6FA 2G45A 2LGLA 2F6JA 3U5OA 2KIZA 1WEMA 2L0BA 3SOUA 5LCWB 2YHNA 2LXPC 1Z60A 1JOCA 2E6RA 2M85A 2L5UA 3IHPA 2MNZA 3N9OA 2ECTA 4LADB 1VFYA 1DVPA 2CSZA 2YW8A 4NN2A 4CCGX 4LLBA 1WFKA 4YADA 2Y1MA 4X3GA 1FP0A 2Y1NA 2ECNA 3DPLR 3HCUA 2KWNA 4GNEA 2MNYA 2LN0A 3EB6A 2FUUA 2C2LA 3DQVR 5EYAF 3O70A 1WEPA 3LQHA 5TDRA 4CA1A 4QF3A 4FK5A 3MHHA 3C5KA 5G04B 1WILA 3T7LA 3O7AA 3FL2A 2KWOA 2OXQC 2KE1A 5G0FA 2KYUA 2G6QA 5FERA 1HYJA 4LK9A 4B86C 5KH3A 3ZYQA 2M3HA 2VNFA 1WIMA 1FBVA 5B8DA 1CHCA 4AYCB 2AN6A 4BBQA 3PHDA 2RSDA 5TBNA 2VJEB 4V3KC 4AYCA 2BAYA 3ZVZB 4L58A 4P5OB 3O36A 2LV9A 4YATA 3SHBA 1MM3A 4R7EA 4A4BA 3GV4A 3VK6A 3ZPVE 2C2VS 2VP7A 2QIZA 1WEVA 5H1TA 1LDKC 1V87A 5I3LA 2L43A 2IDAA 5B77A 5FEYA 2YYRA 2EGPA 2K1JA 1WESA 1WGMA 4QF2A 4A4CA 2H0DA 1WEQA 2M6MA 3RPGC 4R2YA 3N9NA 3M99A 2YQMA 2VJEA 3RTRB 4A0CD 1HYIA 2EODA 5J3XA 2VJFB 1WEUA 3I2DA 1Z2QA 2YURA 2LXHC 2JMDA 3LRQA 2DX8A 1MM2A 2YSJA 2CT2A 2K17A 1WE9A 4PPEA 3HCSA 3GL6A 1WEOA 2E6SA 2FSAA 3N9LA 2PNXA 2KWKA 2PUYA 1K2FA 4UP0A 4AUQB 5LKTA 4S3OC 4UI9B 2H0DB 3HTKC 5TDWA 4BHWA 3N9PA 4R8PK 5AIUA 5FB1A 3RPGB 2KREA 2EA6A 2CKLA 5AITA 4WZ3B 4YBSA 4GNFA 3O35A 5D1MB 3T6RA 2YHOA 4I7CA 2NAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WA6 A;  1JM7 B;  3KQI A;  3L11 A;  5DKA A;  2VPB A;  3EB5 A;  2HDP A;  5LKZ A;  1X4I A;  5H1U A;  2RI7 A;  4O64 A;  4PTB A;  2VPG A;  5KH9 A;  2YRE A;  5D1L B;  3L1X A;  5G05 B;  2ECG A;  2LGG A;  2VPD A;  4MSX A;  2QIC A;  4YAX A;  2L75 A;  2LRI C;  2QJ0 A;  3M63 A;  3O33 A;  2XEU A;  5FB0 A;  3QZV A;  3V43 A;  3C6W A;  3ZTG A;  3ASL A;  2MA6 A;  2MD7 B;  3U5N A;  3O37 A;  3U5M A;  4ZUX U;  4ZQL A;  2MIQ A;  3KNV A;  2KU3 A;  2KFT A;  2MT5 A;  1X4J A;  4UP5 A;  2F6N A;  5B79 A;  4L7X A;  4MVT A;  3L1Z B;  2KWJ A;  3NG2 A;  4FO9 A;  4LJN A;  4IC2 A;  4XI1 A;  3M62 A;  5KH7 A;  4GND A;  4V3L C;  4YBT A;  1WEW A;  4WZ2 A;  2ECJ A;  4FIP A;  2MD8 C;  3ZNI A;  2UZG A;  5TAB A;  2LDR A;  4FJC A;  1WEN A;  1RMD A;  3N9Q A;  2KGG A;  2K4D A;  5D1K B;  1JM7 A;  4F52 B;  4GNG A;  1XWH A;  2JRJ A;  4W4U A;  2JMI A;  1LDJ B;  2Y43 A;  2LQ6 A;  1U6G B;  2L80 A;  2G43 A;  3LQJ A;  2VJF A;  5DIN A;  2M1R A;  4AP4 A;  2HYE D;  3U5P A;  3PUQ A;  5JG6 A;  5C13 A;  2K16 A;  2VPE A;  4B7Y C;  2ECI A;  2MUM A;  3KV5 A;  3SOX A;  5B75 A;  1VD4 A;  4S3O B;  2XB1 A;  4WZ0 A;  5H9M A;  3KV6 A;  5B78 A;  1E4U A;  1X4U A;  3ZVY A;  2YU4 A;  4C9Z A;  1N87 A;  2CSY A;  4AVX A;  4ZDT A;  5C11 A;  4TKP B;  4YBM A;  1T1H A;  1G25 A;  2D8S A;  1VYX A;  2YSM A;  2F42 A;  5LKX A;  4IC3 A;  4I7D A;  2KR4 A;  5LKU A;  2YT5 A;  5H1V A;  2CKL B;  1BOR A;  4A49 A;  4N4F A;  4YC9 A;  3LQI A;  3PUR A;  4LKA A;  2ECV A;  1IYM A;  1Z6U A;  2JMJ A;  2I50 A;  2ZET C;  5TRB A;  2LGK A;  3ZPV 1;  2MA5 A;  3MHS A;  2YQL A;  3SOW A;  2ECW A;  4I7B A;  5B76 A;  4N3W A;  2LGV A;  4GB0 A;  2FUI A;  2KGI A;  1WEE A;  3HCT A;  3O34 A;  3N9M A;  2YUC A;  1F62 A;  4YAB A;  1ZBD B;  4Q6F A;  2G45 A;  2LGL A;  2F6J A;  3U5O A;  2KIZ A;  1WEM A;  2L0B A;  3SOU A;  5LCW B;  2YHN A;  2LXP C;  1Z60 A;  1JOC A;  2E6R A;  2M85 A;  2L5U A;  3IHP A;  2MNZ A;  3N9O A;  2ECT A;  4LAD B;  1VFY A;  1DVP A;  2CSZ A;  2YW8 A;  4NN2 A;  4CCG X;  4LLB A;  1WFK A;  4YAD A;  2Y1M A;  4X3G A;  1FP0 A;  2Y1N A;  2ECN A;  3DPL R;  3HCU A;  2KWN A;  4GNE A;  2MNY A;  2LN0 A;  3EB6 A;  2FUU A;  2C2L A;  3DQV R;  5EYA F;  3O70 A;  1WEP A;  3LQH A;  5TDR A;  4CA1 A;  4QF3 A;  4FK5 A;  3MHH A;  3C5K A;  5G04 B;  1WIL A;  3T7L A;  3O7A A;  3FL2 A;  2KWO A;  2OXQ C;  2KE1 A;  5G0F A;  2KYU A;  2G6Q A;  5FER A;  1HYJ A;  4LK9 A;  4B86 C;  5KH3 A;  3ZYQ A;  2M3H A;  2VNF A;  1WIM A;  1FBV A;  5B8D A;  1CHC A;  4AYC B;  2AN6 A;  4BBQ A;  3PHD A;  2RSD A;  5TBN A;  2VJE B;  4V3K C;  4AYC A;  2BAY A;  3ZVZ B;  4L58 A;  4P5O B;  3O36 A;  2LV9 A;  4YAT A;  3SHB A;  1MM3 A;  4R7E A;  4A4B A;  3GV4 A;  3VK6 A;  3ZPV E;  2C2V S;  2VP7 A;  2QIZ A;  1WEV A;  5H1T A;  1LDK C;  1V87 A;  5I3L A;  2L43 A;  2IDA A;  5B77 A;  5FEY A;  2YYR A;  2EGP A;  2K1J A;  1WES A;  1WGM A;  4QF2 A;  4A4C A;  2H0D A;  1WEQ A;  2M6M A;  3RPG C;  4R2Y A;  3N9N A;  3M99 A;  2YQM