5C11A

Crystal structure of jarid1a phd finger bound to histone h3c4me3 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
b'SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c11A00
3I2DA 2M3HA 5H9MA 1Z60A 3O35A 2VJEB 1X4IA 4LKAA 2I50A 5I3LA 3C6WA 5KH9A 1E4UA 3N9LA 3L1XA 4R7EA 2MA6A 3L11A 2ECTA 5AITA 2G6QA 3KNVA 4IC2A 4P5OB 2CKLB 2C2LA 3M63A 3RPGC 1JM7A 2YUCA 4X3GA 3DQVR 2L43A 5D1MB 4QF2A 5JG6A 2XEUA 2MA5A 3O33A 2E6SA 4AP4A 3ZNIA 2K16A 4YBTA 3U5NA 1T1HA 1FP0A 2QJ0A 2LQ6A 4AVXA 2KWKA 2KREA 4ZQLA 1MM2A 2VPBA 4I7CA 2M1RA 4W4UA 2E6RA 3O7AA 2JRJA 1WEUA 3VK6A 3PHDA 1WEWA 3N9PA 2YQLA 1ZBDB 4WZ2A 5KH3A 2MT5A 5LCWB 2MD7B 2LGVA 3KV6A 2MNYA 4B7YC 4CA1A 2ECIA 2MIQA 5H1UA 5TBNA 2FUIA 2KR4A 1JM7B 2VPDA 5C11A 2K1JA 1LDJB 1VD4A 3N9MA 3O36A 5G05B 2JMDA 4AYCB 2L0BA 1MM3A 2YURA 5H1VA 4QF3A 1XWHA 3MHSA 4PTBA 4ZUXU 4C9ZA 2PNXA 1X4JA 2H0DA 4FO9A 2YHOA 1WEEA 2FUUA 3DPLR 3ZPV1 2Y1NA 3GV4A 2YQMA 2G43A 2FSAA 2ECWA 3SHBA 4UP0A 2UZGA 5G0FA 3IHPA 1K2FA 2YSMA 4V3LC 1WEMA 3EB6A 1BORA 5C13A 4CCGX 4N3WA 2YSJA 1HYIA 4I7BA 4NN2A 3FL2A 2AN6A 5D1LB 5AIUA 3ZPVE 5J3XA 3U5PA 1U6GB 4AYCA 1WILA 4UP5A 4FK5A 1F62A 1CHCA 1G25A 3ZTGA 1WEQA 2HDPA 2KGIA 2LGGA 2L80A 3V43A 2MNZA 4XI1A 2VP7A 5TDWA 3NG2A 5B8DA 3RTRB 2YW8A 3ZVYA 4R2YA 3HCTA 2LV9A 2KWNA 2H0DB 2YYRA 4Q6FA 3SOUA 1FBVA 4A0CD 4A49A 4YATA 5FEYA 2LGKA 3EB5A 3L1ZB 1WIMA 5B78A 5FB0A 2KE1A 3LRQA 2BAYA 3KQIA 3N9OA 4A4CA 5G04B 2RSDA 4LJNA 2CSYA 4YAXA 1WENA 2EGPA 2PUYA 4WA6A 4B86C 5B79A 5TRBA 4AUQB 2MD8C 2L75A 2ZETC 2LGLA 3HCUA 4UI9B 4LK9A 5FERA 5D1KB 2VPGA 2NAAA 2K4DA 2ECJA 3O70A 2LXHC 4V3KC 4I7DA 2F6NA 2LN0A 3N9NA 2ECGA 4S3OB 2EODA 2RI7A 2VPEA 1Z2QA 3KV5A 3SOWA 3N9QA 1N87A 1X4UA 2KWOA 2M85A 2CT2A 3ZVZB 2G45A 2KWJA 3ASLA 2ECNA 4ZDTA 4YBSA 2QICA 2M6MA 2HYED 2KU3A 2JMIA 2VJFA 4A4BA 1IYMA 4MSXA 4PPEA 2YU4A 3HCSA 1RMDA 3O37A 3QZVA 4IC3A 3HTKC 5LKZA 5B75A 4O64A 4WZ0A 1HYJA 2OXQC 2YREA 4TKPB 2VNFA 2YHNA 3LQJA 3O34A 1WEOA 2JMJA 4N4FA 5LKUA 3T7LA 4F52B 2LRIC 4LADB 5LKTA 1WFKA 5B76A 5DINA 2Y43A 4YADA 2Y1MA 3PUQA 5FB1A 2K17A 5LKXA 3RPGB 1Z6UA 2L5UA 2DX8A 2ECVA 3LQIA 4FIPA 2D8SA 3M62A 3C5KA 4GNGA 4GNEA 3U5OA 2VJEA 4WZ3B 4YC9A 2C2VS 3MHHA 5TDRA 2KYUA 2IDAA 1WGMA 2YT5A 4GNDA 2MUMA 3U5MA 2VJFB 1WE9A 2XB1A 4YBMA 5H1TA 2CKLA 1JOCA 5DKAA 4S3OC 4YABA 2LXPC 3PURA 4GB0A 1DVPA 2F42A 3M99A 2F6JA 5TABA 1LDKC 1VYXA 5KH7A 4L7XA 4LLBA 4MVTA 5EYAF 1WESA 3LQHA 1WEVA 3ZYQA 4R8PK 4L58A 1WEPA 5B77A 3SOXA 2CSZA 2KIZA 3GL6A 1VFYA 3T6RA 2LDRA 1V87A 4BBQA 2KGGA 4FJCA 2EA6A 2KFTA 2QIZA 4BHWA 4GNFA
