2L7PA

Ashh2 a cw domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase ASHH2
publication title The CW domain, a new histone recognition module in chromatin proteins.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 8
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2l7pA00
2L7PA 4QQ4A 5SVXA 4O62A 2E61A 4Z0OA 5SVIB 5SVYA 2RR4A 5SVIA 4Z0RA
chains in the Genus database with same CATH superfamily
2FUIA 3LVQE 5JG6A 2LN0A 2CKLA 2EXUA 2DX8A 1LDJB 2KYUA 3H7HA 1VD4A 2FSAA 2KFTA 3PURA 1MM3A 3N9PA 5AITA 4I7DA 4FIPA 4Z0RA 4I7BA 2LXPC 1V87A 4F52B 4R8PK 2Y43A 2XEUA 3E2DA 5I3LA 3I2DA 3Q1DA 1VYXA 3ZPVE 2F42A 2JMDA 1HYJA 3FEHA 2LGGA 1Z2QA 5TRBA 3NG2A 2M3HA 4V3KC 2F6JA 3U5NA 2Y1MA 1XWHA 4S3OB 2E6SA 4R2YA 1DCQA 4WA6A 5SVXA 2CSZA 2JUNA 3DQVR 5TABA 2Y1NA 1G25A 4Q6FA 4ZDTA 3N9LA 5J3XA 3FM8C 4WZ3B 3VK6A 2JMIA 2E61A 2CONA 2YVRA 4L7XA 4QF3A 2EA6A 1FP0A 2VPGA 1DVPA 5TBNA 2RI7A 2ECGA 5B77A 3EB5A 3O35A 2CSYA 2KR4A 4CCGX 1WE9A 3LJUX 2YQMA 2K16A 1WEEA 3KQIA 1ZBDB 2RR4A 5TDRA 3SUBA 2XP0A 5D1LB 4YATA 1F62A 2PNXA 2XOZA 2YW8A 2QJ0A 2KREA 5FERA 1WFKA 2YQLA 2L0BA 2KWOA 3L1ZB 2LGKA 1N87A 5TDWA 1BORA 4GNEA 4L58A 3N9MA 5AIUA 4BHWA 1K2FA 3M99A 1X4JA 1WEMA 5LKUA 1WESA 4LLBA 5D1MB 4YBSA 2LQ6A 1T1HA 3KV5A 2ECVA 3KDEC 3RTRB 1WEUA 2XOYA 4B86C 2YURA 4X3GA 3ZPV1 5DKAA 4UP5A 2FUUA 3QZVA 4LK9A 4W4UA 3FANA 4FK5A 3RPGC 1MBMA 5D1KB 5B78A 2VJEB 2H0DB 2EGPA 1X4IA 2B0OE 3LQJA 2VJFB 1Z6UA 2JRJA 2L43A 1WEWA 3N9QA 2CT2A 4AUQB 2KKYA 2LDRA 2VP7A 3ZVYA 2KWJA 4I7CA 4ZQLA 2FFWA 3N9OA 3C6WA 1CHCA 4PPEA 4C9ZA 2ZETC 3FJUB 4GNDA 2EODA 4B7YC 2OWAA 2YHNA 2CRWA 2G6QA 2LRIC 2YYRA 2D8UA 2VPDA 3L1XA 2ECJA 3SOXA 2OXQC 3MDBC 4WZ0A 3T9KA 1FBVA 2YSJA 2DJAA 5SVIB 3O37A 3GL6A 4YBTA 3PLWA 4A49A 2NAAA 4AYCB 5B8DA 3ASLA 3PUQA 5H1TA 2IDAA 2KWNA 3IHPA 3ZVZB 3HCTA 3O47A 2L80A 3O36A 5H1VA 3DDTA 2CSVA 2YU4A 2KGIA 4MVTA 2KE1A 3O70A 4AVXA 3ZTGA 2ECWA 3N9NA 2LGVA 4IC2A 4MSXA 1WEQA 3LDYA 2YSMA 1RMDA 5H1UA 2CRRA 2M1RA 2VPEA 3HCSA 5KH7A 4YBMA 4GNFA 5B75A 1JM7B 4GB0A 2F6NA 2M13A 4ZUXU 3U5OA 5EYAF 4V3LC 2CKLB 4TKPB 5LKZA 2C2VS 1WEPA 3ZNIA 4OGEA 1MM2A 2LXHC 2VPBA 3M63A 2MIQA 3EB6A 3PHDA 2E6RA 1JOCA 2RSDA 4YABA 2ECIA 