5C11A

Crystal structure of jarid1a phd finger bound to histone h3c4me3 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Lysine-specific demethylase 5A
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c11A00
2E6RA 2M3HA 1N87A 5G05B 1T1HA 1DVPA 2OXQC 3L11A 3SOWA 3O33A 2M85A 3IHPA 1HYJA 4V3LC 2KREA 4YC9A 2KGIA 2CKLA 2KU3A 4UP0A 4PPEA 5DINA 4YABA 4AUQB 2VPGA 4GNGA 2ECWA 5B79A 2MA5A 3EB5A 3SOUA 1WEPA 5D1LB 2DX8A 1LDKC 1JM7A 1WESA 1WEVA 2KE1A 4ZDTA 4LADB 4I7DA 1FBVA 2VPEA 5I3LA 5LCWB 2ECGA 4YBTA 2Y1MA 5H1VA 5C13A 1K2FA 1LDJB 1RMDA 2MNYA 5G04B 1WFKA 2VPBA 2Y43A 3N9LA 4QF2A 4CCGX 2L5UA 2LGKA 4NN2A 3O70A 4WZ3B 4Q6FA 4B7YC 2MIQA 2RSDA 2L75A 3M99A 2QICA 3ASLA 4S3OC 5G0FA 4N4FA 3LQHA 3KQIA 2YQMA 4CA1A 3PURA 4AP4A 5J3XA 5TDWA 4IC3A 2KFTA 1WEQA 2C2LA 1WEOA 1VYXA 2MUMA 5B8DA 2JMIA 1E4UA 1WE9A 4FO9A 4L58A 4O64A 1ZBDB 1WENA 5B77A 2KR4A 4YBMA 2YHOA 4LLBA 2AN6A 2HDPA 1WEMA 3M63A 2JRJA 4WA6A 2PNXA 5KH7A 2VJFA 2VP7A 1X4JA 3N9NA 4FIPA 4QF3A 2KWJA 4S3OB 4WZ0A 1V87A 3FL2A 2VJEB 3N9MA 1BORA 4TKPB 1IYMA 3PHDA 2KWNA 2EODA 2YW8A 2K1JA 2VPDA 3ZVZB 3KV6A 3RPGC 1WEEA 5EYAF 2VNFA 2ZETC 5B75A 5TABA 2CSZA 2HYED 2YREA 3ZTGA 4LKAA 2MD7B 3T7LA 4FK5A 1MM3A 1X4IA 2KWKA 3EB6A 4I7CA 2QJ0A 2K17A 1MM2A 4PTBA 4UP5A 3KV5A 2XB1A 4AYCB 3U5OA 3ZPVE 2RI7A 2H0DB 4MVTA 5H1TA 4BHWA 2I50A 2YQLA 3DQVR 5D1KB 2YUCA 3MHSA 1X4UA 4L7XA 5H9MA 3MHHA 2LXPC 4XI1A 3HCSA 1JM7B 2ECJA 2YURA 2YT5A 2LN0A 5KH3A 2KWOA 1WILA 4AVXA 2YSMA 3PUQA 3LQIA 1XWHA 3I2DA 5FERA 2UZGA 4GB0A 2QIZA 2KGGA 2C2VS 2FSAA 4MSXA 4YATA 2JMDA 3N9OA 2ECVA 1U6GB 3N9QA 4C9ZA 2YU4A 5FB0A 1VD4A 3ZPV1 5KH9A 4R8PK 1WGMA 3SHBA 1G25A 2YYRA 4R2YA 1Z2QA 1WIMA 2CKLB 4A4CA 2LQ6A 2LRIC 5FB1A 5D1MB 3DPLR 3VK6A 2LXHC 1WEUA 2NAAA 3U5PA 2Y1NA 4LJNA 5TBNA 3SOXA 2MNZA 3QZVA 4WZ2A 2ECNA 2L80A 2F6JA 4I7BA 5DKAA 3ZNIA 4X3GA 3C5KA 4R7EA 4YAXA 4GNEA 