2L7PA

Ashh2 a cw domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
GSRRASVGSEFMVVDVTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASHH2
publication title The CW domain, a new histone recognition module in chromatin proteins.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 8
structure length 100
sequence length 100
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07496 zf-CW CW-type Zinc Finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.100 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 2l7pA00
4Z0RA 5SVIB 2L7PA 5SVYA 2RR4A 4O62A 2E61A 4Z0OA 4QQ4A 5SVIA 5SVXA
chains in the Genus database with same CATH superfamily
3FM8C 2E6RA 3Q1DA 3DWDA 1MM3A 1X4IA 3GL6A 4R8PK 4LLBA 2P57A 2VJEA 1Z60A 4CCGX 3O7AA 5G05B 2XOCA 3LVRE 3T9KA 3KV6A 5FEYA 4B86C 1WEPA 3FEHA 2KGIA 3ZPV1 1V87A 4R2YA 4H9DA 1FP0A 3SOWA 2HDPA 2YT5A 2QJ0A 2M6MA 3PHDA 2VPDA 3KNVA 1K2FA 4FO9A 4V3KC 2KKXA 3SHBA 4F52B 5KH7A 2NAAA 2FSAA 2YHNA 5H9MA 4AP4A 3QZVA 2MA6A 3KV5A 3PURA 5H1VA 2XEUA 4PPEA 2EGPA 2C2VS 2KFTA 4C9ZA 3ZVYA 2M13A 3V43A 2F6JA 5D1KB 2OWAA 2YURA 1WEUA 2LAUA 4GNEA 2BAYA 2YU4A 1JM7A 1RMDA 4A49A 4F1PA 5K3QA 2KGGA 3N9PA 2MD8C 5G0FA 1JOCA 2YHOA 3ZPVE 1ZBDB 4L58A 3LQJA 1T1HA 2CSZA 4YADA 2ECWA 4ZUXU 1WEWA 2CT2A 3LVQE 1F62A 2M3HA 4YAXA 4V3LC 5DINA 3O34A 2K1JA 2EGMA 5J3XA 2KE1A 1LDKC 4LK9A 1HYIA 2XP0A 2QIZA 3LQHA 2F6NA 4GB0A 2LXPC 4I7DA 1WILA 3JUEA 2KWOA 5TABA 4ZQLA 3EB6A 2YQLA 5D1MB 5LCWB 1X4UA 2MUMA 2UZGA 4QF2A 2QICA 3SOUA 4IC3A 2JMJA 4X3GA 1G25A 3U5NA 2F42A 4ZDTA 4WA6A 2MIQA 4FIPA 2G45A 2RSDA 5TRBA 2L75A 3VK6A 5TDRA 1WEQA 4IC2A 5LKXA 2KIZA 3O35A 2ECVA 2YVRA 5SVYA 2KREA 5AITA 5B8DA 2FUIA 2K16A 4GNDA 3PLWA 4UP5A 2E61A 4Q6FA 3IHPA 2VJFB 4PTBA 3L1ZB 2LDRA 2CRRA 2PNXA 5KH3A 2CKLB 2CSYA 4GNGA 3L11A 2LGVA 4CA1A 4AUQB 5EYAF 1WEOA 2K17A 1CHCA 2DSMA 2IDAA 2JRJA 3M99A 1MBMA 2VP7A 2LQ6A 3N9NA 2LXHC 5JG6A 2ECIA 2YW8A 3O47A 5D1LB 4WZ3B 4YC9A 3SUBA 5FB1A 2FFWA 3FJUB 3ZYQA 2ECGA 3MDBC 1X4JA 1VFYA 4A0CD 2D8SA 3U5PA 3NG2A 2Y1NA 2Y43A 3LQIA 1WGMA 2JUNA 3LJUX 3I2DA 1WESA 5C11A 1WEEA 4NN2A 4Z0RA 1HYJA 5SVIB 4GNFA 4QF3A 2MT5A 4A4BA 2ECTA 3ASLA 2L43A 2FD4A 4XI1A 3M7KA 2H0DB 2E6SA 3HCSA 5TBNA 5B78A 4OGCA 3GV4A 2EXUA 3PUQA 3T7LA 