chains in the Genus database with same CATH superfamily
3I2DA 2M3HA 5H9MA 1Z60A 2CRWA 3O35A 2VJEB 1X4IA 4LKAA 2I50A 5I3LA 3C6WA 3KDEC 5KH9A 1E4UA 3N9LA 3L1XA 4R7EA 3JUEA 2MA6A 3L11A 2ECTA 5AITA 4Z0RA 2G6QA 3KNVA 4IC2A 4P5OB 2CKLB 2M13A 2C2LA 3M63A 3RPGC 2CSVA 1JM7A 2YUCA 4X3GA 3DQVR 2L43A 5D1MB 4QF2A 5JG6A 2XEUA 2MA5A 3O33A 2E6SA 4AP4A 3ZNIA 2K16A 4YBTA 3U5NA 4Z0OA 3DWDA 1T1HA 1FP0A 2QJ0A 2LQ6A 4AVXA 2KWKA 2B0OE 2FD4A 2KREA 4ZQLA 4I7CA 1MM2A 2VPBA 2M1RA 4W4UA 2E6RA 3O7AA 2JRJA 2JM3A 1WEUA 3VK6A 3PHDA 1WEWA 2XP0A 3N9PA 2YQLA 1ZBDB 4WZ2A 5KH3A 2MT5A 5LCWB 2MD7B 2LGVA 3KV6A 2MNYA 5SVYA 4B7YC 4CA1A 2ECIA 2MIQA 5H1UA 5TBNA 2FUIA 3LDYA 2KR4A 1JM7B 2VPDA 5C11A 2K1JA 3PLWA 1LDJB 1VD4A 3N9MA 3O36A 5G05B 2JMDA 4AYCB 2L0BA 1MM3A 2YURA 5H1VA 2L7PA 4QF3A 1XWHA 3MHSA 4PTBA 4ZUXU 4C9ZA 2PNXA 3T9KA 1X4JA 2H0DA 4FO9A 2YHOA 1WEEA 2FUUA 5K3QA 3DPLR 3ZPV1 2Y1NA 3GV4A 2YQMA 2G43A 2FSAA 2ECWA 3SHBA 2YVRA 4UP0A 2UZGA 5G0FA 3IHPA 1K2FA 2YSMA 2KKYA 4V3LC 5SVIA 1WEMA 4OGCA 3EB6A 1BORA 4H9DA 5C13A 4CCGX 4N3WA 2YSJA 1HYIA 4I7BA 4NN2A 1DCQA 3FL2A 2AN6A 2KKXA 5D1LB 5AIUA 3ZPVE 5J3XA 2P57A 2EGMA 3U5PA 1U6GB 4AYCA 1WILA 4UP5A 4FK5A 3M7KA 1F62A 1CHCA 1G25A 3ZTGA 1WEQA 2HDPA 2XOYA 2KGIA 2LGGA 2L80A 3MDBC 3V43A 2MNZA 4XI1A 2VP7A 2EXUA 5TDWA 2FFWA 3NG2A 5B8DA 3RTRB 2YW8A 3ZVYA 4R2YA 3HCTA 2LV9A 2KWNA 2H0DB 2YYRA 4Q6FA 3SOUA 1FBVA 4A0CD 3SUBA 4A49A 4YATA 5FEYA 2LGKA 3EB5A 3L1ZB 1WIMA 5B78A 5FB0A 4OGEA 2KE1A 3O47A 5SVIB 3LRQA 2CONA 2BAYA 3KQIA 3N9OA 4A4CA 5G04B 2RSDA 2DSMA 4LJNA 2CSYA 3E2DA 4YAXA 1WENA 2EGPA 2PUYA 4WA6A 4B86C 5B79A 5TRBA 4AUQB 2MD8C 2L75A 2ZETC 3FEHA 2LGLA 3HCUA 2E61A 4UI9B 4LK9A 5FERA 5D1KB 2VPGA 2NAAA 2K4DA 2ECJA 3O70A 2LXHC 4V3KC 4I7DA 2F6NA 2LN0A 3N9NA 2ECGA 4S3OB 2EODA 2RI7A 2VPEA 1Z2QA 3KV5A 3DDTA 3Q1DA 3SOWA 3N9QA 1N87A 1X4UA 2LAUA 2CRRA 2KWOA 2M85A 2CT2A 3ZVZB 2G45A 2KWJA 3ASLA 2ECNA 4ZDTA 4YBSA 2QICA 2M6MA 3FAOA 2DJAA 2D8UA 2HYED 2RR4A 2KU3A 2JMIA 4QQ4A 2VJFA 4A4BA 1IYMA 4MSXA 4PPEA 2YU4A 3HCSA 1RMDA 3O37A 3QZVA 4IC3A 3HTKC 5LKZA 5B75A 4O64A 4WZ0A 1HYJA 2OXQC 2YREA 4TKPB 2VNFA 2YHNA 3LQJA 3O34A 1WEOA 2JMJA 3FANA 4N4FA 5LKUA 3T7LA 4F52B 2LRIC 4LADB 5LKTA 1WFKA 5B76A 5DINA 2Y43A 4YADA 2Y1MA 3PUQA 5FB1A 2K17A 5LKXA 