A;  2VJE A;  3RTR B;  4A0C D;  1HYI A;  2EOD A;  5J3X A;  2VJF B;  1WEU A;  3I2D A;  1Z2Q A;  2YUR A;  2LXH C;  2JMD A;  3LRQ A;  2DX8 A;  1MM2 A;  2YSJ A;  2CT2 A;  2K17 A;  1WE9 A;  4PPE A;  3HCS A;  3GL6 A;  1WEO A;  2E6S A;  2FSA A;  3N9L A;  2PNX A;  2KWK A;  2PUY A;  1K2F A;  4UP0 A;  4AUQ B;  5LKT A;  4S3O C;  4UI9 B;  2H0D B;  3HTK C;  5TDW A;  4BHW A;  3N9P A;  4R8P K;  5AIU A;  5FB1 A;  3RPG B;  2KRE A;  2EA6 A;  2CKL A;  5AIT A;  4WZ3 B;  4YBS A;  4GNF A;  3O35 A;  5D1M B;  3T6R A;  2YHO A;  4I7C A;  2NAA A; 
#chains in the Genus database with same CATH topology
 2RR4 A;  4WA6 A;  1JM7 B;  3KQI A;  3L11 A;  5DKA A;  2VPB A;  3EB5 A;  3FM8 C;  2HDP A;  2DSM A;  3JUE A;  5LKZ A;  1X4I A;  5H1U A;  2RI7 A;  4O64 A;  4PTB A;  2VPG A;  5KH9 A;  2YRE A;  5D1L B;  3E2D A;  3L1X A;  5G05 B;  2ECG A;  2LGG A;  3MDB C;  2VPD A;  4H9D A;  4MSX A;  2QIC A;  4YAX A;  2L75 A;  4O62 A;  2JM3 A;  2LRI C;  2QJ0 A;  3M63 A;  3O33 A;  2XEU A;  2XOZ A;  5FB0 A;  3QZV A;  3V43 A;  3C6W A;  3ZTG A;  3ASL A;  2MA6 A;  2MD7 B;  3U5N A;  3O37 A;  3U5M A;  4ZUX U;  4ZQL A;  2CRW A;  2MIQ A;  3KNV A;  2KU3 A;  4Z0R A;  2KFT A;  2MT5 A;  1X4J A;  5SVX A;  4UP5 A;  2F6N A;  5B79 A;  4L7X A;  4MVT A;  2FFW A;  3L1Z B;  2KWJ A;  3NG2 A;  4FO9 A;  4LJN A;  4IC2 A;  4XI1 A;  3M62 A;  5KH7 A;  4GND A;  4V3L C;  4YBT A;  1WEW A;  4WZ2 A;  2ECJ A;  3LVR E;  4FIP A;  2MD8 C;  4F1P A;  3ZNI A;  2UZG A;  5TAB A;  2LDR A;  4FJC A;  1WEN A;  1RMD A;  3N9Q A;  2KGG A;  2K4D A;  5D1K B;  1JM7 A;  4F52 B;  4GNG A;  1XWH A;  2JRJ A;  4W4U A;  2LAU A;  2JMI A;  1LDJ B;  2Y43 A;  2LQ6 A;  1U6G B;  2L80 A;  2G43 A;  2KKX A;  2VJF A;  3LQJ A;  5DIN A;  2M1R A;  4AP4 A;  2HYE D;  3U5P A;  3PUQ A;  5JG6 A;  5C13 A;  5SVY A;  2K16 A;  2VPE A;  4B7Y C;  2ECI A;  2MUM A;  2B0O E;  3KV5 A;  3LVQ E;  3SOX A;  5B75 A;  1VD4 A;  3DDT A;  2P57 A;  4S3O B;  2XB1 A;  4WZ0 A;  5H9M A;  3KV6 A;  2CON A;  5B78 A;  2JUN A;  1E4U A;  1X4U A;  3ZVY A;  2YU4 A;  4C9Z A;  1N87 A;  2CSY A;  4AVX A;  4ZDT A;  5C11 A;  