1VYXA 1VD4A 4N3WA 2XB1A 3O37A 5B79A 2XOZA 5B77A 3ZTGA 2LV9A 4AYCB 4YBTA 2RI7A 4A4CA 4O62A 2ZETC 3LDYA 2KU3A 2KWNA 1Z6UA 2EA6A 4BHWA 2KWKA 5I3LA 4OGEA 4YBSA 4MVTA 5FERA 3DQVR 4YABA 5C13A 1Z2QA 3SOXA 3O33A 2VPBA 3DDTA 5DKAA 2B0OE 5LKZA 2G6QA 2HYED 3EB5A 3H7HA 3N9OA 2MKEA 2PUYA 2CONA 2ECJA 2LN0A 1WFKA 2KYUA 3M63A 4N4FA 3U5OA 3LRQA 2AN6A 4P5OB 4FK5A 3ZVZB 2MA5A 2VJFA 5FB0A 5G04B 3N9MA 2VJEB 2C2LA 3KDEC 2MD7B 3E2DA 4TKPB 2CKLA 2K4DA 4WZ0A 4R7EA 2VPGA 2M1RA 5B76A 2LGLA 2LGKA 2XOYA 2EODA 2JM3A 4S3OC 3C6WA 4YBMA 2KR4A 4AVXA 2JMDA 1XWHA 4I7CA 2YUCA 4LKAA 2L5UA 1WIMA 4O64A 3RPGC 2KWJA 4L7XA 2LRIC 3RTRB 2JMIA 1MM2A 2YSJA 4FJCA 5B75A 1N87A 1E4UA 2Y1MA 2ECNA 3N9LA 2MNYA 4LJNA 4LADB 5TDWA 1DVPA 1WE9A 3HCUA 3ZNIA 1DCQA 3FL2A 4Z0OA 1FBVA 2VNFA 2YREA 3HCTA 2YQMA 2L0BA 5SVXA 4UP0A 5LKUA 5AIUA 3FANA 4UI9B 5KH9A 1WEVA 5SVIA 4YATA 1JM7B 3MHHA 3DPLR 2KKYA 4W4UA 2H0DA 2MNZA 2IQJA 1U6GB 2VPEA 5LKTA 2CRWA 3T6RA 4I7BA 2D8UA 3L1XA 1IYMA 3FAOA 2LGGA 3HTKC 2FUUA 2DJAA 2DX8A 4S3OB 4AYCA 2YYRA 2YSMA 2I50A 1BORA 3N9QA 5H1UA 2OXQC 3RPGB 4MSXA 1WENA 2L80A 1LDJB 5H1TA 3U5MA 3M62A 2RR4A 1WEMA 3MHSA 2CSVA 3O70A 4BBQA 2L7PA 4B7YC 3O36A 3KQIA 2G43A 3C5KA 2M85A 4WZ2A 4QQ4A
chains in the Genus database with same CATH topology
2EXUA 2CRWA 3FM8C 3FEHA 3Q1DA 3DWDA 2CRRA 2D8UA 2YREA 4H9DA 5SVXA 2XP0A 3O47A 4Z0RA 5SVIB 3KDEC 2RR4A 2XOZA 3DDTA 3SUBA 2B0OE 2FFWA 2DJAA 2M13A 2P57A 3E2DA 3LVQE 3FJUB 5SVIA 2CSVA 3JUEA 2OWAA 3MDBC 2YVRA 2L7PA 5SVYA 2FD4A 2LAUA 3H7HA 4O62A 3M7KA 2MKEA 2XOCA 2KKYA 3LDYA 2CONA 4QQ4A 3PLWA 4F1PA 5K3QA 1DCQA 2JUNA 3LVRE 3T9KA 2KKXA 3LJUX 2E61A 2XOYA 2EGMA 4OGCA 4OGEA 4Z0OA 2JM3A 2IQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0R A;  5SVI B;  2L7P A;  5SVY A;  2RR4 A;  4O62 A;  2E61 A;  4Z0O A;  4QQ4 A;  5SVI A;  5SVX A; 
#chains in the Genus database with same CATH topology
 3FM8 C;  2E6R A;  3Q1D A;  3DWD A;  1MM3 A;  1X4I A;  3GL6 A;  4R8P K;  4LLB A;  2P57 A;  2VJE A;  1Z60 A;  4CCG X;  3O7A A;  5G05 B;  2XOC A;  3LVR E;  3T9K A;  3KV6 A;  5FEY A;  4B86 C;  1WEP A;  3FEH A;  2KGI A;  3ZPV 1;  1V87 A;  4R2Y A;  4H9D A;  1FP0 A;  3SOW A;  2HDP A;  2YT5 A;  2QJ0 A;  2M6M A;  3PHD A;  2VPD A;  3KNV A;  1K2F A;  4FO9 