2VJEA 2M1RA 3HCUA 3N9PA 2KYUA 1Z6UA 2G43A 4A0CD 1F62A 2F42A 2F6NA 3O34A 3U5MA 5JG6A 5FEYA 2D8SA 3LRQA 2PUYA 2YHNA 3C6WA 3O37A 5H1UA 3HCTA 5LKZA 2K16A 2JMJA 3ZYQA 2YSJA 4GNFA 3V43A 2ECIA 3O7AA 2MA6A 3NG2A 3L1ZB 3M62A 5C11A 2FUUA 2L43A 3T6RA 3O35A 2LGLA 5B76A 2CT2A 1HYIA 3GV4A 2M6MA 1CHCA 2KIZA 2IDAA 1FP0A 2K4DA 5B78A 4F52B 4YBSA 4A4BA 4P5OB 5AITA 3KNVA 5LKXA 4YADA 3RTRB 2BAYA 3RPGB 2VJFB 1JOCA 2LV9A 4W4UA 2MD8C 4LK9A 2G45A 4B86C 3LQJA 2FUIA 2CSYA 2MT5A 3HTKC 4AYCA 3O36A 4GNDA 2H0DA 4BBQA 5TDRA 3U5NA 3ZVYA 5LKUA 2LGGA 2E6SA 2ECTA 4FJCA 4V3KC 5LKTA 4ZQLA 2LDRA 4ZUXU 5AIUA 4IC2A 1Z60A 1VFYA 3L1XA 4UI9B 5TRBA 2L0BA 4A49A 2LGVA 2XEUA 4N3WA 3GL6A 2EA6A 1WEWA 2EGPA 2G6QA
chains in the Genus database with same CATH superfamily
3LDYA 2E6RA 2M3HA 1N87A 5G05B 1T1HA 1DVPA 2OXQC 3L11A 3SOWA 3O33A 2M85A 3IHPA 1HYJA 3DDTA 5SVYA 4V3LC 2KREA 4YC9A 2KGIA 2CKLA 2KU3A 4UP0A 4PPEA 5DINA 4YABA 4AUQB 2DSMA 2VPGA 4GNGA 2ECWA 5B79A 2MA5A 3EB5A 3SOUA 1WEPA 5D1LB 2DX8A 1LDKC 4Z0RA 1JM7A 1WESA 1WEVA 5SVXA 2KE1A 4ZDTA 4LADB 4I7DA 1FBVA 2VPEA 5I3LA 5LCWB 2ECGA 4YBTA 2Y1MA 5H1VA 5C13A 2B0OE 1K2FA 1LDJB 3FM8C 1RMDA 2MNYA 5G04B 1WFKA 4Z0OA 2VPBA 2Y43A 3DWDA 3N9LA 4QF2A 4CCGX 2L5UA 2LGKA 4NN2A 3O70A 4WZ3B 4Q6FA 4B7YC 2MIQA 2RSDA 2L75A 3M99A 2QICA 3ASLA 4S3OC 5G0FA 4N4FA 3LQHA 3KQIA 2CSVA 2YQMA 4CA1A 3PURA 4AP4A 5J3XA 5TDWA 4IC3A 2KFTA 1WEQA 2C2LA 1WEOA 1VYXA 2MUMA 5B8DA 2JMIA 1E4UA 1WE9A 4FO9A 4L58A 4O64A 1ZBDB 1WENA 2JUNA 2IQJA 5B77A 2MKEA 3KDEC 2P57A 2KR4A 4YBMA 2YHOA 4LLBA 2AN6A 2HDPA 4OGEA 1WEMA 3M63A 2JRJA 4WA6A 2PNXA 5KH7A 2VJFA 2VP7A 1X4JA 3N9NA 4FIPA 4QF3A 2KWJA 4S3OB 4WZ0A 1V87A 3FL2A 2VJEB 3N9MA 2LAUA 1BORA 3FEHA 4TKPB 1IYMA 3PHDA 2KWNA 2EODA 2YW8A 2K1JA 2VPDA 3ZVZB 5K3QA 2EGMA 3KV6A 3RPGC 1WEEA 5EYAF 2VNFA 2ZETC 5B75A 2E61A 5TABA 2CSZA 2HYED 2YREA 3MDBC 3ZTGA 4LKAA 