2L7PA

Ashh2 a cw domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CW domain, a new histone recognition module in chromatin proteins.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASHH2
total genus 8
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2l7pA00
4Z0OA 5SVIB 5SVIA 2L7PA 2E61A 4O62A 5SVYA 4Z0RA 2RR4A 5SVXA 4QQ4A
chains in the Genus database with same CATH superfamily
3KV6A 4F52B 1WEVA 5H1UA 2E61A 4X3GA 3DQVR 2C2VS 4AP4A 2NAAA 2M6MA 2I50A 2VP7A 3ZVYA 2M1RA 5D1LB 2FUIA 1RMDA 2ECIA 2JRJA 4ZUXU 2XOCA 2KKYA 2ECWA 3L11A 1DCQA 2VJFA 3T9KA 2CONA 2MUMA 2M13A 5FERA 4FK5A 3GV4A 2PNXA 2KFTA 3L1XA 2MA6A 1WEMA 2IDAA 5D1MB 1Z60A 2FUUA 2EODA 3MHSA 3O34A 4LK9A 4MVTA 2F42A 2MIQA 5DKAA 2XOZA 4CCGX 3N9PA 2EGMA 4MSXA 4I7CA 5B76A 5C11A 2RSDA 4WZ2A 5TBNA 4B7YC 2Y1NA 1WFKA 3O70A 2KE1A 2CT2A 2LQ6A 3U5NA 4GNFA 3U5PA 2E6SA 2LXHC 4FJCA 1XWHA 2L7PA 4XI1A 4Z0RA 2YW8A 4NN2A 2ECNA 2M85A 3SOUA 2Y43A 1IYMA 1WESA 2VJEB 2L43A 4W4UA 2HDPA 2CSVA 4GB0A 2KGGA 3O35A 2PUYA 4YADA 3HCUA 2P57A 2MNYA 3ZNIA 1WIMA 1FBVA 3JUEA 4YBMA 2YQLA 3HCTA 5FEYA 1G25A 2LGLA 1WEOA 4YBSA 1WEUA 3I2DA 2KWOA 5FB1A 2XOYA 3SHBA 4BBQA 2XB1A 1WEPA 5G05B 4GNEA 5FB0A 2QJ0A 2IQJA 2VNFA 5LKUA 3LQHA 5C13A 4WZ0A 3VK6A 5LCWB 1LDKC 3E2DA 2JMDA 2VPEA 3FJUB 2F6NA 2CSYA 2JUNA 4B86C 4YATA 1Z2QA 3KQIA 2DSMA 1VD4A 5EYAF 2K1JA 3M62A 4N3WA 5LKXA 3PURA 5B79A 2HYED 4GNGA 2M3HA 3O47A 2K17A 2E6RA 3RPGC 4IC3A 3KV5A 2EGPA 2VPGA 2KGIA 4H9DA 3N9LA 5B77A 4LJNA 4L7XA 4LLBA 1JOCA 4ZQLA 1WEEA 2CSZA 4UP0A 2MNZA 3C5KA 2CKLA 4A0CD 3MDBC 3Q1DA 2G43A 3FAOA 1WILA 1X4IA 3V43A 3U5OA 4WA6A 4A4BA 4IC2A 2YHNA 1X4JA 3N9QA 2VJFB 4C9ZA 3LDYA 2ECJA 4AVXA 3O33A 3KNVA 1Z6UA 4O64A 3ZTGA 4GNDA 2LXPC 5KH9A 5G0FA 3FL2A 3LQIA 4FIPA 4CA1A 4V3LC 4OGEA 2KR4A 4AYCA 4AYCB 2BAYA 2LN0A 2ZETC 3LVQE 1K2FA 2JM3A 4I7DA 3H7HA 2LV9A 2CRWA 5AIUA 2K16A 4N4FA 3PHDA 2MD8C 4F1PA 3FM8C 2LGGA 5TABA 3EB6A 3FEHA 3NG2A 3N9MA 4UI9B 2CRRA 3N9NA 4ZDTA 2LGKA 5H1TA 5JG6A 2FD4A 3M99A 3LVRE 3T7LA 5SVYA 4QQ4A 1VYXA 3L1ZB 4UP5A 1E4UA 4YABA 2LRIC 2KKXA 2KREA 1N87A 5DINA 2AN6A 3C6WA 3O7AA 1X4UA 3KDEC 2EA6A 1HYIA 3DPLR 2UZGA 3M7KA 2H0DB 4S3OB 4Z0OA 1ZBDB 2H0DA 