2L7PA

Ashh2 a cw domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
b'GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase ASHH2
molecule tags Transferase
source organism Arabidopsis thaliana
publication title The CW domain, a new histone recognition module in chromatin proteins.
pubmed doi rcsb
total genus 8
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2l7pA00
2L7PA 4O62A 5SVXA 4QQ4A 2E61A 4Z0OA 5SVIA 5SVIB 5SVYA 2RR4A 4Z0RA
chains in the Genus database with same CATH superfamily
4CA1A 4L58A 3M62A 4Z0OA 4WZ2A 4YADA 2L5UA 4Z0RA 2KFTA 2LGVA 2VPDA 1HYJA 4V3LC 2QICA 3LQIA 2L80A 4NN2A 2XOYA 5EYAF 2CONA 5G05B 5KH7A 4OGCA 4YBMA 2MUMA 2LXPC 1X4IA 2ECGA 5TABA 2QIZA 3N9QA 5FB1A 3LVRE 2ECTA 3DQVR 2MA5A 3MDBC 4S3OB 5AITA 4O62A 4QQ4A 3O34A 2YYRA 2KE1A 2YT5A 2KWOA 3HTKC 2F6NA 1MBMA 2E61A 3ZNIA 4AUQB 2OWAA 3NG2A 5DKAA 3KDEC 3Q1DA 5SVXA 2NAAA 3LJUX 4I7DA 2VJEA 2E6RA 3C6WA 2ECVA 2YQLA 2K16A 3QZVA 2UZGA 1ZBDB 3V43A 2F6JA 5TDRA 4B7YC 1WEEA 5C11A 4WZ3B 2M13A 2YSMA 4BBQA 2D8SA 2MA6A 3FANA 2LGGA 2M3HA 3O70A 5H1TA 1T1HA 3SOWA 5SVIA 3HCSA 4GNDA 2ZETC 2G43A 2LRIC 1Z2QA 5B79A 2P57A 2FUUA 2EODA 1JOCA 2G45A 1DVPA 2K4DA 5LKTA 2AN6A 2CRWA 1WEPA 5C13A 2F42A 2ECWA 3PLWA 3KV6A 2XP0A 1Z6UA 2YSJA 2G6QA 3SHBA 2HYED 4YAXA 1WGMA 2MT5A 3E2DA 5LCWB 5LKUA 2ECNA 4P5OB 2H0DA 2KGGA 2LN0A 2EA6A 2CKLB 2CKLA 1RMDA 3SOXA 4GNGA 2FUIA 3O37A 3N9NA 1Z60A 2LAUA 3KNVA 5B77A 2CSVA 2YUCA 2B0OE 3U5OA 4LJNA 2E6SA 2KWKA 4I7CA 5FERA 1V87A 2L75A 2VPBA 3O35A 3I2DA 1VYXA 2PNXA 1VD4A 2L43A 5B8DA 2YVRA 2CSZA 4FK5A 2JM3A 4YBTA 2VJEB 2VPGA 2XOCA 4A49A 2LDRA 1G25A 3DPLR 1XWHA 2LGKA 1IYMA 2ECJA 3DDTA 3M99A 3SOUA 2JMIA 4UP5A 4AP4A 3GV4A 4TKPB 3L11A 2OXQC 1N87A 4YABA 5B78A 2EGMA 2JUNA 2KR4A 1WEVA 2XEUA 5KH9A 5SVYA 4MVTA 4IC2A 4FO9A 4QF2A 4GNEA 2XOZA 3U5PA 4PPEA 3ASLA 4ZQLA 3HCUA 2M6MA 3DWDA 2RR4A 2KKXA 2C2LA 2EXUA 3U5MA 4A4CA 4AVXA 2DSMA 2KREA 4XI1A 3LQHA 1WEWA 2K1JA 4X3GA 2VJFA 4ZUXU 4Q6FA 1X4JA 2JRJA 1WEQA 4L7XA 2MKEA 2MNYA 4N3WA 2YURA 5TBNA 3FAOA 2IDAA 1WILA 3JUEA 1LDJB 3FJUB 4R2YA 4O64A 4AYCA 3KV5A 2BAYA 2KKYA 5B75A 5H9MA 3N9PA 4QF3A 2LQ6A 5KH3A 4UI9B 2RI7A 2KWNA 4R8PK 3FL2A 4MSXA 2JMDA 3M7KA 3H7HA 5FB0A 3VK6A 