2CRRA

Solution structure of arfgap domain from human smap1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
141
structure length
141
Chain Sequence
GSSGSSGKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal membrane-associated protein SMAP1B
publication title Solution structure of ArfGap domain from human SMAP1
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 23
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01412 ArfGap Putative GTPase activating protein for Arf
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.160 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2crrA01
3O47A 3FM8C 3JUEA 2B0OE 3DWDA 3LJUX 3T9KA 3LVRE 2CRRA 3MDBC 3FEHA 2IQJA 2CRWA 3SUBA 2P57A 2OWAA 1DCQA 3LVQE 4F1PA
chains in the Genus database with same CATH superfamily
2YYRA 4LADB 2I50A 1LDKC 1WIMA 5K3QA 2XEUA 5TRBA 4PPEA 3RPGB 2L7PA 4CA1A 3U5OA 3N9NA 3IHPA 5FB1A 5KH3A 4B86C 5KH9A 4LJNA 2LV9A 3I2DA 2ECWA 2KGGA 4C9ZA 3V43A 2MNYA 4AVXA 3N9LA 3LJUX 2JRJA 2H0DA 4Q6FA 2Y1NA 2VJEB 2YQLA 2QICA 5J3XA 5B78A 4TKPB 2CSVA 5LKXA 5H1UA 4CCGX 2LXPC 2K17A 2KWNA 5H1TA 2OWAA 5SVIA 4FK5A 4UP0A 1JM7B 4WZ3B 3FM8C 4AYCA 2UZGA 3E2DA 4V3LC 2KFTA 4WA6A 4YC9A 4FIPA 5G04B 5D1LB 1WEMA 1HYJA 3FAOA 5KH7A 2LGGA 2YQMA 3ZYQA 1DVPA 3O70A 2M3HA 4YBTA 3T7LA 2LGKA 5JG6A 2CSZA 2CKLB 1HYIA 2L75A 4BBQA 4F52B 2YREA 3JUEA 4YADA 2AN6A 5H1VA 3T9KA 3N9OA 2CRRA 2MA6A 2LAUA 3M7KA 4YABA 2ZETC 4ZUXU 1N87A 2C2LA 3ZPV1 1Z6UA 2MA5A 5SVXA 5FEYA 2VPGA 3O34A 3N9MA 5DKAA 2XP0A 5C13A 2K4DA 3MDBC 2MUMA 5C11A 2VNFA 2LQ6A 2P57A 1JOCA 4R7EA 5B77A 3KDEC 2KGIA 4I7DA 2M1RA 4AUQB 4OGCA 2XOYA 2ECGA 3DDTA 4N4FA 4LKAA 2PNXA 2KYUA 4I7BA 1WENA 3M99A 4NN2A 3HTKC 5FERA 4R2YA 2CONA 2F6JA 2RR4A 3U5NA 2E61A 4AP4A 2FUIA 3ZNIA 4A4BA 2ECJA 2VP7A 3O36A 1MM3A 3EB5A 3L1ZB 4MSXA 4GNDA 2E6RA 5LCWB 5B75A 1WEOA 1WILA 2KE1A 2KKYA 5AIUA 3C6WA 2QIZA 4W4UA 4I7CA 3L1XA 4H9DA 2LGVA 2BAYA 2PUYA 2JM3A 1WEUA 2D8UA 2JMDA 2VPEA 3FL2A 3SOWA 4S3OB 3T6RA 3LVRE 2EXUA 2L43A 2MKEA 2IDAA 3FANA 2KU3A 3LQJA 4YAXA 5I3LA 4YATA 3LQIA 4UP5A 2QJ0A 4L7XA 5SVYA 1VD4A 2FSAA 2EA6A 2DX8A 5TDRA 2EODA 1Z2QA 1FP0A 3HCTA 3GL6A 5G05B 2M6MA 1FBVA 3H7HA 3FEHA 1VYXA 2KR4A 4MVTA 2CRWA 4R8PK 2HYED 3KQIA 2H0DB 3Q1DA 5FB0A 1X4JA 2JMIA 4QF2A 1WEVA 3ASLA 1V87A 2CT2A 2MNZA 