A;  4V3K C;  2KKX A;  3SHB A;  4F52 B;  5KH7 A;  2NAA A;  2FSA A;  2YHN A;  5H9M A;  4AP4 A;  3QZV A;  2MA6 A;  3KV5 A;  3PUR A;  5H1V A;  2XEU A;  4PPE A;  2EGP A;  2C2V S;  2KFT A;  4C9Z A;  3ZVY A;  2M13 A;  3V43 A;  2F6J A;  5D1K B;  2OWA A;  2YUR A;  1WEU A;  2LAU A;  4GNE A;  2BAY A;  2YU4 A;  1JM7 A;  1RMD A;  4A49 A;  4F1P A;  5K3Q A;  2KGG A;  3N9P A;  2MD8 C;  5G0F A;  1JOC A;  2YHO A;  3ZPV E;  1ZBD B;  4L58 A;  3LQJ A;  1T1H A;  2CSZ A;  4YAD A;  2ECW A;  4ZUX U;  1WEW A;  2CT2 A;  3LVQ E;  1F62 A;  2M3H A;  4YAX A;  4V3L C;  5DIN A;  3O34 A;  2K1J A;  2EGM A;  5J3X A;  2KE1 A;  1LDK C;  4LK9 A;  1HYI A;  2XP0 A;  2QIZ A;  3LQH A;  2F6N A;  4GB0 A;  2LXP C;  4I7D A;  1WIL A;  3JUE A;  2KWO A;  5TAB A;  4ZQL A;  3EB6 A;  2YQL A;  5D1M B;  5LCW B;  1X4U A;  2MUM A;  2UZG A;  4QF2 A;  2QIC A;  3SOU A;  4IC3 A;  2JMJ A;  4X3G A;  1G25 A;  3U5N A;  2F42 A;  4ZDT A;  4WA6 A;  2MIQ A;  4FIP A;  2G45 A;  2RSD A;  5TRB A;  2L75 A;  3VK6 A;  5TDR A;  1WEQ A;  4IC2 A;  5LKX A;  2KIZ A;  3O35 A;  2ECV A;  2YVR A;  5SVY A;  2KRE A;  5AIT A;  5B8D A;  2FUI A;  2K16 A;  4GND A;  3PLW A;  4UP5 A;  2E61 A;  4Q6F A;  3IHP A;  2VJF B;  4PTB A;  3L1Z B;  2LDR A;  2CRR A;  2PNX A;  5KH3 A;  2CKL B;  2CSY A;  4GNG A;  3L11 A;  2LGV A;  4CA1 A;  4AUQ B;  5EYA F;  1WEO A;  2K17 A;  1CHC A;  2DSM A;  2IDA A;  2JRJ A;  3M99 A;  1MBM A;  2VP7 A;  2LQ6 A;  3N9N A;  2LXH C;  5JG6 A;  2ECI A;  2YW8 A;  3O47 A;  5D1L B;  4WZ3 B;  4YC9 A;  3SUB A;  5FB1 A;  2FFW A;  3FJU B;  3ZYQ A;  2ECG A;  3MDB C;  1X4J A;  1VFY A;  4A0C D;  2D8S A;  3U5P A;  3NG2 A;  2Y1N A;  2Y43 A;  3LQI A;  1WGM A;  2JUN A;  3LJU X;  3I2D A;  1WES A;  5C11 A;  1WEE A;  4NN2 A;  4Z0R A;  1HYJ A;  5SVI B;  4GNF A;  4QF3 A;  2MT5 A;  4A4B A;  2ECT A;  3ASL A;  2L43 A;  2FD4 A;  4XI1 A;  3M7K A;  2H0D B;  2E6S A;  3HCS A;  5TBN A;  5B78 A;  4OGC A;  3GV4 A;  2EXU A;  3PUQ A;  3T7L A;  1VYX A;  1VD4 A;  4N3W A;  2XB1 A;  3O37 A;  5B79 A;  2XOZ A;  5B77 A;  3ZTG A;  2LV9 A;  4AYC B;  4YBT A;  2RI7 A;  4A4C A;  4O62 A;  2ZET C;  3LDY A;  2KU3 A;  2KWN A;  1Z6U A;  2EA6 A;  4BHW A;  2KWK A;  5I3L A;  4OGE A;  4YBS A;  4MVT A;  5FER A;  3DQV R;  4YAB A;  