3RPGB 1Z6UA 2L5UA 2DX8A 2ECVA 5SVXA 4F1PA 2IQJA 3LQIA 4FIPA 2D8SA 1MBMA 3M62A 4O62A 3C5KA 4GNGA 4GNEA 3U5OA 2VJEA 4WZ3B 4YC9A 2XOCA 3LJUX 2C2VS 3MHHA 5TDRA 2KYUA 2IDAA 1WGMA 2YT5A 4GNDA 2MUMA 3U5MA 2VJFB 1WE9A 2XB1A 4YBMA 5H1TA 2CKLA 3FJUB 3H7HA 1JOCA 5DKAA 4S3OC 4YABA 2LXPC 3PURA 4GB0A 2JUNA 1DVPA 2F42A 3M99A 2F6JA 5TABA 2OWAA 1LDKC 2MKEA 1VYXA 5KH7A 4L7XA 4LLBA 4MVTA 5EYAF 3FM8C 1WESA 3LQHA 1WEVA 3ZYQA 3LVRE 4R8PK 4L58A 1WEPA 5B77A 3SOXA 2CSZA 2KIZA 3GL6A 3LVQE 1VFYA 3T6RA 2LDRA 1V87A 2XOZA 4BBQA 2KGGA 4FJCA 2EA6A 2KFTA 2QIZA 4BHWA 4GNFA
chains in the Genus database with same CATH topology
3I2DA 2M3HA 5H9MA 1Z60A 3O35A 2VJEB 1X4IA 4LKAA 2I50A 5I3LA 3C6WA 5KH9A 1E4UA 3N9LA 3L1XA 4R7EA 2MA6A 3L11A 2ECTA 5AITA 2G6QA 3KNVA 4IC2A 4P5OB 2CKLB 2C2LA 3M63A 3RPGC 1JM7A 2YUCA 4X3GA 3DQVR 2L43A 5D1MB 4QF2A 5JG6A 2XEUA 2MA5A 3O33A 2E6SA 4AP4A 3ZNIA 2K16A 4YBTA 3U5NA 1T1HA 1FP0A 2QJ0A 2LQ6A 4AVXA 2KWKA 2KREA 4ZQLA 1MM2A 2VPBA 4I7CA 2M1RA 4W4UA 2E6RA 3O7AA 2JRJA 1WEUA 3VK6A 3PHDA 1WEWA 3N9PA 2YQLA 1ZBDB 4WZ2A 5KH3A 2MT5A 5LCWB 2MD7B 2LGVA 3KV6A 2MNYA 4B7YC 4CA1A 2ECIA 2MIQA 5H1UA 5TBNA 2FUIA 2KR4A 1JM7B 2VPDA 5C11A 2K1JA 1LDJB 1VD4A 3N9MA 3O36A 5G05B 2JMDA 4AYCB 2L0BA 1MM3A 2YURA 5H1VA 4QF3A 1XWHA 3MHSA 4PTBA 4ZUXU 4C9ZA 2PNXA 1X4JA 2H0DA 4FO9A 2YHOA 1WEEA 2FUUA 3DPLR 3ZPV1 2Y1NA 3GV4A 2YQMA 2G43A 2FSAA 2ECWA 3SHBA 4UP0A 2UZGA 5G0FA 3IHPA 1K2FA 2YSMA 4V3LC 1WEMA 3EB6A 1BORA 5C13A 4CCGX 4N3WA 2YSJA 1HYIA 4I7BA 4NN2A 3FL2A 2AN6A 5D1LB 5AIUA 3ZPVE 5J3XA 3U5PA 1U6GB 4AYCA 1WILA 4UP5A 4FK5A 1F62A 1CHCA 1G25A 3ZTGA 1WEQA 2HDPA 2KGIA 2LGGA 2L80A 3V43A 2MNZA 4XI1A 2VP7A 5TDWA 3NG2A 5B8DA 3RTRB 2YW8A 3ZVYA 4R2YA 3HCTA 2LV9A 2KWNA 2H0DB 2YYRA 4Q6FA 3SOUA 1FBVA 4A0CD 4A49A 4YATA 5FEYA 2LGKA 3EB5A 3L1ZB 1WIMA 5B78A 5FB0A 2KE1A 3LRQA 2BAYA 3KQIA 3N9OA 4A4CA 5G04B 2RSDA 4LJNA 2CSYA 4YAXA 1WENA 2EGPA 2PUYA 4WA6A 4B86C 5B79A 5TRBA 4AUQB 2MD8C 2L75A 2ZETC 2LGLA 3HCUA 4UI9B 4LK9A 5FERA 5D1KB 2VPGA 2NAAA 2K4DA 2ECJA 3O70A 2LXHC 4V3KC 4I7DA 2F6NA 2LN0A 3N9NA 2ECGA 4S3OB 2EODA 2RI7A 2VPEA 1Z2QA 3KV5A 3SOWA 3N9QA 1N87A 1X4UA 2KWOA 2M85A 2CT2A 3ZVZB 2G45A 2KWJA 3ASLA 2ECNA 4ZDTA 4YBSA 2QICA 2M6MA 2HYED 2KU3A 2JMIA 2VJFA 4A4BA 1IYMA 4MSXA 4PPEA 2YU4A 3HCSA 1RMDA 3O37A 3QZVA 4IC3A 3HTKC 5LKZA 5B75A 4O64A 4WZ0A 1HYJA 2OXQC 2YREA 4TKPB 2VNFA 2YHNA 3LQJA 3O34A 1WEOA 2JMJA 