3L1ZB 2Y1NA 4YATA 4I7BA 4IC3A 4W4UA 5J3XA 5G0FA 3T6RA 1LDKC 1WE9A 3O36A 4YC9A 5DINA 4C9ZA 2L7PA 2CSYA 2LV9A 5JG6A 3LDYA 4ZDTA 2H0DB 2FFWA 4B86C 1WESA 4N4FA 2Y1MA 4GNFA 2I50A 4LKAA 4PTBA 4WA6A 2KU3A 4LLBA 2MD8C 4FJCA 3MHHA 2CT2A 2VJFB 4BHWA 2MNZA 5G04B 4GB0A 3PHDA 2KIZA 3L1XA 4OGEA 3FM8C 2C2VS 3T7LA 1WEUA 2VPEA 3RPGB 2EGPA 5SVIB 4A0CD 2D8UA 2JMJA 3C5KA 2YW8A 2XB1A 3O7AA 1U6GB 1WFKA 3ZVYA 1DCQA 4S3OC 4LK9A 2KGIA 3RTRB 3FEHA 2L0BA 5TRBA 5D1KB 1CHCA 2YHOA 4V3KC 5H1UA 1E4UA 3ZPV1 4F1PA 2HDPA 1FBVA 3O33A 1VFYA 2M1RA 4A4BA 1WEMA 4F52B 2DX8A 3RPGC 1MM2A 3EB6A 1K2FA 2LXHC 3N9OA 5LKXA 3LRQA 2IQJA 4R7EA 4LADB 1MM3A 3EB5A 2YQMA 2KYUA 2YU4A 3GL6A 5FEYA 2FD4A 2Y43A 3N9LA 3HCTA 5TDWA 5H1VA 3MHSA 1JM7B 1FP0A 2CRRA 2KWJA 1X4UA 3LVQE 3KQIA 4FIPA 2DJAA 4AYCB 2LGLA 2RSDA 1F62A 2PUYA 2QJ0A 2YHNA 3LQJA 4H9DA 3SUBA 3ZPVE 1JM7A 3T9KA 3U5NA 3O47A 2VP7A 5K3QA 5B76A 3ZYQA 5D1MB 4WZ0A 2VNFA 3PURA 5AIUA 4UP0A 1WEOA 2M85A 2ECIA 2YREA 1WENA 1HYIA 2MIQA 4YBSA 1WIMA 3M63A 5I3LA 5D1LB 2FSAA 3IHPA 2K17A 5LKZA 3ZTGA 3PUQA 3N9MA 4CCGX 2MD7B 1BORA 3ZVZB
chains in the Genus database with same CATH topology
3FEHA 2EXUA 3E2DA 3JUEA 2XOCA 3M7KA 4Z0OA 3H7HA 3MDBC 5SVYA 3FJUB 4Z0RA 2CRRA 4O62A 2YREA 2P57A 2IQJA 4QQ4A 4OGEA 4F1PA 3LVQE 2LAUA 3DDTA 2FFWA 2XOZA 3FM8C 2KKYA 2CSVA 2M13A 2B0OE 2DJAA 2XOYA 2E61A 5SVIB 2CONA 2CRWA 2D8UA 4OGCA 2MKEA 2OWAA 3KDEC 3PLWA 3Q1DA 3LDYA 2L7PA 4H9DA 5SVXA 3DWDA 3SUBA 2FD4A 3LJUX 2EGMA 2JUNA 5SVIA 1DCQA 2XP0A 2YVRA 2RR4A 3T9KA 2KKXA 3O47A 2JM3A 5K3QA 3LVRE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7P A;  4O62 A;  5SVX A;  4QQ4 A;  2E61 A;  4Z0O A;  5SVI A;  5SVI B;  5SVY A;  2RR4 A;  4Z0R A; 
#chains in the Genus database with same CATH topology
 4CA1 A;  4L58 A;  3M62 A;  4Z0O A;  4WZ2 A;  4YAD A;  2L5U A;  4Z0R A;  2KFT A;  2LGV A;  2VPD A;  1HYJ A;  4V3L C;  2QIC A;  3LQI A;  2L80 A;  4NN2 A;  2XOY A;  5EYA F;  2CON A;  5G05 B;  5KH7 A;  4OGC A;  4YBM A;  2MUM A;  2LXP C;  1X4I A;  2ECG A;  5TAB A;  2QIZ A;  3N9Q A;  5FB1 A;  3LVR E;  2ECT A;  3DQV R;  2MA5 A;  3MDB C;  4S3O B;  5AIT A;  4O62 A;  4QQ4 A;  3O34 A;  2YYR A;  2KE1 A;  2YT5 A;  2KWO A;  3HTK C;  