4OGE A;  4TKP B;  4YBM A;  1T1H A;  1G25 A;  2XOC A;  2D8S A;  3SUB A;  1VYX A;  2YSM A;  2F42 A;  5LKX A;  4IC3 A;  4I7D A;  2KR4 A;  5LKU A;  2YT5 A;  5H1V A;  2EGM A;  2CKL B;  1BOR A;  4A49 A;  4N4F A;  4YC9 A;  3LQI A;  3PUR A;  4LKA A;  5SVI B;  2ECV A;  1IYM A;  1Z6U A;  2JMJ A;  2I50 A;  2ZET C;  5TRB A;  2LGK A;  3ZPV 1;  2MA5 A;  3MHS A;  2XP0 A;  2YQL A;  3SOW A;  4OGC A;  2ECW A;  3DWD A;  2D8U A;  4I7B A;  5B76 A;  4N3W A;  2LGV A;  2DJA A;  3O47 A;  4GB0 A;  2M13 A;  2FUI A;  3M7K A;  2KGI A;  1WEE A;  3HCT A;  3O34 A;  3N9M A;  2YUC A;  2OWA A;  3H7H A;  1F62 A;  4YAB A;  1ZBD B;  4Q6F A;  2G45 A;  2LGL A;  2F6J A;  3U5O A;  2KIZ A;  1WEM A;  2L0B A;  3FEH A;  3SOU A;  5LCW B;  2YHN A;  2LXP C;  1Z60 A;  1JOC A;  2E6R A;  2M85 A;  2L5U A;  3IHP A;  1MBM A;  2MNZ A;  3N9O A;  2E61 A;  2ECT A;  4LAD B;  1VFY A;  1DVP A;  2CSZ A;  2YW8 A;  4NN2 A;  4CCG X;  4LLB A;  1WFK A;  4YAD A;  3LJU X;  2Y1M A;  4X3G A;  1FP0 A;  2Y1N A;  2ECN A;  3DPL R;  2CRR A;  2KWN A;  3HCU A;  4GNE A;  2MNY A;  2LN0 A;  3EB6 A;  2FUU A;  2C2L A;  3DQV R;  5EYA F;  3O70 A;  1WEP A;  3LQH A;  5TDR A;  3Q1D A;  4CA1 A;  4QF3 A;  4FK5 A;  3MHH A;  3C5K A;  5G04 B;  1WIL A;  3T7L A;  3O7A A;  3FL2 A;  2KWO A;  2OXQ C;  2KE1 A;  5G0F A;  2KYU A;  2G6Q A;  5FER A;  1HYJ A;  4LK9 A;  2IQJ A;  4B86 C;  5KH3 A;  3PLW A;  3ZYQ A;  2M3H A;  2KKY A;  2VNF A;  1WIM A;  1FBV A;  5B8D A;  1CHC A;  4AYC B;  2AN6 A;  4BBQ A;  3PHD A;  2RSD A;  5TBN A;  1DCQ A;  2VJE B;  4V3K C;  4AYC A;  2BAY A;  3ZVZ B;  4L58 A;  4P5O B;  3O36 A;  2LV9 A;  4YAT A;  3SHB A;  1MM3 A;  4R7E A;  4A4B A;  3GV4 A;  3VK6 A;  3ZPV E;  2C2V S;  2VP7 A;  2QIZ A;  1WEV A;  5H1T A;  1LDK C;  1V87 A;  5I3L A;  2L43 A;  2IDA A;  5B77 A;  2CSV A;  5FEY A;  2YYR A;  2XOY A;  2EGP A;  2K1J A;  1WES A;  1WGM A;  4QF2 A;  4A4C A;  2H0D A;  1WEQ A;  5SVI A;  4Z0O A;  2M6M A;  3RPG C;  5K3Q A;  4R2Y A;  3FAO A;  3N9N A;  3M99 A;  2YQM A;  2VJE A;  3T9K A;  3RTR B;  4A0C D;  1HYI A;  2EOD A;  5J3X A;  2MKE A;  2EXU A;  