2MT5A 1WEPA 3PLWA 2YHNA 3LVQE 2K16A 2G45A 5B8DA 4S3OC 4QF3A 5SVIB 1VFYA 3U5MA 3MHHA 1WEWA 4AYCB 4GNFA 1G25A 2VPDA 2KWJA 3QZVA 1MM2A 2LGLA 2NAAA 3LQHA 1WESA 3M63A 3SOUA 2DSMA 2Y1MA 4GB0A 4X3GA 2VPBA 4FO9A 2YSJA 1XWHA 4BHWA 4FJCA 2XOZA 5H9MA 2K1JA 5D1MB 2VJEA 4QQ4A 4LLBA 3L11A 4OGEA 2LRIC 2YT5A 4N3WA 1K2FA 5LKUA 4A49A 3U5PA 4P5OB 1JM7A 1MBMA 2KWOA 1WEQA 4O62A 2YW8A 2XOCA 4O64A 3LDYA 3SHBA 1WFKA 2M13A 2YSMA 5EYAF 2B0OE 2FUUA 5AITA 5TABA 4A4CA 2XB1A 3DWDA 4YBMA 4GNEA 1X4UA 2ECVA 4WZ0A 1CHCA 4Z0RA 3HCSA 2YURA 3HCUA 2FFWA 2MD7B 3SUBA 3M62A 4V3KC 2CKLA 1BORA 3ZVYA 3GV4A 5G0FA 1DCQA 2YVRA 1LDJB 5DINA 4YBSA 3PUQA 5D1KB 3RTRB 2DJAA 4B7YC 3O47A 2EGPA 4GNGA 3O7AA 2YUCA 2LDRA 2VJFB 1Z60A 2F6NA 3NG2A 5B76A 2G43A 4LK9A 3VK6A 3PURA 2Y43A 3DQVR 2MIQA 1ZBDB 2CSYA 2L5UA 3KV6A 5TDWA 3KNVA 4ZQLA 3LRQA 2HDPA 1T1HA 5LKZA 3RPGC 4WZ2A 5LKTA 1RMDA 5B79A 2M85A 4IC2A 1WGMA 4PTBA 2KREA 4Z0OA 2IQJA 1IYMA 3PHDA 3ZTGA 3O33A 2KWKA 2MD8C 4XI1A 2JUNA 3FJUB 1WE9A 2KKXA 3SOXA 3N9PA 2G6QA 3N9QA 4UI9B 3ZVZB 2ECTA 4A0CD 1X4IA 2RI7A 4L58A 2LN0A 1F62A 2RSDA 4IC3A 2YU4A 2OXQC 1U6GB 3MHSA 3EB6A 4F1PA 2F42A 2FD4A 1E4UA 3ZPVE 2KIZA 2EGMA 3C5KA 3KV5A 2ECIA 3O37A 2ECNA 2D8SA 4ZDTA 5TBNA 3O35A 2YHOA 2LXHC 1WEEA 2L0BA 3DPLR 2L80A 2E6SA 2JMJA 2C2VS 2VJFA
chains in the Genus database with same CATH topology
2YREA 2DJAA 2M13A 3O47A 3FM8C 2JM3A 3JUEA 2B0OE 2D8UA 2XOZA 3E2DA 2EGMA 2XP0A 5SVIB 3DWDA 3LJUX 4QQ4A 5K3QA 3T9KA 4OGEA 3LVRE 4Z0RA 2FD4A 2CRRA 2EXUA 3MDBC 3H7HA 2MKEA 3FEHA 3LVQE 2LAUA 2L7PA 4Z0OA 2CRWA 2IQJA 2KKYA 2FFWA 3M7KA 2CONA 2CSVA 3SUBA 2P57A 3Q1DA 3KDEC 2RR4A 5SVXA 2OWAA 1DCQA 3PLWA 2E61A 4O62A 2YVRA 4H9DA 2JUNA 3FJUB 4OGCA 5SVIA 2XOYA 5SVYA 2XOCA 3LDYA 4F1PA 3DDTA 2KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O47 A;  3FM8 C;  3JUE A;  2B0O E;  3DWD A;  3LJU X;  3T9K A;  3LVR E;  2CRR A;  3MDB C;  3FEH A;  2IQJ A;  2CRW A;  3SUB A;  2P57 A;  2OWA A;  1DCQ A;  3LVQ E;  4F1P A; 
#chains in the Genus database with same CATH topology