4O64A 4FJCA 5KH9A 3LRQA 2QIZA 5LKXA 2PUYA 5G04B 4IC3A 3FL2A 1E4UA 3KV6A 2AN6A 2JMJA 4XI1A 2EGMA 3T7LA 4YAXA 3KNVA 5KH3A 2LV9A 3ZYQA 2KGGA 2ECTA 4A0CD 5C13A 3SOUA 2LGLA 4F1PA 2KWKA 1LDKC 5FEYA 2MA6A 2BAYA 2VNFA 2M6MA 2D8SA 4R7EA 5B76A 2IQJA 2UZGA 3LQHA 4OGCA 5C11A 2XB1A 2MD7B 2MKEA 2QICA 3T6RA 2KKXA 1VFYA 3DWDA 3HTKC 2FD4A 4FO9A 4A4CA 4A4BA 2I50A 2YHOA 1WGMA 4QF2A 5LCWB 2VJEA 2DSMA 2H0DA 4P5OB 4N4FA 2MD8C 3FAOA 2VJFA 4GNGA 4UP0A 1X4UA 1Z60A 2P57A 5FB1A 4QQ4A 3M62A 1WILA 2YT5A 3LQIA 4LADB 3LVRE 3U5MA 2HDPA 5B79A 4WZ2A 4LJNA 2XOCA 2L7PA 1WEVA 1WEOA 2MNZA 4N3WA 4O62A 4AP4A 3L11A 2YUCA 3C5KA 1IYMA 5K3QA 2MNYA 3DPLR 2C2LA 2K17A 3RPGB 2ECNA 4YC9A 2KIZA 5G0FA 5SVIA 3SHBA 5LKTA 5G05B 4UI9B 4AYCA 3O33A 5FB0A 3V43A 3HCUA 2KU3A 4S3OC 1WENA 4H9DA 3GV4A 4LKAA 3M7KA 2G45A 4CA1A 4PTBA 1HYIA 3MHSA 4Z0OA 2JM3A 2M85A 2LAUA 4BBQA 4YADA 2K4DA 5H9MA 3O34A 5SVYA 2L5UA 5DINA 2L75A 1WIMA 4NN2A 2MUMA 2MT5A 2MA5A 3SOWA 3O7AA 3MHHA 2YREA 3U5PA 2G43A 1JM7A 3JUEA 1U6GB 2HYED 2K1JA
chains in the Genus database with same CATH topology
2XOCA 2LAUA 3LVQE 2L7PA 3O47A 2KKYA 2EXUA 3FM8C 2RR4A 2IQJA 3MDBC 3Q1DA 5SVYA 3T9KA 3SUBA 2M13A 2EGMA 2XP0A 3H7HA 2DJAA 3DDTA 2FFWA 4OGCA 3FEHA 2CSVA 5SVIB 2E61A 4O62A 2CONA 2YVRA 2MKEA 4H9DA 4Z0RA 2XOZA 2P57A 3PLWA 2KKXA 4QQ4A 2YREA 3DWDA 5K3QA 3M7KA 3FJUB 4OGEA 4F1PA 1DCQA 2OWAA 2FD4A 2CRWA 2B0OE 3LDYA 3JUEA 3LVRE 3E2DA 3KDEC 5SVXA 3LJUX 4Z0OA 2JUNA 2JM3A 2D8UA 2XOYA 5SVIA 2CRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  4QQ4 A;  5SVX A;  4O62 A;  2E61 A;  4Z0O A;  5SVI B;  5SVY A;  2RR4 A;  5SVI A;  4Z0R A; 
#chains in the Genus database with same CATH topology
 2FUI A;  3LVQ E;  5JG6 A;  2LN0 A;  2CKL A;  2EXU A;  2DX8 A;  1LDJ B;  2KYU A;  3H7H A;  1VD4 A;  2FSA A;  2KFT A;  3PUR A;  1MM3 A;  3N9P A;  5AIT A;  4I7D A;  4FIP A;  4Z0R A;  4I7B A;  2LXP C;  1V87 A;  4F52 B;  4R8P K;  2Y43 A;  2XEU A;  3E2D A;  5I3L A;  3I2D A;  3Q1D A;  1VYX A;  3ZPV E;  2F42 A;  2JMD A;  1HYJ A;  3FEH A;  2LGG A;  1Z2Q A;  5TRB A;  3NG2 A;  2M3H A;  4V3K C;  2F6J A;  3U5N A;  2Y1M A;  1XWH A;  4S3O B;  2E6S A;  4R2Y A;  1DCQ A;  4WA6 A;  5SVX