2VJF B;  1WEU A;  3I2D A;  1Z2Q A;  2YUR A;  2LXH C;  2JMD A;  3KDE C;  3LRQ A;  2DX8 A;  1MM2 A;  2YSJ A;  2CT2 A;  2K17 A;  1WE9 A;  4PPE A;  3HCS A;  3GL6 A;  1WEO A;  2E6S A;  2FSA A;  3N9L A;  2PNX A;  2KWK A;  2PUY A;  3FJU B;  2YVR A;  1K2F A;  4UP0 A;  4AUQ B;  5LKT A;  4S3O C;  4QQ4 A;  2FD4 A;  4UI9 B;  2H0D B;  3HTK C;  5TDW A;  2L7P A;  4BHW A;  3N9P A;  4R8P K;  5AIU A;  5FB1 A;  3RPG B;  3FAN A;  2KRE A;  2EA6 A;  2CKL A;  5AIT A;  4WZ3 B;  4YBS A;  4GNF A;  3O35 A;  5D1M B;  3T6R A;  2YHO A;  4I7C A;  2NAA A;  3LDY A; 
#chains in the Genus database with same CATH homology
 4WA6 A;  1JM7 B;  3KQI A;  3L11 A;  5DKA A;  2VPB A;  3EB5 A;  2HDP A;  5LKZ A;  1X4I A;  5H1U A;  2RI7 A;  4O64 A;  4PTB A;  2VPG A;  5KH9 A;  2YRE A;  5D1L B;  3L1X A;  5G05 B;  2ECG A;  2LGG A;  2VPD A;  4MSX A;  2QIC A;  4YAX A;  2L75 A;  2LRI C;  2QJ0 A;  3M63 A;  3O33 A;  2XEU A;  5FB0 A;  3QZV A;  3V43 A;  3C6W A;  3ZTG A;  3ASL A;  2MA6 A;  2MD7 B;  3U5N A;  3O37 A;  3U5M A;  4ZUX U;  4ZQL A;  2MIQ A;  3KNV A;  2KU3 A;  2KFT A;  2MT5 A;  1X4J A;  4UP5 A;  2F6N A;  5B79 A;  4L7X A;  4MVT A;  3L1Z B;  2KWJ A;  3NG2 A;  4FO9 A;  4LJN A;  4IC2 A;  4XI1 A;  3M62 A;  5KH7 A;  4GND A;  4V3L C;  4YBT A;  1WEW A;  4WZ2 A;  2ECJ A;  4FIP A;  2MD8 C;  3ZNI A;  2UZG A;  5TAB A;  2LDR A;  4FJC A;  1WEN A;  1RMD A;  3N9Q A;  2KGG A;  2K4D A;  5D1K B;  1JM7 A;  4F52 B;  4GNG A;  1XWH A;  2JRJ A;  4W4U A;  2JMI A;  1LDJ B;  2Y43 A;  2LQ6 A;  1U6G B;  2L80 A;  2G43 A;  3LQJ A;  2VJF A;  5DIN A;  2M1R A;  4AP4 A;  2HYE D;  3U5P A;  3PUQ A;  5JG6 A;  5C13 A;  2K16 A;  2VPE A;  4B7Y C;  2ECI A;  2MUM A;  3KV5 A;  3SOX A;  5B75 A;  1VD4 A;  4S3O B;  2XB1 A;  4WZ0 A;  5H9M A;  3KV6 A;  5B78 A;  1E4U A;  1X4U A;  3ZVY A;  2YU4 A;  4C9Z A;  1N87 A;  2CSY A;  4AVX A;  4ZDT A;  5C11 A;  4TKP B;  4YBM A;  1T1H A;  1G25 A;  2D8S A;  1VYX A;  2YSM A;  2F42 A;  5LKX A;  4IC3 A;  4I7D A;  2KR4 A;  5LKU A;  2YT5 A;  5H1V A;  2CKL B;  1BOR A;  4A49 A;  4N4F A;  4YC9 A;  3LQI A;  3PUR A;  4LKA A;  