4N4FA 5LKUA 3T7LA 4F52B 2LRIC 4LADB 5LKTA 1WFKA 5B76A 5DINA 2Y43A 4YADA 2Y1MA 3PUQA 5FB1A 2K17A 5LKXA 3RPGB 1Z6UA 2L5UA 2DX8A 2ECVA 3LQIA 4FIPA 2D8SA 3M62A 3C5KA 4GNGA 4GNEA 3U5OA 2VJEA 4WZ3B 4YC9A 2C2VS 3MHHA 5TDRA 2KYUA 2IDAA 1WGMA 2YT5A 4GNDA 2MUMA 3U5MA 2VJFB 1WE9A 2XB1A 4YBMA 5H1TA 2CKLA 1JOCA 5DKAA 4S3OC 4YABA 2LXPC 3PURA 4GB0A 1DVPA 2F42A 3M99A 2F6JA 5TABA 1LDKC 1VYXA 5KH7A 4L7XA 4LLBA 4MVTA 5EYAF 1WESA 3LQHA 1WEVA 3ZYQA 4R8PK 4L58A 1WEPA 5B77A 3SOXA 2CSZA 2KIZA 3GL6A 1VFYA 3T6RA 2LDRA 1V87A 4BBQA 2KGGA 4FJCA 2EA6A 2KFTA 2QIZA 4BHWA 4GNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2D A;  2M3H A;  5H9M A;  1Z60 A;  3O35 A;  2VJE B;  1X4I A;  4LKA A;  2I50 A;  5I3L A;  3C6W A;  5KH9 A;  1E4U A;  3N9L A;  3L1X A;  4R7E A;  2MA6 A;  3L11 A;  2ECT A;  5AIT A;  2G6Q A;  3KNV A;  4IC2 A;  4P5O B;  2CKL B;  2C2L A;  3M63 A;  3RPG C;  1JM7 A;  2YUC A;  4X3G A;  3DQV R;  2L43 A;  5D1M B;  4QF2 A;  5JG6 A;  2XEU A;  2MA5 A;  3O33 A;  2E6S A;  4AP4 A;  3ZNI A;  2K16 A;  4YBT A;  3U5N A;  1T1H A;  1FP0 A;  2QJ0 A;  2LQ6 A;  4AVX A;  2KWK A;  2KRE A;  4ZQL A;  1MM2 A;  2VPB A;  4I7C A;  2M1R A;  4W4U A;  2E6R A;  3O7A A;  2JRJ A;  1WEU A;  3VK6 A;  3PHD A;  1WEW A;  3N9P A;  2YQL A;  1ZBD B;  4WZ2 A;  5KH3 A;  2MT5 A;  5LCW B;  2MD7 B;  2LGV A;  3KV6 A;  2MNY A;  4B7Y C;  4CA1 A;  2ECI A;  2MIQ A;  5H1U A;  5TBN A;  2FUI A;  2KR4 A;  1JM7 B;  2VPD A;  5C11 A;  2K1J A;  1LDJ B;  1VD4 A;  3N9M A;  3O36 A;  5G05 B;  2JMD A;  4AYC B;  2L0B A;  1MM3 A;  2YUR A;  5H1V A;  4QF3 A;  1XWH A;  3MHS A;  4PTB A;  4ZUX U;  4C9Z A;  2PNX A;  1X4J A;  2H0D A;  4FO9 A;  2YHO A;  1WEE A;  2FUU A;  3DPL R;  3ZPV 1;  2Y1N A;  3GV4 A;  2YQM A;  2G43 A;  2FSA A;  2ECW A;  3SHB A;  4UP0 A;  2UZG A;  5G0F A;  3IHP A;  1K2F A;  2YSM A;  4V3L C;  1WEM A;  3EB6 A;  1BOR A;  5C13 A;  4CCG X;  4N3W A;  2YSJ A;  1HYI A;  4I7B A;  4NN2 A;  3FL2 A;  2AN6 A;  5D1L B;  5AIU A;  3ZPV E;  5J3X A;  3U5P A;  1U6G B;  4AYC A;  1WIL A;  4UP5 A;  4FK5 A;  1F62 A;  1CHC A;  1G25 A;  3ZTG A;  1WEQ A;  2HDP A;  2KGI A;  2LGG A;  2L80 A;  3V43 A;  2MNZ A;  4XI1 A;  2VP7 A;  5TDW A;  3NG2 A;  5B8D A;  3RTR B;  2YW8 A;  3ZVY A;  4R2Y A;  3HCT A;  2LV9 A;  2KWN A;  2H0D B;  2YYR A;  4Q6F A;  3SOU A;  1FBV A;  4A0C D;  4A49 A;  4YAT A;  5FEY A;  2LGK A;  3EB5 A;  3L1Z B;  1WIM A;  5B78 