2MD7B 3T7LA 4FK5A 1MM3A 1X4IA 2KWKA 3EB6A 4I7CA 2QJ0A 2K17A 1MM2A 4PTBA 4UP5A 3KV5A 2XB1A 4AYCB 3U5OA 3ZPVE 3LVRE 2RI7A 2H0DB 4MVTA 5H1TA 4BHWA 2I50A 2YQLA 3DQVR 5D1KB 4QQ4A 2YUCA 3MHSA 1X4UA 4L7XA 5H9MA 3MHHA 4OGCA 2LXPC 3PLWA 4XI1A 3HCSA 1JM7B 2ECJA 2YURA 2YT5A 2LN0A 5KH3A 2KWOA 1WILA 2KKXA 4AVXA 2YSMA 3PUQA 3LQIA 1XWHA 2XP0A 3I2DA 3M7KA 5FERA 2UZGA 4GB0A 2QIZA 2M13A 2KGGA 2C2VS 2FSAA 4YATA 4MSXA 2KKYA 2JMDA 3N9OA 2ECVA 3Q1DA 2DJAA 1U6GB 3N9QA 4C9ZA 1MBMA 3H7HA 2YU4A 4H9DA 5FB0A 1VD4A 3ZPV1 5KH9A 2L7PA 4R8PK 1WGMA 3SHBA 1G25A 2YYRA 3FAOA 4R2YA 2EXUA 5SVIA 1Z2QA 2FD4A 1WIMA 2CKLB 4A4CA 2LQ6A 4F1PA 2LRIC 5FB1A 5D1MB 3DPLR 3VK6A 2LXHC 1WEUA 4O62A 2NAAA 3U5PA 2RR4A 2Y1NA 4LJNA 5TBNA 3SOXA 2MNZA 3QZVA 4WZ2A 2ECNA 2L80A 2F6JA 4I7BA 5DKAA 3ZNIA 3LVQE 4X3GA 3C5KA 4R7EA 4YAXA 4GNEA 2XOCA 2VJEA 2M1RA 3HCUA 3N9PA 2KYUA 1Z6UA 2G43A 4A0CD 1F62A 2F42A 2F6NA 5SVIB 3O34A 3U5MA 5JG6A 3O47A 5FEYA 2D8SA 3LRQA 2PUYA 2YHNA 2D8UA 3C6WA 3SUBA 3O37A 2XOYA 5H1UA 3HCTA 5LKZA 2K16A 2JMJA 3ZYQA 2YSJA 4GNFA 3V43A 2ECIA 3O7AA 2MA6A 2CONA 3NG2A 3L1ZB 3M62A 5C11A 2CRRA 2FUUA 2L43A 3T6RA 2YVRA 3O35A 2LGLA 2JM3A 2CRWA 3FANA 5B76A 1DCQA 2CT2A 1HYIA 3GV4A 2M6MA 1CHCA 2KIZA 2IDAA 1FP0A 2K4DA 5B78A 4F52B 4YBSA 4A4BA 4P5OB 5AITA 3KNVA 5LKXA 4YADA 3RTRB 2BAYA 3RPGB 2VJFB 1JOCA 2LV9A 4W4UA 2MD8C 4LK9A 3JUEA 2G45A 4B86C 3LQJA 2FUIA 2CSYA 2MT5A 3HTKC 4AYCA 3T9KA 3O36A 4GNDA 2H0DA 3FJUB 4BBQA 5TDRA 3U5NA 3ZVYA 5LKUA 2LGGA 2E6SA 2ECTA 2XOZA 4FJCA 4V3KC 5LKTA 4ZQLA 2LDRA 4ZUXU 3LJUX 5AIUA 4IC2A 1Z60A 1VFYA 3L1XA 4UI9B 3E2DA 2OWAA 5TRBA 2L0BA 4A49A 2FFWA 2LGVA 2XEUA 4N3WA 3GL6A 2EA6A 1WEWA 2EGPA 2G6QA
chains in the Genus database with same CATH topology