2F6N A;  1MBM A;  2E61 A;  3ZNI A;  4AUQ B;  2OWA A;  3NG2 A;  5DKA A;  3KDE C;  3Q1D A;  5SVX A;  2NAA A;  3LJU X;  4I7D A;  2VJE A;  2E6R A;  3C6W A;  2ECV A;  2YQL A;  2K16 A;  3QZV A;  2UZG A;  1ZBD B;  3V43 A;  2F6J A;  5TDR A;  4B7Y C;  1WEE A;  5C11 A;  4WZ3 B;  2M13 A;  2YSM A;  4BBQ A;  2D8S A;  2MA6 A;  3FAN A;  2LGG A;  2M3H A;  3O70 A;  5H1T A;  1T1H A;  3SOW A;  5SVI A;  3HCS A;  4GND A;  2ZET C;  2G43 A;  2LRI C;  1Z2Q A;  5B79 A;  2P57 A;  2FUU A;  2EOD A;  1JOC A;  2G45 A;  1DVP A;  2K4D A;  5LKT A;  2AN6 A;  2CRW A;  1WEP A;  5C13 A;  2F42 A;  2ECW A;  3PLW A;  3KV6 A;  2XP0 A;  1Z6U A;  2YSJ A;  2G6Q A;  3SHB A;  2HYE D;  4YAX A;  1WGM A;  2MT5 A;  3E2D A;  5LCW B;  5LKU A;  2ECN A;  4P5O B;  2H0D A;  2KGG A;  2LN0 A;  2EA6 A;  2CKL B;  2CKL A;  1RMD A;  3SOX A;  4GNG A;  2FUI A;  3O37 A;  3N9N A;  1Z60 A;  2LAU A;  3KNV A;  5B77 A;  2CSV A;  2YUC A;  2B0O E;  3U5O A;  4LJN A;  2E6S A;  2KWK A;  4I7C A;  5FER A;  1V87 A;  2L75 A;  2VPB A;  3O35 A;  3I2D A;  1VYX A;  2PNX A;  1VD4 A;  2L43 A;  5B8D A;  2YVR A;  2CSZ A;  4FK5 A;  2JM3 A;  4YBT A;  2VJE B;  2VPG A;  2XOC A;  4A49 A;  2LDR A;  1G25 A;  3DPL R;  1XWH A;  2LGK A;  1IYM A;  2ECJ A;  3DDT A;  3M99 A;  3SOU A;  2JMI A;  4UP5 A;  4AP4 A;  3GV4 A;  4TKP B;  3L11 A;  2OXQ C;  1N87 A;  4YAB A;  5B78 A;  2EGM A;  2JUN A;  2KR4 A;  1WEV A;  2XEU A;  5KH9 A;  5SVY A;  4MVT A;  4IC2 A;  4FO9 A;  4QF2 A;  4GNE A;  2XOZ A;  3U5P A;  4PPE A;  3ASL A;  4ZQL A;  3HCU A;  2M6M A;  3DWD A;  2RR4 A;  2KKX A;  2C2L A;  2EXU A;  3U5M A;  4A4C A;  4AVX A;  2DSM A;  2KRE A;  4XI1 A;  3LQH A;  1WEW A;  2K1J A;  4X3G A;  2VJF A;  4ZUX U;  4Q6F A;  1X4J A;  2JRJ A;  1WEQ A;  4L7X A;  2MKE A;  2MNY A;  4N3W A;  2YUR A;  5TBN A;  3FAO A;  2IDA A;  1WIL A;  3JUE A;  1LDJ B;  3FJU B;  4R2Y A;  4O64 A;  4AYC A;  3KV5 A;  2BAY A;  2KKY A;  5B75 A;  5H9M A;  3N9P A;  4QF3 A;  2LQ6 A;  5KH3 A;  4UI9 B;  2RI7 A;  2KWN A;  4R8P K;  3FL2 A;  4MSX A;  2JMD A;  3M7K A;  3H7H A;  5FB0 A;  3VK6 A;  3L1Z B;  2Y1N A;  4YAT A;  4I7B A;  4IC3 A;  4W4U A;  5J3X A;  5G0F A;  3T6R A;  1LDK C;  1WE9 A;  3O36 A;  4YC9 A;  5DIN A;  4C9Z