A;  5FB0 A;  2KE1 A;  3LRQ A;  2BAY A;  3KQI A;  3N9O A;  4A4C A;  5G04 B;  2RSD A;  4LJN A;  2CSY A;  4YAX A;  1WEN A;  2EGP A;  2PUY A;  4WA6 A;  4B86 C;  5B79 A;  5TRB A;  4AUQ B;  2MD8 C;  2L75 A;  2ZET C;  2LGL A;  3HCU A;  4UI9 B;  4LK9 A;  5FER A;  5D1K B;  2VPG A;  2NAA A;  2K4D A;  2ECJ A;  3O70 A;  2LXH C;  4V3K C;  4I7D A;  2F6N A;  2LN0 A;  3N9N A;  2ECG A;  4S3O B;  2EOD A;  2RI7 A;  2VPE A;  1Z2Q A;  3KV5 A;  3SOW A;  3N9Q A;  1N87 A;  1X4U A;  2KWO A;  2M85 A;  2CT2 A;  3ZVZ B;  2G45 A;  2KWJ A;  3ASL A;  2ECN A;  4ZDT A;  4YBS A;  2QIC A;  2M6M A;  2HYE D;  2KU3 A;  2JMI A;  2VJF A;  4A4B A;  1IYM A;  4MSX A;  4PPE A;  2YU4 A;  3HCS A;  1RMD A;  3O37 A;  3QZV A;  4IC3 A;  3HTK C;  5LKZ A;  5B75 A;  4O64 A;  4WZ0 A;  1HYJ A;  2OXQ C;  2YRE A;  4TKP B;  2VNF A;  2YHN A;  3LQJ A;  3O34 A;  1WEO A;  2JMJ A;  4N4F A;  5LKU A;  3T7L A;  4F52 B;  2LRI C;  4LAD B;  5LKT A;  1WFK A;  5B76 A;  5DIN A;  2Y43 A;  4YAD A;  2Y1M A;  3PUQ A;  5FB1 A;  2K17 A;  5LKX A;  3RPG B;  1Z6U A;  2L5U A;  2DX8 A;  2ECV A;  3LQI A;  4FIP A;  2D8S A;  3M62 A;  3C5K A;  4GNG A;  4GNE A;  3U5O A;  2VJE A;  4WZ3 B;  4YC9 A;  2C2V S;  3MHH A;  5TDR A;  2KYU A;  2IDA A;  1WGM A;  2YT5 A;  4GND A;  2MUM A;  3U5M A;  2VJF B;  1WE9 A;  2XB1 A;  4YBM A;  5H1T A;  2CKL A;  1JOC A;  5DKA A;  4S3O C;  4YAB A;  2LXP C;  3PUR A;  4GB0 A;  1DVP A;  2F42 A;  3M99 A;  2F6J A;  5TAB A;  1LDK C;  1VYX A;  5KH7 A;  4L7X A;  4LLB A;  4MVT A;  5EYA F;  1WES A;  3LQH A;  1WEV A;  3ZYQ A;  4R8P K;  4L58 A;  1WEP A;  5B77 A;  3SOX A;  2CSZ A;  2KIZ A;  3GL6 A;  1VFY A;  3T6R A;  2LDR A;  1V87 A;  4BBQ A;  2KGG A;  4FJC A;  2EA6 A;  2KFT A;  2QIZ A;  4BHW A;  4GNF A; 
#chains in the Genus database with same CATH topology
 3I2D A;  2M3H A;  5H9M A;  1Z60 A;  2CRW A;  3O35 A;  2VJE B;  1X4I A;  4LKA A;  2I50 A;  5I3L A;  3C6W A;  3KDE C;  5KH9 A;  1E4U A;  3N9L A;  3L1X A;  4R7E A;  3JUE A;  2MA6 A;  3L11 A;  2ECT A;  5AIT A;  4Z0R A;  2G6Q A;  3KNV A;  4IC2 A;  4P5O B;  2CKL B;  2M13 A;  2C2L A;  3M63 A;  3RPG C;  2CSV A;  1JM7 A;  2YUC A;  4X3G A;  3DQV R;  2L43 A;  5D1M B;  4QF2 A;  5JG6 A;  2XEU A;  2MA5 A;  3O33 A;  2E6S A;  4AP4 A;  3ZNI A;  2K16 A;  4YBT A;  3U5N A;  4Z0O A;  3DWD A;  1T1H A;  1FP0 A;  2QJ0 A;  2LQ6 A;  4AVX A;  2KWK A;  2B0O E;  2FD4 A;  2KRE A;  