2ECV A;  1IYM A;  1Z6U A;  2JMJ A;  2I50 A;  2ZET C;  5TRB A;  2LGK A;  3ZPV 1;  2MA5 A;  3MHS A;  2YQL A;  3SOW A;  2ECW A;  4I7B A;  5B76 A;  4N3W A;  2LGV A;  4GB0 A;  2FUI A;  2KGI A;  1WEE A;  3HCT A;  3O34 A;  3N9M A;  2YUC A;  1F62 A;  4YAB A;  1ZBD B;  4Q6F A;  2G45 A;  2LGL A;  2F6J A;  3U5O A;  2KIZ A;  1WEM A;  2L0B A;  3SOU A;  5LCW B;  2YHN A;  2LXP C;  1Z60 A;  1JOC A;  2E6R A;  2M85 A;  2L5U A;  3IHP A;  2MNZ A;  3N9O A;  2ECT A;  4LAD B;  1VFY A;  1DVP A;  2CSZ A;  2YW8 A;  4NN2 A;  4CCG X;  4LLB A;  1WFK A;  4YAD A;  2Y1M A;  4X3G A;  1FP0 A;  2Y1N A;  2ECN A;  3DPL R;  3HCU A;  2KWN A;  4GNE A;  2MNY A;  2LN0 A;  3EB6 A;  2FUU A;  2C2L A;  3DQV R;  5EYA F;  3O70 A;  1WEP A;  3LQH A;  5TDR A;  4CA1 A;  4QF3 A;  4FK5 A;  3MHH A;  3C5K A;  5G04 B;  1WIL A;  3T7L A;  3O7A A;  3FL2 A;  2KWO A;  2OXQ C;  2KE1 A;  5G0F A;  2KYU A;  2G6Q A;  5FER A;  1HYJ A;  4LK9 A;  4B86 C;  5KH3 A;  3ZYQ A;  2M3H A;  2VNF A;  1WIM A;  1FBV A;  5B8D A;  1CHC A;  4AYC B;  2AN6 A;  4BBQ A;  3PHD A;  2RSD A;  5TBN A;  2VJE B;  4V3K C;  4AYC A;  2BAY A;  3ZVZ B;  4L58 A;  4P5O B;  3O36 A;  2LV9 A;  4YAT A;  3SHB A;  1MM3 A;  4R7E A;  4A4B A;  3GV4 A;  3VK6 A;  3ZPV E;  2C2V S;  2VP7 A;  2QIZ A;  1WEV A;  5H1T A;  1LDK C;  1V87 A;  5I3L A;  2L43 A;  2IDA A;  5B77 A;  5FEY A;  2YYR A;  2EGP A;  2K1J A;  1WES A;  1WGM A;  4QF2 A;  4A4C A;  2H0D A;  1WEQ A;  2M6M A;  3RPG C;  4R2Y A;  3N9N A;  3M99 A;  2YQM A;  2VJE A;  3RTR B;  4A0C D;  1HYI A;  2EOD A;  5J3X A;  2VJF B;  1WEU A;  3I2D A;  1Z2Q A;  2YUR A;  2LXH C;  2JMD A;  3LRQ A;  2DX8 A;  1MM2 A;  2YSJ A;  2CT2 A;  2K17 A;  1WE9 A;  4PPE A;  3HCS A;  3GL6 A;  1WEO A;  2E6S A;  2FSA A;  3N9L A;  2PNX A;  2KWK A;  2PUY A;  1K2F A;  4UP0 A;  4AUQ B;  5LKT A;  4S3O C;  4UI9 B;  2H0D B;  3HTK C;  5TDW A;  4BHW A;  3N9P A;  4R8P K;  5AIU A;  5FB1 A;  3RPG B;  2KRE A;  2EA6 A;  2CKL A;  5AIT A;  4WZ3 B;  4YBS A;  4GNF A;  3O35 A;  5D1M B;  3T6R A;  2YHO A;  4I7C A;  2NAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...