2L7PA

Ashh2 a cw domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase ASHH2
publication title The CW domain, a new histone recognition module in chromatin proteins.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 8
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2l7pA00
2RR4A 5SVIB 5SVXA 5SVYA 4Z0RA 2L7PA 2E61A 4O62A 4QQ4A 5SVIA 4Z0OA
chains in the Genus database with same CATH superfamily
2M1RA 2YVRA 4N3WA 4QF3A 3FANA 4A4BA 3KDEC 2EGMA 3M7KA 4QF2A 4CA1A 2YW8A 2KU3A 3LQJA 4O62A 2EXUA 1WESA 2FD4A 2HYED 2DJAA 4N4FA 2VPBA 4YABA 3U5PA 2PUYA 1VD4A 1U6GB 2KREA 5TDRA 5G05B 1Z6UA 2MA6A 4GNDA 2ZETC 1WENA 2FUIA 2YURA 2PNXA 2VJFA 4LK9A 3N9OA 3FEHA 3KV6A 3LJUX 2LAUA 1LDJB 4R2YA 5LKUA 3RPGC 2G45A 4LJNA 3DPLR 2LGVA 2JMIA 5FERA 2L5UA 4B86C 2YU4A 4ZDTA 1WGMA 4CCGX 3SUBA 2YT5A 4I7DA 4A4CA 4QQ4A 2VJEA 2D8SA 4XI1A 2MD8C 3SHBA 5SVIA 2L75A 3T6RA 3ZNIA 3U5MA 3HCUA 2KKYA 3N9PA 4YBSA 4NN2A 2YQMA 2KWKA 3I2DA 3KNVA 3PHDA 4O64A 3LQIA 2LGLA 4UI9B 2XEUA 1ZBDB 2LXPC 3U5NA 4B7YC 1WILA 3M62A 2M6MA 5TRBA 3EB6A 4C9ZA 4V3KC 1V87A 2Y1NA 5B76A 2JMJA 5DINA 5SVXA 2K1JA 3O37A 5KH7A 2RR4A 2C2VS 2CKLA 4F1PA 2VNFA 4S3OB 2ECIA 2MKEA 2LRIC 4UP0A 2XP0A 3N9NA 4L7XA 1JM7B 2H0DA 4R7EA 3O47A 4GNEA 3EB5A 2YSMA 1DCQA 4Z0OA 2XOZA 1LDKC 2QIZA 5C11A 5C13A 2CSZA 1Z2QA 2KWOA 4TKPB 3ZPVE 3LRQA 2E61A 2KWNA 3RTRB 1BORA 2B0OE 4YBMA 1CHCA 2MT5A 2FUUA 1E4UA 3H7HA 1FP0A 3ZVZB 4IC2A 4X3GA 4GNGA 4MSXA 4OGEA 3QZVA 5B77A 2KR4A 4WZ2A 2RSDA 3C5KA 2K4DA 2ECJA 5H9MA 3Q1DA 4YAXA 4W4UA 5D1KB 2MNZA 1MBMA 1WFKA 2CRRA 2L43A 5LKTA 5D1LB 1X4JA 2NAAA 1HYJA 1FBVA 2L80A 2L0BA 3HCTA 3DWDA 4I7CA 3DDTA 4V3LC 3SOXA 2ECGA 1F62A 4LKAA 4MVTA 1RMDA 2EODA 2Y43A 4PPEA 1N87A 3ZTGA 2LQ6A 1JOCA 3RPGB 2LV9A 3GV4A 4ZQLA 5EYAF 2YHNA 1WIMA 2MIQA 2VJFB 4Z0RA 2KYUA 3NG2A 5B79A 4R8PK 2KWJA 1WEOA 5LKXA 4YATA 3ZPV1 2M3HA 3O35A 2ECTA 3N9QA 2CRWA 2FSAA 2CT2A 2XOYA 2BAYA 3PURA 5B78A 2HDPA 2EGPA 1WE9A 3T7LA 3O33A 4YBTA 4AYCB 5G0FA 2MUMA 2K16A 4OGCA 4PTBA 2YQLA 4A0CD 2VPGA 2CSVA 2XOCA 4FO9A 3M99A 2LDRA 3SOWA 4BBQA 4FK5A 4FIPA 4GNFA 4WZ3B 2RI7A 3MDBC 4LADB 4WZ0A 4I7BA 2K17A 3FL2A 2IDAA 1WEUA 3LQHA 4UP5A 5TDWA 4AP4A 5B8DA 5FB1A 