4ZQL A;  4I7C A;  1MM2 A;  2VPB A;  2M1R A;  4W4U A;  2E6R A;  3O7A A;  2JRJ A;  2JM3 A;  1WEU A;  3VK6 A;  3PHD A;  1WEW A;  2XP0 A;  3N9P A;  2YQL A;  1ZBD B;  4WZ2 A;  5KH3 A;  2MT5 A;  5LCW B;  2MD7 B;  2LGV A;  3KV6 A;  2MNY A;  5SVY A;  4B7Y C;  4CA1 A;  2ECI A;  2MIQ A;  5H1U A;  5TBN A;  2FUI A;  3LDY A;  2KR4 A;  1JM7 B;  2VPD A;  5C11 A;  2K1J A;  3PLW A;  1LDJ B;  1VD4 A;  3N9M A;  3O36 A;  5G05 B;  2JMD A;  4AYC B;  2L0B A;  1MM3 A;  2YUR A;  5H1V A;  2L7P A;  4QF3 A;  1XWH A;  3MHS A;  4PTB A;  4ZUX U;  4C9Z A;  2PNX A;  3T9K A;  1X4J A;  2H0D A;  4FO9 A;  2YHO A;  1WEE A;  2FUU A;  5K3Q A;  3DPL R;  3ZPV 1;  2Y1N A;  3GV4 A;  2YQM A;  2G43 A;  2FSA A;  2ECW A;  3SHB A;  2YVR A;  4UP0 A;  2UZG A;  5G0F A;  3IHP A;  1K2F A;  2YSM A;  2KKY A;  4V3L C;  5SVI A;  1WEM A;  4OGC A;  3EB6 A;  1BOR A;  4H9D A;  5C13 A;  4CCG X;  4N3W A;  2YSJ A;  1HYI A;  4I7B A;  4NN2 A;  1DCQ A;  3FL2 A;  2AN6 A;  2KKX A;  5D1L B;  5AIU A;  3ZPV E;  5J3X A;  2P57 A;  2EGM A;  3U5P A;  1U6G B;  4AYC A;  1WIL A;  4UP5 A;  4FK5 A;  3M7K A;  1F62 A;  1CHC A;  1G25 A;  3ZTG A;  1WEQ A;  2HDP A;  2XOY A;  2KGI A;  2LGG A;  2L80 A;  3MDB C;  3V43 A;  2MNZ A;  4XI1 A;  2VP7 A;  2EXU A;  5TDW A;  2FFW A;  3NG2 A;  5B8D A;  3RTR B;  2YW8 A;  3ZVY A;  4R2Y A;  3HCT A;  2LV9 A;  2KWN A;  2H0D B;  2YYR A;  4Q6F A;  3SOU A;  1FBV A;  4A0C D;  3SUB A;  4A49 A;  4YAT A;  5FEY A;  2LGK A;  3EB5 A;  3L1Z B;  1WIM A;  5B78 A;  5FB0 A;  4OGE A;  2KE1 A;  3O47 A;  5SVI B;  3LRQ A;  2CON A;  2BAY A;  3KQI A;  3N9O A;  4A4C A;  5G04 B;  2RSD A;  2DSM A;  4LJN A;  2CSY A;  3E2D A;  4YAX A;  1WEN A;  2EGP A;  2PUY A;  4WA6 A;  4B86 C;  5B79 A;  5TRB A;  4AUQ B;  2MD8 C;  2L75 A;  2ZET C;  3FEH A;  2LGL A;  3HCU A;  2E61 A;  4UI9 B;  4LK9 A;  5FER A;  5D1K B;  2VPG A;  2NAA A;  2K4D A;  2ECJ A;  3O70 A;  2LXH C;  4V3K C;  4I7D A;  2F6N A;  2LN0 A;  3N9N A;  2ECG A;  4S3O B;  2EOD A;  2RI7 A;  2VPE A;  1Z2Q A;  3KV5 A;  3DDT A;  3Q1D A;  3SOW A;  3N9Q A;  1N87 A;  1X4U A;  2LAU A;  2CRR A;  2KWO A;  2M85 A;  2CT2 A;  3ZVZ B;  2G45 A;  2KWJ A;  3ASL A;  2ECN A;  4ZDT A;  4YBS A;  2QIC A;  2M6M A;  3FAO A;  2DJA A;  2D8U A;  2HYE D;  2RR4 A;  2KU3 A;  2JMI A;  4QQ4 A;  2VJF A;  4A4B A;  1IYM A;  4MSX A;  4PPE A;  2YU4 A;  3HCS A;  1RMD A;  3O37 A;  3QZV A;  4IC3 A;  3HTK C;  