2E6RA 2M3HA 1N87A 5G05B 1T1HA 1DVPA 2OXQC 3L11A 3SOWA 3O33A 2M85A 3IHPA 1HYJA 4V3LC 2KREA 4YC9A 2KGIA 2CKLA 2KU3A 4UP0A 4PPEA 5DINA 4YABA 4AUQB 2VPGA 4GNGA 2ECWA 5B79A 2MA5A 3EB5A 3SOUA 1WEPA 5D1LB 2DX8A 1LDKC 1JM7A 1WESA 1WEVA 2KE1A 4ZDTA 4LADB 4I7DA 1FBVA 2VPEA 5I3LA 5LCWB 2ECGA 4YBTA 2Y1MA 5H1VA 5C13A 1K2FA 1LDJB 1RMDA 2MNYA 5G04B 1WFKA 2VPBA 2Y43A 3N9LA 4QF2A 4CCGX 2L5UA 2LGKA 4NN2A 3O70A 4WZ3B 4Q6FA 4B7YC 2MIQA 2RSDA 2L75A 3M99A 2QICA 3ASLA 4S3OC 5G0FA 4N4FA 3LQHA 3KQIA 2YQMA 4CA1A 3PURA 4AP4A 5J3XA 5TDWA 4IC3A 2KFTA 1WEQA 2C2LA 1WEOA 1VYXA 2MUMA 5B8DA 2JMIA 1E4UA 1WE9A 4FO9A 4L58A 4O64A 1ZBDB 1WENA 5B77A 2KR4A 4YBMA 2YHOA 4LLBA 2AN6A 2HDPA 1WEMA 3M63A 2JRJA 4WA6A 2PNXA 5KH7A 2VJFA 2VP7A 1X4JA 3N9NA 4FIPA 4QF3A 2KWJA 4S3OB 4WZ0A 1V87A 3FL2A 2VJEB 3N9MA 1BORA 4TKPB 1IYMA 3PHDA 2KWNA 2EODA 2YW8A 2K1JA 2VPDA 3ZVZB 3KV6A 3RPGC 1WEEA 5EYAF 2VNFA 2ZETC 5B75A 5TABA 2CSZA 2HYED 2YREA 3ZTGA 4LKAA 2MD7B 3T7LA 4FK5A 1MM3A 1X4IA 2KWKA 3EB6A 4I7CA 2QJ0A 2K17A 1MM2A 4PTBA 4UP5A 3KV5A 2XB1A 4AYCB 3U5OA 3ZPVE 2RI7A 2H0DB 4MVTA 5H1TA 4BHWA 2I50A 2YQLA 3DQVR 5D1KB 2YUCA 3MHSA 1X4UA 4L7XA 5H9MA 3MHHA 2LXPC 4XI1A 3HCSA 1JM7B 2ECJA 2YURA 2YT5A 2LN0A 5KH3A 2KWOA 1WILA 4AVXA 2YSMA 3PUQA 3LQIA 1XWHA 3I2DA 5FERA 2UZGA 4GB0A 2QIZA 2KGGA 2C2VS 2FSAA 4MSXA 4YATA 2JMDA 3N9OA 2ECVA 1U6GB 3N9QA 4C9ZA 2YU4A 5FB0A 1VD4A 3ZPV1 5KH9A 4R8PK 1WGMA 3SHBA 1G25A 2YYRA 4R2YA 1Z2QA 1WIMA 2CKLB 4A4CA 2LQ6A 2LRIC 5FB1A 5D1MB 3DPLR 3VK6A 2LXHC 1WEUA 2NAAA 3U5PA 2Y1NA 4LJNA 5TBNA 3SOXA 2MNZA 3QZVA 4WZ2A 2ECNA 2L80A 2F6JA 4I7BA 5DKAA 3ZNIA 4X3GA 3C5KA 4R7EA 4YAXA 4GNEA 2VJEA 2M1RA 3HCUA 3N9PA 2KYUA 1Z6UA 2G43A 4A0CD 1F62A 2F42A 2F6NA 3O34A 3U5MA 5JG6A 5FEYA 2D8SA 3LRQA 2PUYA 2YHNA 3C6WA 3O37A 5H1UA 3HCTA 5LKZA 2K16A 2JMJA 3ZYQA 2YSJA 4GNFA 3V43A 2ECIA 3O7AA 2MA6A 3NG2A 3L1ZB 3M62A 5C11A 2FUUA 2L43A 3T6RA 3O35A 2LGLA 5B76A 2CT2A 1HYIA 3GV4A 2M6MA 1CHCA 2KIZA 2IDAA 1FP0A 2K4DA 5B78A 4F52B 4YBSA 4A4BA 4P5OB 5AITA 3KNVA 