3T9KA 2F42A 3PLWA 3IHPA 2AN6A 2LGKA 2L7PA 2QICA 2JMDA 3L1ZB 5LKZA 1WEWA 2LGGA 3N9LA 2F6NA 5H1VA 1MM3A 3L11A 2ECWA 2KKXA 2QJ0A 2D8UA 2VPEA 3LVRE 1IYMA 2YREA 4A49A 2C2LA 2ECNA 3MHSA 4L58A 2YSJA 2MNYA 3V43A 2ECVA 1T1HA 1X4UA 2P57A 2JM3A 3O70A 4YC9A 2E6RA 3MHHA 4LLBA 5AITA 5JG6A 2KIZA 3PUQA 5SVYA 2DX8A 4WA6A 2XB1A 2JUNA 1WEQA 5FEYA 1VFYA 2FFWA 2F6JA 5H1TA 2JRJA 3O34A 4IC3A 5FB0A 3LDYA 3O36A 3FM8C 1HYIA 3O7AA 3L1XA 5KH3A 3M63A 2OXQC 2LXHC 3E2DA 2VP7A 2E6SA 2M13A 4FJCA 5KH9A 3HCSA 3DQVR 2UZGA 2MA5A 2M85A 1G25A 1WEEA 4GB0A 2KGGA 2VJEB 3HTKC 3GL6A 4H9DA 4AYCA 5SVIB 2EA6A 2G6QA 3ZVYA 3KV5A 2KFTA 5TBNA 2OWAA 3ASLA 2YUCA 1JM7A 3ZYQA 2G43A 3FAOA 4BHWA 4AVXA 1WEMA 5B75A 1XWHA 3FJUB 4S3OC 3C6WA 1WEVA 2VPDA 2YHOA 5LCWB 1Z60A 3N9MA 1K2FA 4YADA 2YYRA 3LVQE 4Q6FA 2I50A 2IQJA 1WEPA 5TABA 1MM2A 5DKAA 2Y1MA 2DSMA 2CKLB 2CONA 5H1UA 4ZUXU 1X4IA 5AIUA 5K3QA 2LN0A 5D1MB 5I3LA 4AUQB 3U5OA 2KGIA 2H0DB 3JUEA 1VYXA 3SOUA 3KQIA 4F52B 1DVPA 5J3XA 2KE1A 4P5OB 2CSYA 5G04B 3VK6A 2MD7B
chains in the Genus database with same CATH topology
2XP0A 3T9KA 3SUBA 2M13A 3PLWA 3LVRE 2XOCA 2CSVA 2YREA 2YVRA 2L7PA 2CRWA 5SVYA 2B0OE 2XOYA 4QQ4A 3O47A 3FJUB 2CRRA 2JUNA 3H7HA 3KDEC 3JUEA 2FFWA 1DCQA 5SVIA 2EGMA 3M7KA 5SVXA 4Z0OA 2XOZA 3LDYA 3FEHA 3MDBC 3LJUX 2KKYA 2RR4A 3LVQE 2LAUA 2IQJA 4H9DA 4OGEA 5SVIB 3DWDA 4Z0RA 3FM8C 4F1PA 4O62A 2EXUA 2FD4A 3DDTA 2DJAA 2KKXA 2P57A 2OWAA 2JM3A 2CONA 3E2DA 2MKEA 4OGCA 5K3QA 2E61A 2D8UA 3Q1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR4 A;  5SVI B;  5SVX A;  5SVY A;  4Z0R A;  2L7P A;  2E61 A;  4O62 A;  4QQ4 A;  5SVI A;  4Z0O A; 
#chains in the Genus database with same CATH topology
 2M1R A;  2YVR A;  4N3W A;  4QF3 A;  3FAN A;  4A4B A;  3KDE C;  2EGM A;  3M7K A;  4QF2 A;  4CA1 A;  2YW8 A;  2KU3 A;  3LQJ A;  4O62 A;  2EXU A;  1WES A;  2FD4 A;  2HYE D;  2DJA A;  4N4F A;  2VPB A;  4YAB A;  3U5P A;  2PUY A;  1VD4 A;  1U6G B;  2KRE A;  5TDR A;  5G05 B;  1Z6U A;  2MA6 A;  4GND A;  2ZET C;  1WEN A;  2FUI A;  2YUR A;  2PNX A;  2VJF A;  4LK9 A;  3N9O A;  3FEH A;  3KV6 A;  3LJU X;  2LAU A;  1LDJ B;  4R2Y A;  5LKU A;  3RPG C;  2G45 A;  4LJN A;  3DPL R;  2LGV