 2YYR A;  4LAD B;  2I50 A;  1LDK C;  1WIM A;  5K3Q A;  2XEU A;  5TRB A;  4PPE A;  3RPG B;  2L7P A;  4CA1 A;  3U5O A;  3N9N A;  3IHP A;  5FB1 A;  5KH3 A;  4B86 C;  5KH9 A;  4LJN A;  2LV9 A;  3I2D A;  2ECW A;  2KGG A;  4C9Z A;  3V43 A;  2MNY A;  4AVX A;  3N9L A;  3LJU X;  2JRJ A;  2H0D A;  4Q6F A;  2Y1N A;  2VJE B;  2YQL A;  2QIC A;  5J3X A;  5B78 A;  4TKP B;  2CSV A;  5LKX A;  5H1U A;  4CCG X;  2LXP C;  2K17 A;  2KWN A;  5H1T A;  2OWA A;  5SVI A;  4FK5 A;  4UP0 A;  1JM7 B;  4WZ3 B;  3FM8 C;  4AYC A;  2UZG A;  3E2D A;  4V3L C;  2KFT A;  4WA6 A;  4YC9 A;  4FIP A;  5G04 B;  5D1L B;  1WEM A;  1HYJ A;  3FAO A;  5KH7 A;  2LGG A;  2YQM A;  3ZYQ A;  1DVP A;  3O70 A;  2M3H A;  4YBT A;  3T7L A;  2LGK A;  5JG6 A;  2CSZ A;  2CKL B;  1HYI A;  2L75 A;  4BBQ A;  4F52 B;  2YRE A;  3JUE A;  4YAD A;  2AN6 A;  5H1V A;  3T9K A;  3N9O A;  2CRR A;  2MA6 A;  2LAU A;  3M7K A;  4YAB A;  2ZET C;  4ZUX U;  1N87 A;  2C2L A;  3ZPV 1;  1Z6U A;  2MA5 A;  5SVX A;  5FEY A;  2VPG A;  3O34 A;  3N9M A;  5DKA A;  2XP0 A;  5C13 A;  2K4D A;  3MDB C;  2MUM A;  5C11 A;  2VNF A;  2LQ6 A;  2P57 A;  1JOC A;  4R7E A;  5B77 A;  3KDE C;  2KGI A;  4I7D A;  2M1R A;  4AUQ B;  4OGC A;  2XOY A;  2ECG A;  3DDT A;  4N4F A;  4LKA A;  2PNX A;  2KYU A;  4I7B A;  1WEN A;  3M99 A;  4NN2 A;  3HTK C;  5FER A;  4R2Y A;  2CON A;  2F6J A;  2RR4 A;  3U5N A;  2E61 A;  4AP4 A;  2FUI A;  3ZNI A;  4A4B A;  2ECJ A;  2VP7 A;  3O36 A;  1MM3 A;  3EB5 A;  3L1Z B;  4MSX A;  4GND A;  2E6R A;  5LCW B;  5B75 A;  1WEO A;  1WIL A;  2KE1 A;  2KKY A;  5AIU A;  3C6W A;  2QIZ A;  4W4U A;  4I7C A;  3L1X A;  4H9D A;  2LGV A;  2BAY A;  2PUY A;  2JM3 A;  1WEU A;  2D8U A;  2JMD A;  2VPE A;  3FL2 A;  3SOW A;  4S3O B;  3T6R A;  3LVR E;  2EXU A;  2L43 A;  2MKE A;  2IDA A;  3FAN A;  2KU3 A;  3LQJ A;  4YAX A;  5I3L A;  4YAT A;  3LQI A;  4UP5 A;  2QJ0 A;  4L7X A;  5SVY A;  1VD4 A;  2FSA A;  2EA6 A;  2DX8 A;  5TDR A;  2EOD A;  1Z2Q A;  1FP0 A;  3HCT A;  3GL6 A;  5G05 B;  2M6M A;  1FBV A;  3H7H A;  3FEH A;  1VYX A;  2KR4 A;  4MVT A;  2CRW A;  4R8P K;  2HYE D;  3KQI A;  2H0D B;  3Q1D A;  5FB0 A;  1X4J A;  2JMI A;  4QF2 A;  1WEV A;  3ASL A;  1V87 A;  2CT2 A;  2MNZ A;  2MT5 A;  1WEP A;  3PLW A;  2YHN A;  3LVQ E;  2K16 A;  2G45 A;  5B8D A;  4S3O C;  4QF3 A;  5SVI B;  1VFY A;  3U5M A;  3MHH A;  1WEW A;  4AYC B;  4GNF A;  1G25 A;  2VPD A;  2KWJ A;  3QZV A;  1MM2 A;  2LGL A;  2NAA A;  3LQH A;  1WES A;  3M63 A;  3SOU A;  2DSM A;  2Y1M A;  4GB0 A;  4X3G A;  2VPB A;  4FO9 A;  2YSJ A;  1XWH A;  4BHW A;  