5LKXA 4YADA 3RTRB 2BAYA 3RPGB 2VJFB 1JOCA 2LV9A 4W4UA 2MD8C 4LK9A 2G45A 4B86C 3LQJA 2FUIA 2CSYA 2MT5A 3HTKC 4AYCA 3O36A 4GNDA 2H0DA 4BBQA 5TDRA 3U5NA 3ZVYA 5LKUA 2LGGA 2E6SA 2ECTA 4FJCA 4V3KC 5LKTA 4ZQLA 2LDRA 4ZUXU 5AIUA 4IC2A 1Z60A 1VFYA 3L1XA 4UI9B 5TRBA 2L0BA 4A49A 2LGVA 2XEUA 4N3WA 3GL6A 2EA6A 1WEWA 2EGPA 2G6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6R A;  2M3H A;  1N87 A;  5G05 B;  1T1H A;  1DVP A;  2OXQ C;  3L11 A;  3SOW A;  3O33 A;  2M85 A;  3IHP A;  1HYJ A;  4V3L C;  2KRE A;  4YC9 A;  2KGI A;  2CKL A;  2KU3 A;  4UP0 A;  4PPE A;  5DIN A;  4YAB A;  4AUQ B;  2VPG A;  4GNG A;  2ECW A;  5B79 A;  2MA5 A;  3EB5 A;  3SOU A;  1WEP A;  5D1L B;  2DX8 A;  1LDK C;  1JM7 A;  1WES A;  1WEV A;  2KE1 A;  4ZDT A;  4LAD B;  4I7D A;  1FBV A;  2VPE A;  5I3L A;  5LCW B;  2ECG A;  4YBT A;  2Y1M A;  5H1V A;  5C13 A;  1K2F A;  1LDJ B;  1RMD A;  2MNY A;  5G04 B;  1WFK A;  2VPB A;  2Y43 A;  3N9L A;  4QF2 A;  4CCG X;  2L5U A;  2LGK A;  4NN2 A;  3O70 A;  4WZ3 B;  4Q6F A;  4B7Y C;  2MIQ A;  2RSD A;  2L75 A;  3M99 A;  2QIC A;  3ASL A;  4S3O C;  5G0F A;  4N4F A;  3LQH A;  3KQI A;  2YQM A;  4CA1 A;  3PUR A;  4AP4 A;  5J3X A;  5TDW A;  4IC3 A;  2KFT A;  1WEQ A;  2C2L A;  1WEO A;  1VYX A;  2MUM A;  5B8D A;  2JMI A;  1E4U A;  1WE9 A;  4FO9 A;  4L58 A;  4O64 A;  1ZBD B;  1WEN A;  5B77 A;  2KR4 A;  4YBM A;  2YHO A;  4LLB A;  2AN6 A;  2HDP A;  1WEM A;  3M63 A;  2JRJ A;  4WA6 A;  2PNX A;  5KH7 A;  2VJF A;  2VP7 A;  1X4J A;  3N9N A;  4FIP A;  4QF3 A;  2KWJ A;  4S3O B;  4WZ0 A;  1V87 A;  3FL2 A;  2VJE B;  3N9M A;  1BOR A;  4TKP B;  1IYM A;  3PHD A;  2KWN A;  2EOD A;  2YW8 A;  2K1J A;  2VPD A;  3ZVZ B;  3KV6 A;  3RPG C;  1WEE A;  5EYA F;  2VNF A;  2ZET C;  5B75 A;  5TAB A;  2CSZ A;  2HYE D;  2YRE A;  3ZTG A;  4LKA A;  2MD7 B;  3T7L A;  4FK5 A;  1MM3 A;  1X4I A;  