A;  2JMI A;  5FER A;  2L5U A;  4B86 C;  2YU4 A;  4ZDT A;  1WGM A;  4CCG X;  3SUB A;  2YT5 A;  4I7D A;  4A4C A;  4QQ4 A;  2VJE A;  2D8S A;  4XI1 A;  2MD8 C;  3SHB A;  5SVI A;  2L75 A;  3T6R A;  3ZNI A;  3U5M A;  3HCU A;  2KKY A;  3N9P A;  4YBS A;  4NN2 A;  2YQM A;  2KWK A;  3I2D A;  3KNV A;  3PHD A;  4O64 A;  3LQI A;  2LGL A;  4UI9 B;  2XEU A;  1ZBD B;  2LXP C;  3U5N A;  4B7Y C;  1WIL A;  3M62 A;  2M6M A;  5TRB A;  3EB6 A;  4C9Z A;  4V3K C;  1V87 A;  2Y1N A;  5B76 A;  2JMJ A;  5DIN A;  5SVX A;  2K1J A;  3O37 A;  5KH7 A;  2RR4 A;  2C2V S;  2CKL A;  4F1P A;  2VNF A;  4S3O B;  2ECI A;  2MKE A;  2LRI C;  4UP0 A;  2XP0 A;  3N9N A;  4L7X A;  1JM7 B;  2H0D A;  4R7E A;  3O47 A;  4GNE A;  3EB5 A;  2YSM A;  1DCQ A;  4Z0O A;  2XOZ A;  1LDK C;  2QIZ A;  5C11 A;  5C13 A;  2CSZ A;  1Z2Q A;  2KWO A;  4TKP B;  3ZPV E;  3LRQ A;  2E61 A;  2KWN A;  3RTR B;  1BOR A;  2B0O E;  4YBM A;  1CHC A;  2MT5 A;  2FUU A;  1E4U A;  3H7H A;  1FP0 A;  3ZVZ B;  4IC2 A;  4X3G A;  4GNG A;  4MSX A;  4OGE A;  3QZV A;  5B77 A;  2KR4 A;  4WZ2 A;  2RSD A;  3C5K A;  2K4D A;  2ECJ A;  5H9M A;  3Q1D A;  4YAX A;  4W4U A;  5D1K B;  2MNZ A;  1MBM A;  1WFK A;  2CRR A;  2L43 A;  5LKT A;  5D1L B;  1X4J A;  2NAA A;  1HYJ A;  1FBV A;  2L80 A;  2L0B A;  3HCT A;  3DWD A;  4I7C A;  3DDT A;  4V3L C;  3SOX A;  2ECG A;  1F62 A;  4LKA A;  4MVT A;  1RMD A;  2EOD A;  2Y43 A;  4PPE A;  1N87 A;  3ZTG A;  2LQ6 A;  1JOC A;  3RPG B;  2LV9 A;  3GV4 A;  4ZQL A;  5EYA F;  2YHN A;  1WIM A;  2MIQ A;  2VJF B;  4Z0R A;  2KYU A;  3NG2 A;  5B79 A;  4R8P K;  2KWJ A;  1WEO A;  5LKX A;  4YAT A;  3ZPV 1;  2M3H A;  3O35 A;  2ECT A;  3N9Q A;  2CRW A;  2FSA A;  2CT2 A;  2XOY A;  2BAY A;  3PUR A;  5B78 A;  2HDP A;  2EGP A;  1WE9 A;  3T7L A;  3O33 A;  4YBT A;  4AYC B;  5G0F A;  2MUM A;  2K16 A;  4OGC A;  4PTB A;  2YQL A;  4A0C D;  2VPG A;  2CSV A;  2XOC A;  4FO9 A;  3M99 A;  2LDR A;  3SOW A;  4BBQ A;  4FK5 A;  4FIP A;  4GNF A;  4WZ3 B;  2RI7 A;  3MDB C;  4LAD B;  4WZ0 A;  4I7B A;  2K17 A;  3FL2 A;  2IDA A;  1WEU A;  3LQH A;  4UP5 A;  5TDW A;  4AP4 A;  5B8D A;  5FB1 A;  3T9K A;  2F42 A;  3PLW A;  3IHP A;  2AN6 A;  2LGK A;  