A;  2CSZ A;  2JUN A;  3DQV R;  5TAB A;  2Y1N A;  1G25 A;  4Q6F A;  4ZDT A;  3N9L A;  5J3X A;  3FM8 C;  4WZ3 B;  3VK6 A;  2JMI A;  2E61 A;  2CON A;  2YVR A;  4L7X A;  4QF3 A;  2EA6 A;  1FP0 A;  2VPG A;  1DVP A;  5TBN A;  2RI7 A;  2ECG A;  5B77 A;  3EB5 A;  3O35 A;  2CSY A;  2KR4 A;  4CCG X;  1WE9 A;  3LJU X;  2YQM A;  2K16 A;  1WEE A;  3KQI A;  1ZBD B;  2RR4 A;  5TDR A;  3SUB A;  2XP0 A;  5D1L B;  4YAT A;  1F62 A;  2PNX A;  2XOZ A;  2YW8 A;  2QJ0 A;  2KRE A;  5FER A;  1WFK A;  2YQL A;  2L0B A;  2KWO A;  3L1Z B;  2LGK A;  1N87 A;  5TDW A;  1BOR A;  4GNE A;  4L58 A;  3N9M A;  5AIU A;  4BHW A;  1K2F A;  3M99 A;  1X4J A;  1WEM A;  5LKU A;  1WES A;  4LLB A;  5D1M B;  4YBS A;  2LQ6 A;  1T1H A;  3KV5 A;  2ECV A;  3KDE C;  3RTR B;  1WEU A;  2XOY A;  4B86 C;  2YUR A;  4X3G A;  3ZPV 1;  5DKA A;  4UP5 A;  2FUU A;  3QZV A;  4LK9 A;  4W4U A;  3FAN A;  4FK5 A;  3RPG C;  1MBM A;  5D1K B;  5B78 A;  2VJE B;  2H0D B;  2EGP A;  1X4I A;  2B0O E;  3LQJ A;  2VJF B;  1Z6U A;  2JRJ A;  2L43 A;  1WEW A;  3N9Q A;  2CT2 A;  4AUQ B;  2KKY A;  2LDR A;  2VP7 A;  3ZVY A;  2KWJ A;  4I7C A;  4ZQL A;  2FFW A;  3N9O A;  3C6W A;  1CHC A;  4PPE A;  4C9Z A;  2ZET C;  3FJU B;  4GND A;  2EOD A;  4B7Y C;  2OWA A;  2YHN A;  2CRW A;  2G6Q A;  2LRI C;  2YYR A;  2D8U A;  2VPD A;  3L1X A;  2ECJ A;  3SOX A;  2OXQ C;  3MDB C;  4WZ0 A;  3T9K A;  1FBV A;  2YSJ A;  2DJA A;  5SVI B;  3O37 A;  3GL6 A;  4YBT A;  3PLW A;  4A49 A;  2NAA A;  4AYC B;  5B8D A;  3ASL A;  3PUQ A;  5H1T A;  2IDA A;  2KWN A;  3IHP A;  3ZVZ B;  3HCT A;  3O47 A;  2L80 A;  3O36 A;  5H1V A;  3DDT A;  2CSV A;  2YU4 A;  2KGI A;  4MVT A;  2KE1 A;  3O70 A;  4AVX A;  3ZTG A;  2ECW A;  3N9N A;  2LGV A;  4IC2 A;  4MSX A;  1WEQ A;  3LDY A;  2YSM A;  1RMD A;  5H1U A;  2CRR A;  2M1R A;  2VPE A;  3HCS A;  5KH7 A;  4YBM A;  4GNF A;  5B75 A;  1JM7 B;  4GB0 A;  2F6N A;  2M13 A;  4ZUX U;  3U5O A;  5EYA F;  4V3L C;  2CKL B;  4TKP B;  5LKZ A;  2C2V S;  1WEP A;  3ZNI A;  4OGE A;  1MM2 A;  2LXH C;  2VPB A;  3M63 A;  2MIQ A;  3EB6 A;  3PHD A;  2E6R A;  1JOC A;  2RSD A;  4YAB A;  2ECI A;  4O64 A;  4FJC A;  5KH9 A;  3LRQ A;  2QIZ A;  5LKX A;  