2KWK A;  3EB6 A;  4I7C A;  2QJ0 A;  2K17 A;  1MM2 A;  4PTB A;  4UP5 A;  3KV5 A;  2XB1 A;  4AYC B;  3U5O A;  3ZPV E;  2RI7 A;  2H0D B;  4MVT A;  5H1T A;  4BHW A;  2I50 A;  2YQL A;  3DQV R;  5D1K B;  2YUC A;  3MHS A;  1X4U A;  4L7X A;  5H9M A;  3MHH A;  2LXP C;  4XI1 A;  3HCS A;  1JM7 B;  2ECJ A;  2YUR A;  2YT5 A;  2LN0 A;  5KH3 A;  2KWO A;  1WIL A;  4AVX A;  2YSM A;  3PUQ A;  3LQI A;  1XWH A;  3I2D A;  5FER A;  2UZG A;  4GB0 A;  2QIZ A;  2KGG A;  2C2V S;  2FSA A;  4MSX A;  4YAT A;  2JMD A;  3N9O A;  2ECV A;  1U6G B;  3N9Q A;  4C9Z A;  2YU4 A;  5FB0 A;  1VD4 A;  3ZPV 1;  5KH9 A;  4R8P K;  1WGM A;  3SHB A;  1G25 A;  2YYR A;  4R2Y A;  1Z2Q A;  1WIM A;  2CKL B;  4A4C A;  2LQ6 A;  2LRI C;  5FB1 A;  5D1M B;  3DPL R;  3VK6 A;  2LXH C;  1WEU A;  2NAA A;  3U5P A;  2Y1N A;  4LJN A;  5TBN A;  3SOX A;  2MNZ A;  3QZV A;  4WZ2 A;  2ECN A;  2L80 A;  2F6J A;  4I7B A;  5DKA A;  3ZNI A;  4X3G A;  3C5K A;  4R7E A;  4YAX A;  4GNE A;  2VJE A;  2M1R A;  3HCU A;  3N9P A;  2KYU A;  1Z6U A;  2G43 A;  4A0C D;  1F62 A;  2F42 A;  2F6N A;  3O34 A;  3U5M A;  5JG6 A;  5FEY A;  2D8S A;  3LRQ A;  2PUY A;  2YHN A;  3C6W A;  3O37 A;  5H1U A;  3HCT A;  5LKZ A;  2K16 A;  2JMJ A;  3ZYQ A;  2YSJ A;  4GNF A;  3V43 A;  2ECI A;  3O7A A;  2MA6 A;  3NG2 A;  3L1Z B;  3M62 A;  5C11 A;  2FUU A;  2L43 A;  3T6R A;  3O35 A;  2LGL A;  5B76 A;  2CT2 A;  1HYI A;  3GV4 A;  2M6M A;  1CHC A;  2KIZ A;  2IDA A;  1FP0 A;  2K4D A;  5B78 A;  4F52 B;  4YBS A;  4A4B A;  4P5O B;  5AIT A;  3KNV A;  5LKX A;  4YAD A;  3RTR B;  2BAY A;  3RPG B;  2VJF B;  1JOC A;  2LV9 A;  4W4U A;  2MD8 C;  4LK9 A;  2G45 A;  4B86 C;  3LQJ A;  2FUI A;  2CSY A;  2MT5 A;  3HTK C;  4AYC A;  3O36 A;  4GND A;  2H0D A;  4BBQ A;  5TDR A;  3U5N A;  3ZVY A;  5LKU A;  2LGG A;  2E6S A;  2ECT A;  4FJC A;  4V3K C;  5LKT A;  4ZQL A;  2LDR A;  4ZUX U;  5AIU A;  4IC2 A;  1Z60 A;  1VFY A;  3L1X A;  4UI9 B;  5TRB A;  2L0B A;  4A49 A;  2LGV A;  2XEU A;  4N3W A;  3GL6 A;  2EA6 A;  1WEW A;  2EGP A;  2G6Q A; 