5B8DA 2FFWA 1MM2A 1MM3A 2D8UA 2LGVA 3SOXA 2MA5A 2KIZA 2Y1MA 4PPEA 5TDWA 1U6GB 5LKZA 3RTRB 5K3QA 2YHOA 2VPDA 1CHCA 2YT5A 4OGCA 2YSMA 2JMIA 4QF2A 2D8SA 1WEWA 5KH7A 3HTKC 2YQMA 5TRBA 5I3LA 4A49A 3M63A 2MT5A 2LDRA 4R8PK 2DX8A 2MKEA 1WGMA 2DJAA 2C2LA 2OWAA 4YAXA 3LRQA 4V3KC 3QZVA 4PTBA 3PLWA 3MHHA 3LQJA 4R7EA 2K4DA 2YYRA 2KWJA 1WENA 4AUQB 3ZPV1 2YREA 2JMJA 3DWDA 3GL6A 2RI7A 2L80A 1JM7A 2XEUA 1JM7B 4LADB 2KWKA 3ZVZB 2MD7B 2EXUA 2ECGA 2XP0A 3FANA 1DVPA 3IHPA 2QICA 5SVIB 4TKPB 4R2YA 3ZPVE 5SVIA 3DDTA 2YU4A 1T1HA 4BHWA 4A4CA 2L75A 5KH3A 2KU3A 1MBMA 5G04B 4L58A 2G6QA 1LDJB 2CKLB 4S3OC 5J3XA 2L0BA 2FSAA 3U5MA 2YVRA 3T6RA 4YC9A 4WZ3B 3HCSA 1HYJA 2OXQC 2L5UA 3O37A 3SUBA 3SOWA 5B78A 5LKTA 2ECTA 2VJEA 2G45A 2RR4A 3RPGB 2LAUA 5H1VA 3LJUX 2F6JA 3ZYQA 5H9MA 2ECVA 1WEQA 4O62A 4P5OB 4LKAA 2VPBA 3PUQA 4QF3A 5SVXA 1WE9A 2KWNA 4Q6FA 4YBTA 3N9OA 3EB5A 4FO9A 5TDRA 2KYUA 1VFYA 2QIZA 2YSJA 5D1KB 1BORA 2YURA 2YUCA 3O36A 5B75A 1V87A 1F62A 1FP0A 4I7BA 2B0OE 5AITA 3ASLA
chains in the Genus database with same CATH topology
2P57A 3FEHA 5K3QA 3O47A 2E61A 2L7PA 3LVQE 2XOZA 4O62A 4Z0RA 2CONA 2EGMA 4OGCA 2EXUA 2IQJA 5SVXA 2JM3A 3T9KA 3JUEA 3LDYA 3H7HA 2CRRA 2YVRA 2CRWA 2M13A 4H9DA 3PLWA 4Z0OA 2XP0A 2FD4A 3M7KA 3LVRE 5SVYA 2FFWA 3E2DA 4QQ4A 3SUBA 5SVIB 3FJUB 2KKXA 2JUNA 5SVIA 2D8UA 3DDTA 2YREA 3MDBC 3Q1DA 2RR4A 2XOCA 3DWDA 3FM8C 2KKYA 2CSVA 2MKEA 2XOYA 2LAUA 2B0OE 2DJAA 4OGEA 4F1PA 3KDEC 2OWAA 3LJUX 1DCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0O A;  5SVI B;  5SVI A;  2L7P A;  2E61 A;  4O62 A;  5SVY A;  4Z0R A;  2RR4 A;  5SVX A;  4QQ4 A; 
#chains in the Genus database with same CATH topology
 3KV6 A;  4F52 B;  1WEV A;  5H1U A;  2E61 A;  4X3G A;  3DQV R;  2C2V S;  4AP4 A;  2NAA A;  2M6M A;  2I50 A;  2VP7 A;  3ZVY A;  2M1R A;  5D1L B;  2FUI A;  1RMD A;  2ECI A;  2JRJ A;  4ZUX U;  2XOC A;  2KKY A;  2ECW A;  3L11 A;  1DCQ A;  2VJF A;  3T9K A;  2CON A;  2MUM A;  2M13 A;  5FER A;  4FK5 A;  3GV4 A;  2PNX A;  2KFT A;  3L1X A;  2MA6 A;  1WEM A;  2IDA A;  5D1M B;  1Z60 A;  2FUU A;  2EOD A;  3MHS A;  3O34 A;  4LK9 A;  4MVT A;  2F42 A;  2MIQ A;  5DKA A;  2XOZ A;  4CCG X;  3N9P