2PUY A;  5G04 B;  4IC3 A;  3FL2 A;  1E4U A;  3KV6 A;  2AN6 A;  2JMJ A;  4XI1 A;  2EGM A;  3T7L A;  4YAX A;  3KNV A;  5KH3 A;  2LV9 A;  3ZYQ A;  2KGG A;  2ECT A;  4A0C D;  5C13 A;  3SOU A;  2LGL A;  4F1P A;  2KWK A;  1LDK C;  5FEY A;  2MA6 A;  2BAY A;  2VNF A;  2M6M A;  2D8S A;  4R7E A;  5B76 A;  2IQJ A;  2UZG A;  3LQH A;  4OGC A;  5C11 A;  2XB1 A;  2MD7 B;  2MKE A;  2QIC A;  3T6R A;  2KKX A;  1VFY A;  3DWD A;  3HTK C;  2FD4 A;  4FO9 A;  4A4C A;  4A4B A;  2I50 A;  2YHO A;  1WGM A;  4QF2 A;  5LCW B;  2VJE A;  2DSM A;  2H0D A;  4P5O B;  4N4F A;  2MD8 C;  3FAO A;  2VJF A;  4GNG A;  4UP0 A;  1X4U A;  1Z60 A;  2P57 A;  5FB1 A;  4QQ4 A;  3M62 A;  1WIL A;  2YT5 A;  3LQI A;  4LAD B;  3LVR E;  3U5M A;  2HDP A;  5B79 A;  4WZ2 A;  4LJN A;  2XOC A;  2L7P A;  1WEV A;  1WEO A;  2MNZ A;  4N3W A;  4O62 A;  4AP4 A;  3L11 A;  2YUC A;  3C5K A;  1IYM A;  5K3Q A;  2MNY A;  3DPL R;  2C2L A;  2K17 A;  3RPG B;  2ECN A;  4YC9 A;  2KIZ A;  5G0F A;  5SVI A;  3SHB A;  5LKT A;  5G05 B;  4UI9 B;  4AYC A;  3O33 A;  5FB0 A;  3V43 A;  3HCU A;  2KU3 A;  4S3O C;  1WEN A;  4H9D A;  3GV4 A;  4LKA A;  3M7K A;  2G45 A;  4CA1 A;  4PTB A;  1HYI A;  3MHS A;  4Z0O A;  2JM3 A;  2M85 A;  2LAU A;  4BBQ A;  4YAD A;  2K4D A;  5H9M A;  3O34 A;  5SVY A;  2L5U A;  5DIN A;  2L75 A;  1WIM A;  4NN2 A;  2MUM A;  2MT5 A;  2MA5 A;  3SOW A;  3O7A A;  3MHH A;  2YRE A;  3U5P A;  2G43 A;  1JM7 A;  3JUE A;  1U6G B;  2HYE D;  2K1J A; 
#chains in the Genus database with same CATH homology
 2XOC A;  2LAU A;  3LVQ E;  2L7P A;  3O47 A;  2KKY A;  2EXU A;  3FM8 C;  2RR4 A;  2IQJ A;  3MDB C;  3Q1D A;  5SVY A;  3T9K A;  3SUB A;  2M13 A;  2EGM A;  2XP0 A;  3H7H A;  2DJA A;  3DDT A;  2FFW A;  4OGC A;  3FEH A;  2CSV A;  5SVI B;  2E61 A;  4O62 A;  2CON A;  2YVR A;  2MKE A;  4H9D A;  4Z0R A;  2XOZ A;  2P57 A;  3PLW A;  2KKX A;  4QQ4 A;  2YRE A;  3DWD A;  5K3Q A;  3M7K A;  3FJU B;  4OGE A;  4F1P A;  1DCQ A;  2OWA A;  2FD4 A;  2CRW A;  2B0O E;  3LDY A;  3JUE A;  3LVR E;  3E2D A;  3KDE C;  5SVX A;  3LJU X;  4Z0O A;  2JUN A;  2JM3 A;  2D8U A;  2XOY A;  5SVI A;  2CRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...