A;  2L7P A;  2CSY A;  2LV9 A;  5JG6 A;  3LDY A;  4ZDT A;  2H0D B;  2FFW A;  4B86 C;  1WES A;  4N4F A;  2Y1M A;  4GNF A;  2I50 A;  4LKA A;  4PTB A;  4WA6 A;  2KU3 A;  4LLB A;  2MD8 C;  4FJC A;  3MHH A;  2CT2 A;  2VJF B;  4BHW A;  2MNZ A;  5G04 B;  4GB0 A;  3PHD A;  2KIZ A;  3L1X A;  4OGE A;  3FM8 C;  2C2V S;  3T7L A;  1WEU A;  2VPE A;  3RPG B;  2EGP A;  5SVI B;  4A0C D;  2D8U A;  2JMJ A;  3C5K A;  2YW8 A;  2XB1 A;  3O7A A;  1U6G B;  1WFK A;  3ZVY A;  1DCQ A;  4S3O C;  4LK9 A;  2KGI A;  3RTR B;  3FEH A;  2L0B A;  5TRB A;  5D1K B;  1CHC A;  2YHO A;  4V3K C;  5H1U A;  1E4U A;  3ZPV 1;  4F1P A;  2HDP A;  1FBV A;  3O33 A;  1VFY A;  2M1R A;  4A4B A;  1WEM A;  4F52 B;  2DX8 A;  3RPG C;  1MM2 A;  3EB6 A;  1K2F A;  2LXH C;  3N9O A;  5LKX A;  3LRQ A;  2IQJ A;  4R7E A;  4LAD B;  1MM3 A;  3EB5 A;  2YQM A;  2KYU A;  2YU4 A;  3GL6 A;  5FEY A;  2FD4 A;  2Y43 A;  3N9L A;  3HCT A;  5TDW A;  5H1V A;  3MHS A;  1JM7 B;  1FP0 A;  2CRR A;  2KWJ A;  1X4U A;  3LVQ E;  3KQI A;  4FIP A;  2DJA A;  4AYC B;  2LGL A;  2RSD A;  1F62 A;  2PUY A;  2QJ0 A;  2YHN A;  3LQJ A;  4H9D A;  3SUB A;  3ZPV E;  1JM7 A;  3T9K A;  3U5N A;  3O47 A;  2VP7 A;  5K3Q A;  5B76 A;  3ZYQ A;  5D1M B;  4WZ0 A;  2VNF A;  3PUR A;  5AIU A;  4UP0 A;  1WEO A;  2M85 A;  2ECI A;  2YRE A;  1WEN A;  1HYI A;  2MIQ A;  4YBS A;  1WIM A;  3M63 A;  5I3L A;  5D1L B;  2FSA A;  3IHP A;  2K17 A;  5LKZ A;  3ZTG A;  3PUQ A;  3N9M A;  4CCG X;  2MD7 B;  1BOR A;  3ZVZ B; 
#chains in the Genus database with same CATH homology
 3FEH A;  2EXU A;  3E2D A;  3JUE A;  2XOC A;  3M7K A;  4Z0O A;  3H7H A;  3MDB C;  5SVY A;  3FJU B;  4Z0R A;  2CRR A;  4O62 A;  2YRE A;  2P57 A;  2IQJ A;  4QQ4 A;  4OGE A;  4F1P A;  3LVQ E;  2LAU A;  3DDT A;  2FFW A;  2XOZ A;  3FM8 C;  2KKY A;  2CSV A;  2M13 A;  2B0O E;  2DJA A;  2XOY A;  2E61 A;  5SVI B;  2CON A;  2CRW A;  2D8U A;  4OGC A;  2MKE A;  2OWA A;  3KDE C;  3PLW A;  3Q1D A;  3LDY A;  2L7P A;  4H9D A;  5SVX A;  3DWD A;  3SUB A;  2FD4 A;  3LJU X;  2EGM A;  2JUN A;  5SVI A;  1DCQ A;  2XP0 A;  2YVR A;  2RR4 A;  3T9K A;  2KKX A;  3O47 A;  2JM3 A;  5K3Q A;  3LVR E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...