A;  2EGM A;  4MSX A;  4I7C A;  5B76 A;  5C11 A;  2RSD A;  4WZ2 A;  5TBN A;  4B7Y C;  2Y1N A;  1WFK A;  3O70 A;  2KE1 A;  2CT2 A;  2LQ6 A;  3U5N A;  4GNF A;  3U5P A;  2E6S A;  2LXH C;  4FJC A;  1XWH A;  2L7P A;  4XI1 A;  4Z0R A;  2YW8 A;  4NN2 A;  2ECN A;  2M85 A;  3SOU A;  2Y43 A;  1IYM A;  1WES A;  2VJE B;  2L43 A;  4W4U A;  2HDP A;  2CSV A;  4GB0 A;  2KGG A;  3O35 A;  2PUY A;  4YAD A;  3HCU A;  2P57 A;  2MNY A;  3ZNI A;  1WIM A;  1FBV A;  3JUE A;  4YBM A;  2YQL A;  3HCT A;  5FEY A;  1G25 A;  2LGL A;  1WEO A;  4YBS A;  1WEU A;  3I2D A;  2KWO A;  5FB1 A;  2XOY A;  3SHB A;  4BBQ A;  2XB1 A;  1WEP A;  5G05 B;  4GNE A;  5FB0 A;  2QJ0 A;  2IQJ A;  2VNF A;  5LKU A;  3LQH A;  5C13 A;  4WZ0 A;  3VK6 A;  5LCW B;  1LDK C;  3E2D A;  2JMD A;  2VPE A;  3FJU B;  2F6N A;  2CSY A;  2JUN A;  4B86 C;  4YAT A;  1Z2Q A;  3KQI A;  2DSM A;  1VD4 A;  5EYA F;  2K1J A;  3M62 A;  4N3W A;  5LKX A;  3PUR A;  5B79 A;  2HYE D;  4GNG A;  2M3H A;  3O47 A;  2K17 A;  2E6R A;  3RPG C;  4IC3 A;  3KV5 A;  2EGP A;  2VPG A;  2KGI A;  4H9D A;  3N9L A;  5B77 A;  4LJN A;  4L7X A;  4LLB A;  1JOC A;  4ZQL A;  1WEE A;  2CSZ A;  4UP0 A;  2MNZ A;  3C5K A;  2CKL A;  4A0C D;  3MDB C;  3Q1D A;  2G43 A;  3FAO A;  1WIL A;  1X4I A;  3V43 A;  3U5O A;  4WA6 A;  4A4B A;  4IC2 A;  2YHN A;  1X4J A;  3N9Q A;  2VJF B;  4C9Z A;  3LDY A;  2ECJ A;  4AVX A;  3O33 A;  3KNV A;  1Z6U A;  4O64 A;  3ZTG A;  4GND A;  2LXP C;  5KH9 A;  5G0F A;  3FL2 A;  3LQI A;  4FIP A;  4CA1 A;  4V3L C;  4OGE A;  2KR4 A;  4AYC A;  4AYC B;  2BAY A;  2LN0 A;  2ZET C;  3LVQ E;  1K2F A;  2JM3 A;  4I7D A;  3H7H A;  2LV9 A;  2CRW A;  5AIU A;  2K16 A;  4N4F A;  3PHD A;  2MD8 C;  4F1P A;  3FM8 C;  2LGG A;  5TAB A;  3EB6 A;  3FEH A;  3NG2 A;  3N9M A;  4UI9 B;  2CRR A;  3N9N A;  4ZDT A;  2LGK A;  5H1T A;  5JG6 A;  2FD4 A;  3M99 A;  3LVR E;  3T7L A;  5SVY A;  4QQ4 A;  1VYX A;  3L1Z B;  4UP5 A;  1E4U A;  4YAB A;  2LRI C;  2KKX A;  2KRE A;  1N87 A;  5DIN A;  2AN6 A;  3C6W A;  3O7A A;  1X4U A;  3KDE C;  2EA6 A;  1HYI A;  3DPL R;  2UZG A;  3M7K A;  2H0D B;  4S3O B;  4Z0O A;  1ZBD B;  2H0D A;  5B8D A;  2FFW A;  1MM2 A;  1MM3 A;  2D8U