2L7P A;  2QIC A;  2JMD A;  3L1Z B;  5LKZ A;  1WEW A;  2LGG A;  3N9L A;  2F6N A;  5H1V A;  1MM3 A;  3L11 A;  2ECW A;  2KKX A;  2QJ0 A;  2D8U A;  2VPE A;  3LVR E;  1IYM A;  2YRE A;  4A49 A;  2C2L A;  2ECN A;  3MHS A;  4L58 A;  2YSJ A;  2MNY A;  3V43 A;  2ECV A;  1T1H A;  1X4U A;  2P57 A;  2JM3 A;  3O70 A;  4YC9 A;  2E6R A;  3MHH A;  4LLB A;  5AIT A;  5JG6 A;  2KIZ A;  3PUQ A;  5SVY A;  2DX8 A;  4WA6 A;  2XB1 A;  2JUN A;  1WEQ A;  5FEY A;  1VFY A;  2FFW A;  2F6J A;  5H1T A;  2JRJ A;  3O34 A;  4IC3 A;  5FB0 A;  3LDY A;  3O36 A;  3FM8 C;  1HYI A;  3O7A A;  3L1X A;  5KH3 A;  3M63 A;  2OXQ C;  2LXH C;  3E2D A;  2VP7 A;  2E6S A;  2M13 A;  4FJC A;  5KH9 A;  3HCS A;  3DQV R;  2UZG A;  2MA5 A;  2M85 A;  1G25 A;  1WEE A;  4GB0 A;  2KGG A;  2VJE B;  3HTK C;  3GL6 A;  4H9D A;  4AYC A;  5SVI B;  2EA6 A;  2G6Q A;  3ZVY A;  3KV5 A;  2KFT A;  5TBN A;  2OWA A;  3ASL A;  2YUC A;  1JM7 A;  3ZYQ A;  2G43 A;  3FAO A;  4BHW A;  4AVX A;  1WEM A;  5B75 A;  1XWH A;  3FJU B;  4S3O C;  3C6W A;  1WEV A;  2VPD A;  2YHO A;  5LCW B;  1Z60 A;  3N9M A;  1K2F A;  4YAD A;  2YYR A;  3LVQ E;  4Q6F A;  2I50 A;  2IQJ A;  1WEP A;  5TAB A;  1MM2 A;  5DKA A;  2Y1M A;  2DSM A;  2CKL B;  2CON A;  5H1U A;  4ZUX U;  1X4I A;  5AIU A;  5K3Q A;  2LN0 A;  5D1M B;  5I3L A;  4AUQ B;  3U5O A;  2KGI A;  2H0D B;  3JUE A;  1VYX A;  3SOU A;  3KQI A;  4F52 B;  1DVP A;  5J3X A;  2KE1 A;  4P5O B;  2CSY A;  5G04 B;  3VK6 A;  2MD7 B; 
#chains in the Genus database with same CATH homology
 2XP0 A;  3T9K A;  3SUB A;  2M13 A;  3PLW A;  3LVR E;  2XOC A;  2CSV A;  2YRE A;  2YVR A;  2L7P A;  2CRW A;  5SVY A;  2B0O E;  2XOY A;  4QQ4 A;  3O47 A;  3FJU B;  2CRR A;  2JUN A;  3H7H A;  3KDE C;  3JUE A;  2FFW A;  1DCQ A;  5SVI A;  2EGM A;  3M7K A;  5SVX A;  4Z0O A;  2XOZ A;  3LDY A;  3FEH A;  3MDB C;  3LJU X;  2KKY A;  2RR4 A;  3LVQ E;  2LAU A;  2IQJ A;  4H9D A;  4OGE A;  5SVI B;  3DWD A;  4Z0R A;  3FM8 C;  4F1P A;  4O62 A;  2EXU A;  2FD4 A;  3DDT A;  2DJA A;  2KKX A;  2P57 A;  2OWA A;  2JM3 A;  2CON A;  3E2D A;  2MKE A;  4OGC A;  5K3Q A;  2E61 A;  2D8U A;  3Q1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...