5LKZ A;  5B75 A;  4O64 A;  4WZ0 A;  1HYJ A;  2OXQ C;  2YRE A;  4TKP B;  2VNF A;  2YHN A;  3LQJ A;  3O34 A;  1WEO A;  2JMJ A;  3FAN A;  4N4F A;  5LKU A;  3T7L A;  4F52 B;  2LRI C;  4LAD B;  5LKT A;  1WFK A;  5B76 A;  5DIN A;  2Y43 A;  4YAD A;  2Y1M A;  3PUQ A;  5FB1 A;  2K17 A;  5LKX A;  3RPG B;  1Z6U A;  2L5U A;  2DX8 A;  2ECV A;  5SVX A;  4F1P A;  2IQJ A;  3LQI A;  4FIP A;  2D8S A;  1MBM A;  3M62 A;  4O62 A;  3C5K A;  4GNG A;  4GNE A;  3U5O A;  2VJE A;  4WZ3 B;  4YC9 A;  2XOC A;  3LJU X;  2C2V S;  3MHH A;  5TDR A;  2KYU A;  2IDA A;  1WGM A;  2YT5 A;  4GND A;  2MUM A;  3U5M A;  2VJF B;  1WE9 A;  2XB1 A;  4YBM A;  5H1T A;  2CKL A;  3FJU B;  3H7H A;  1JOC A;  5DKA A;  4S3O C;  4YAB A;  2LXP C;  3PUR A;  4GB0 A;  2JUN A;  1DVP A;  2F42 A;  3M99 A;  2F6J A;  5TAB A;  2OWA A;  1LDK C;  2MKE A;  1VYX A;  5KH7 A;  4L7X A;  4LLB A;  4MVT A;  5EYA F;  3FM8 C;  1WES A;  3LQH A;  1WEV A;  3ZYQ A;  3LVR E;  4R8P K;  4L58 A;  1WEP A;  5B77 A;  3SOX A;  2CSZ A;  2KIZ A;  3GL6 A;  3LVQ E;  1VFY A;  3T6R A;  2LDR A;  1V87 A;  2XOZ A;  4BBQ A;  2KGG A;  4FJC A;  2EA6 A;  2KFT A;  2QIZ A;  4BHW A;  4GNF A; 
#chains in the Genus database with same CATH homology
 3I2D A;  2M3H A;  5H9M A;  1Z60 A;  3O35 A;  2VJE B;  1X4I A;  4LKA A;  2I50 A;  5I3L A;  3C6W A;  5KH9 A;  1E4U A;  3N9L A;  3L1X A;  4R7E A;  2MA6 A;  3L11 A;  2ECT A;  5AIT A;  2G6Q A;  3KNV A;  4IC2 A;  4P5O B;  2CKL B;  2C2L A;  3M63 A;  3RPG C;  1JM7 A;  2YUC A;  4X3G A;  3DQV R;  2L43 A;  5D1M B;  4QF2 A;  5JG6 A;  2XEU A;  2MA5 A;  3O33 A;  2E6S A;  4AP4 A;  3ZNI A;  2K16 A;  4YBT A;  3U5N A;  1T1H A;  1FP0 A;  2QJ0 A;  2LQ6 A;  4AVX A;  2KWK A;  2KRE A;  4ZQL A;  1MM2 A;  2VPB A;  4I7C A;  2M1R A;  4W4U A;  2E6R A;  3O7A A;  2JRJ A;  1WEU A;  3VK6 A;  3PHD A;  1WEW A;  3N9P A;  2YQL A;  1ZBD B;  4WZ2 A;  5KH3 A;  2MT5 A;  5LCW B;  2MD7 B;  2LGV A;  3KV6 A;  2MNY A;  4B7Y C;  4CA1 A;  2ECI A;  2MIQ A;  5H1U A;  5TBN A;  2FUI A;  2KR4 A;  1JM7 B;  2VPD A;  5C11 A;  2K1J A;  1LDJ B;  1VD4 A;  3N9M A;  3O36 A;  5G05 B;  2JMD A;  4AYC B;  2L0B A;  1MM3 A;  2YUR A;  5H1V A;  4QF3 A;  1XWH A;  3MHS A;  4PTB A;  4ZUX U;  4C9Z A;  2PNX A;  1X4J A;  2H0D A;  4FO9 A;  2YHO A;  1WEE A;  2FUU A;  3DPL R;  3ZPV 1;  2Y1N A;  3GV4 A;  2YQM A;  2G43 A;  2FSA A;  2ECW A;  3SHB A;  4UP0 A;  2UZG A;  5G0F