A;  2LGV A;  3SOX A;  2MA5 A;  2KIZ A;  2Y1M A;  4PPE A;  5TDW A;  1U6G B;  5LKZ A;  3RTR B;  5K3Q A;  2YHO A;  2VPD A;  1CHC A;  2YT5 A;  4OGC A;  2YSM A;  2JMI A;  4QF2 A;  2D8S A;  1WEW A;  5KH7 A;  3HTK C;  2YQM A;  5TRB A;  5I3L A;  4A49 A;  3M63 A;  2MT5 A;  2LDR A;  4R8P K;  2DX8 A;  2MKE A;  1WGM A;  2DJA A;  2C2L A;  2OWA A;  4YAX A;  3LRQ A;  4V3K C;  3QZV A;  4PTB A;  3PLW A;  3MHH A;  3LQJ A;  4R7E A;  2K4D A;  2YYR A;  2KWJ A;  1WEN A;  4AUQ B;  3ZPV 1;  2YRE A;  2JMJ A;  3DWD A;  3GL6 A;  2RI7 A;  2L80 A;  1JM7 A;  2XEU A;  1JM7 B;  4LAD B;  2KWK A;  3ZVZ B;  2MD7 B;  2EXU A;  2ECG A;  2XP0 A;  3FAN A;  1DVP A;  3IHP A;  2QIC A;  5SVI B;  4TKP B;  4R2Y A;  3ZPV E;  5SVI A;  3DDT A;  2YU4 A;  1T1H A;  4BHW A;  4A4C A;  2L75 A;  5KH3 A;  2KU3 A;  1MBM A;  5G04 B;  4L58 A;  2G6Q A;  1LDJ B;  2CKL B;  4S3O C;  5J3X A;  2L0B A;  2FSA A;  3U5M A;  2YVR A;  3T6R A;  4YC9 A;  4WZ3 B;  3HCS A;  1HYJ A;  2OXQ C;  2L5U A;  3O37 A;  3SUB A;  3SOW A;  5B78 A;  5LKT A;  2ECT A;  2VJE A;  2G45 A;  2RR4 A;  3RPG B;  2LAU A;  5H1V A;  3LJU X;  2F6J A;  3ZYQ A;  5H9M A;  2ECV A;  1WEQ A;  4O62 A;  4P5O B;  4LKA A;  2VPB A;  3PUQ A;  4QF3 A;  5SVX A;  1WE9 A;  2KWN A;  4Q6F A;  4YBT A;  3N9O A;  3EB5 A;  4FO9 A;  5TDR A;  2KYU A;  1VFY A;  2QIZ A;  2YSJ A;  5D1K B;  1BOR A;  2YUR A;  2YUC A;  3O36 A;  5B75 A;  1V87 A;  1F62 A;  1FP0 A;  4I7B A;  2B0O E;  5AIT A;  3ASL A; 
#chains in the Genus database with same CATH homology
 2P57 A;  3FEH A;  5K3Q A;  3O47 A;  2E61 A;  2L7P A;  3LVQ E;  2XOZ A;  4O62 A;  4Z0R A;  2CON A;  2EGM A;  4OGC A;  2EXU A;  2IQJ A;  5SVX A;  2JM3 A;  3T9K A;  3JUE A;  3LDY A;  3H7H A;  2CRR A;  2YVR A;  2CRW A;  2M13 A;  4H9D A;  3PLW A;  4Z0O A;  2XP0 A;  2FD4 A;  3M7K A;  3LVR E;  5SVY A;  2FFW A;  3E2D A;  4QQ4 A;  3SUB A;  5SVI B;  3FJU B;  2KKX A;  2JUN A;  5SVI A;  2D8U A;  3DDT A;  2YRE A;  3MDB C;  3Q1D A;  2RR4 A;  2XOC A;  3DWD A;  3FM8 C;  2KKY A;  2CSV A;  2MKE A;  2XOY A;  2LAU A;  2B0O E;  2DJA A;  4OGE A;  4F1P A;  3KDE C;  2OWA A;  3LJU X;  1DCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...