4FJC A;  2XOZ A;  5H9M A;  2K1J A;  5D1M B;  2VJE A;  4QQ4 A;  4LLB A;  3L11 A;  4OGE A;  2LRI C;  2YT5 A;  4N3W A;  1K2F A;  5LKU A;  4A49 A;  3U5P A;  4P5O B;  1JM7 A;  1MBM A;  2KWO A;  1WEQ A;  4O62 A;  2YW8 A;  2XOC A;  4O64 A;  3LDY A;  3SHB A;  1WFK A;  2M13 A;  2YSM A;  5EYA F;  2B0O E;  2FUU A;  5AIT A;  5TAB A;  4A4C A;  2XB1 A;  3DWD A;  4YBM A;  4GNE A;  1X4U A;  2ECV A;  4WZ0 A;  1CHC A;  4Z0R A;  3HCS A;  2YUR A;  3HCU A;  2FFW A;  2MD7 B;  3SUB A;  3M62 A;  4V3K C;  2CKL A;  1BOR A;  3ZVY A;  3GV4 A;  5G0F A;  1DCQ A;  2YVR A;  1LDJ B;  5DIN A;  4YBS A;  3PUQ A;  5D1K B;  3RTR B;  2DJA A;  4B7Y C;  3O47 A;  2EGP A;  4GNG A;  3O7A A;  2YUC A;  2LDR A;  2VJF B;  1Z60 A;  2F6N A;  3NG2 A;  5B76 A;  2G43 A;  4LK9 A;  3VK6 A;  3PUR A;  2Y43 A;  3DQV R;  2MIQ A;  1ZBD B;  2CSY A;  2L5U A;  3KV6 A;  5TDW A;  3KNV A;  4ZQL A;  3LRQ A;  2HDP A;  1T1H A;  5LKZ A;  3RPG C;  4WZ2 A;  5LKT A;  1RMD A;  5B79 A;  2M85 A;  4IC2 A;  1WGM A;  4PTB A;  2KRE A;  4Z0O A;  2IQJ A;  1IYM A;  3PHD A;  3ZTG A;  3O33 A;  2KWK A;  2MD8 C;  4XI1 A;  2JUN A;  3FJU B;  1WE9 A;  2KKX A;  3SOX A;  3N9P A;  2G6Q A;  3N9Q A;  4UI9 B;  3ZVZ B;  2ECT A;  4A0C D;  1X4I A;  2RI7 A;  4L58 A;  2LN0 A;  1F62 A;  2RSD A;  4IC3 A;  2YU4 A;  2OXQ C;  1U6G B;  3MHS A;  3EB6 A;  4F1P A;  2F42 A;  2FD4 A;  1E4U A;  3ZPV E;  2KIZ A;  2EGM A;  3C5K A;  3KV5 A;  2ECI A;  3O37 A;  2ECN A;  2D8S A;  4ZDT A;  5TBN A;  3O35 A;  2YHO A;  2LXH C;  1WEE A;  2L0B A;  3DPL R;  2L80 A;  2E6S A;  2JMJ A;  2C2V S;  2VJF A; 
#chains in the Genus database with same CATH homology
 2YRE A;  2DJA A;  2M13 A;  3O47 A;  3FM8 C;  2JM3 A;  3JUE A;  2B0O E;  2D8U A;  2XOZ A;  3E2D A;  2EGM A;  2XP0 A;  5SVI B;  3DWD A;  3LJU X;  4QQ4 A;  5K3Q A;  3T9K A;  4OGE A;  3LVR E;  4Z0R A;  2FD4 A;  2CRR A;  2EXU A;  3MDB C;  3H7H A;  2MKE A;  3FEH A;  3LVQ E;  2LAU A;  2L7P A;  4Z0O A;  2CRW A;  2IQJ A;  2KKY A;  2FFW A;  3M7K A;  2CON A;  2CSV A;  3SUB A;  2P57 A;  3Q1D A;  3KDE C;  2RR4 A;  5SVX A;  2OWA A;  1DCQ A;  3PLW A;  2E61 A;  4O62 A;  2YVR A;  4H9D A;  2JUN A;  3FJU B;  4OGC A;  5SVI A;  2XOY A;  5SVY A;  2XOC A;  3LDY A;  4F1P A;  3DDT A;  2KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...