A;  3IHP A;  1K2F A;  2YSM A;  4V3L C;  1WEM A;  3EB6 A;  1BOR A;  5C13 A;  4CCG X;  4N3W A;  2YSJ A;  1HYI A;  4I7B A;  4NN2 A;  3FL2 A;  2AN6 A;  5D1L B;  5AIU A;  3ZPV E;  5J3X A;  3U5P A;  1U6G B;  4AYC A;  1WIL A;  4UP5 A;  4FK5 A;  1F62 A;  1CHC A;  1G25 A;  3ZTG A;  1WEQ A;  2HDP A;  2KGI A;  2LGG A;  2L80 A;  3V43 A;  2MNZ A;  4XI1 A;  2VP7 A;  5TDW A;  3NG2 A;  5B8D A;  3RTR B;  2YW8 A;  3ZVY A;  4R2Y A;  3HCT A;  2LV9 A;  2KWN A;  2H0D B;  2YYR A;  4Q6F A;  3SOU A;  1FBV A;  4A0C D;  4A49 A;  4YAT A;  5FEY A;  2LGK A;  3EB5 A;  3L1Z B;  1WIM A;  5B78 A;  5FB0 A;  2KE1 A;  3LRQ A;  2BAY A;  3KQI A;  3N9O A;  4A4C A;  5G04 B;  2RSD A;  4LJN A;  2CSY A;  4YAX A;  1WEN A;  2EGP A;  2PUY A;  4WA6 A;  4B86 C;  5B79 A;  5TRB A;  4AUQ B;  2MD8 C;  2L75 A;  2ZET C;  2LGL A;  3HCU A;  4UI9 B;  4LK9 A;  5FER A;  5D1K B;  2VPG A;  2NAA A;  2K4D A;  2ECJ A;  3O70 A;  2LXH C;  4V3K C;  4I7D A;  2F6N A;  2LN0 A;  3N9N A;  2ECG A;  4S3O B;  2EOD A;  2RI7 A;  2VPE A;  1Z2Q A;  3KV5 A;  3SOW A;  3N9Q A;  1N87 A;  1X4U A;  2KWO A;  2M85 A;  2CT2 A;  3ZVZ B;  2G45 A;  2KWJ A;  3ASL A;  2ECN A;  4ZDT A;  4YBS A;  2QIC A;  2M6M A;  2HYE D;  2KU3 A;  2JMI A;  2VJF A;  4A4B A;  1IYM A;  4MSX A;  4PPE A;  2YU4 A;  3HCS A;  1RMD A;  3O37 A;  3QZV A;  4IC3 A;  3HTK C;  5LKZ A;  5B75 A;  4O64 A;  4WZ0 A;  1HYJ A;  2OXQ C;  2YRE A;  4TKP B;  2VNF A;  2YHN A;  3LQJ A;  3O34 A;  1WEO A;  2JMJ A;  4N4F A;  5LKU A;  3T7L A;  4F52 B;  2LRI C;  4LAD B;  5LKT A;  1WFK A;  5B76 A;  5DIN A;  2Y43 A;  4YAD A;  2Y1M A;  3PUQ A;  5FB1 A;  2K17 A;  5LKX A;  3RPG B;  1Z6U A;  2L5U A;  2DX8 A;  2ECV A;  3LQI A;  4FIP A;  2D8S A;  3M62 A;  3C5K A;  4GNG A;  4GNE A;  3U5O A;  2VJE A;  4WZ3 B;  4YC9 A;  2C2V S;  3MHH A;  5TDR A;  2KYU A;  2IDA A;  1WGM A;  2YT5 A;  4GND A;  2MUM A;  3U5M A;  2VJF B;  1WE9 A;  2XB1 A;  4YBM A;  5H1T A;  2CKL A;  1JOC A;  5DKA A;  4S3O C;  4YAB A;  2LXP C;  3PUR A;  4GB0 A;  1DVP A;  2F42 A;  3M99 A;  2F6J A;  5TAB A;  1LDK C;  1VYX A;  5KH7 A;  4L7X A;  4LLB A;  4MVT A;  5EYA F;  1WES A;  3LQH A;  1WEV A;  3ZYQ A;  4R8P K;  4L58 A;  1WEP A;  5B77 A;  3SOX A;  2CSZ A;  2KIZ A;  3GL6 A;  1VFY A;  3T6R A;  2LDR A;  1V87 A;  4BBQ A;  2KGG A;  4FJC A;  2EA6 A;  2KFT A;  2QIZ A;  4BHW A;  4GNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...