5C13 A;  1Z2Q A;  3SOX A;  3O33 A;  2VPB A;  3DDT A;  5DKA A;  2B0O E;  5LKZ A;  2G6Q A;  2HYE D;  3EB5 A;  3H7H A;  3N9O A;  2MKE A;  2PUY A;  2CON A;  2ECJ A;  2LN0 A;  1WFK A;  2KYU A;  3M63 A;  4N4F A;  3U5O A;  3LRQ A;  2AN6 A;  4P5O B;  4FK5 A;  3ZVZ B;  2MA5 A;  2VJF A;  5FB0 A;  5G04 B;  3N9M A;  2VJE B;  2C2L A;  3KDE C;  2MD7 B;  3E2D A;  4TKP B;  2CKL A;  2K4D A;  4WZ0 A;  4R7E A;  2VPG A;  2M1R A;  5B76 A;  2LGL A;  2LGK A;  2XOY A;  2EOD A;  2JM3 A;  4S3O C;  3C6W A;  4YBM A;  2KR4 A;  4AVX A;  2JMD A;  1XWH A;  4I7C A;  2YUC A;  4LKA A;  2L5U A;  1WIM A;  4O64 A;  3RPG C;  2KWJ A;  4L7X A;  2LRI C;  3RTR B;  2JMI A;  1MM2 A;  2YSJ A;  4FJC A;  5B75 A;  1N87 A;  1E4U A;  2Y1M A;  2ECN A;  3N9L A;  2MNY A;  4LJN A;  4LAD B;  5TDW A;  1DVP A;  1WE9 A;  3HCU A;  3ZNI A;  1DCQ A;  3FL2 A;  4Z0O A;  1FBV A;  2VNF A;  2YRE A;  3HCT A;  2YQM A;  2L0B A;  5SVX A;  4UP0 A;  5LKU A;  5AIU A;  3FAN A;  4UI9 B;  5KH9 A;  1WEV A;  5SVI A;  4YAT A;  1JM7 B;  3MHH A;  3DPL R;  2KKY A;  4W4U A;  2H0D A;  2MNZ A;  2IQJ A;  1U6G B;  2VPE A;  5LKT A;  2CRW A;  3T6R A;  4I7B A;  2D8U A;  3L1X A;  1IYM A;  3FAO A;  2LGG A;  3HTK C;  2FUU A;  2DJA A;  2DX8 A;  4S3O B;  4AYC A;  2YYR A;  2YSM A;  2I50 A;  1BOR A;  3N9Q A;  5H1U A;  2OXQ C;  3RPG B;  4MSX A;  1WEN A;  2L80 A;  1LDJ B;  5H1T A;  3U5M A;  3M62 A;  2RR4 A;  1WEM A;  3MHS A;  2CSV A;  3O70 A;  4BBQ A;  2L7P A;  4B7Y C;  3O36 A;  3KQI A;  2G43 A;  3C5K A;  2M85 A;  4WZ2 A;  4QQ4 A; 
#chains in the Genus database with same CATH homology
 2EXU A;  2CRW A;  3FM8 C;  3FEH A;  3Q1D A;  3DWD A;  2CRR A;  2D8U A;  2YRE A;  4H9D A;  5SVX A;  2XP0 A;  3O47 A;  4Z0R A;  5SVI B;  3KDE C;  2RR4 A;  2XOZ A;  3DDT A;  3SUB A;  2B0O E;  2FFW A;  2DJA A;  2M13 A;  2P57 A;  3E2D A;  3LVQ E;  3FJU B;  5SVI A;  2CSV A;  3JUE A;  2OWA A;  3MDB C;  2YVR A;  2L7P A;  5SVY A;  2FD4 A;  2LAU A;  3H7H A;  4O62 A;  3M7K A;  2MKE A;  2XOC A;  2KKY A;  3LDY A;  2CON A;  4QQ4 A;  3PLW A;  4F1P A;  5K3Q A;  1DCQ A;  2JUN A;  3LVR E;  3T9K A;  2KKX A;  3LJU X;  2E61 A;  2XOY A;  2EGM A;  4OGC A;  4OGE A;  4Z0O A;  2JM3 A;  2IQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...