#chains in the Genus database with same CATH topology
 3LDY A;  2E6R A;  2M3H A;  1N87 A;  5G05 B;  1T1H A;  1DVP A;  2OXQ C;  3L11 A;  3SOW A;  3O33 A;  2M85 A;  3IHP A;  1HYJ A;  3DDT A;  5SVY A;  4V3L C;  2KRE A;  4YC9 A;  2KGI A;  2CKL A;  2KU3 A;  4UP0 A;  4PPE A;  5DIN A;  4YAB A;  4AUQ B;  2DSM A;  2VPG A;  4GNG A;  2ECW A;  5B79 A;  2MA5 A;  3EB5 A;  3SOU A;  1WEP A;  5D1L B;  2DX8 A;  1LDK C;  4Z0R A;  1JM7 A;  1WES A;  1WEV A;  5SVX A;  2KE1 A;  4ZDT A;  4LAD B;  4I7D A;  1FBV A;  2VPE A;  5I3L A;  5LCW B;  2ECG A;  4YBT A;  2Y1M A;  5H1V A;  5C13 A;  2B0O E;  1K2F A;  1LDJ B;  3FM8 C;  1RMD A;  2MNY A;  5G04 B;  1WFK A;  4Z0O A;  2VPB A;  2Y43 A;  3DWD A;  3N9L A;  4QF2 A;  4CCG X;  2L5U A;  2LGK A;  4NN2 A;  3O70 A;  4WZ3 B;  4Q6F A;  4B7Y C;  2MIQ A;  2RSD A;  2L75 A;  3M99 A;  2QIC A;  3ASL A;  4S3O C;  5G0F A;  4N4F A;  3LQH A;  3KQI A;  2CSV A;  2YQM A;  4CA1 A;  3PUR A;  4AP4 A;  5J3X A;  5TDW A;  4IC3 A;  2KFT A;  1WEQ A;  2C2L A;  1WEO A;  1VYX A;  2MUM A;  5B8D A;  2JMI A;  1E4U A;  1WE9 A;  4FO9 A;  4L58 A;  4O64 A;  1ZBD B;  1WEN A;  2JUN A;  2IQJ A;  5B77 A;  2MKE A;  3KDE C;  2P57 A;  2KR4 A;  4YBM A;  2YHO A;  4LLB A;  2AN6 A;  2HDP A;  4OGE A;  1WEM A;  3M63 A;  2JRJ A;  4WA6 A;  2PNX A;  5KH7 A;  2VJF A;  2VP7 A;  1X4J A;  3N9N A;  4FIP A;  4QF3 A;  2KWJ A;  4S3O B;  4WZ0 A;  1V87 A;  3FL2 A;  2VJE B;  3N9M A;  2LAU A;  1BOR A;  3FEH A;  4TKP B;  1IYM A;  3PHD A;  2KWN A;  2EOD A;  2YW8 A;  2K1J A;  2VPD A;  3ZVZ B;  5K3Q A;  2EGM A;  3KV6 A;  3RPG C;  1WEE A;  5EYA F;  2VNF A;  2ZET C;  5B75 A;  2E61 A;  5TAB A;  2CSZ A;  2HYE D;  2YRE A;  3MDB C;  3ZTG A;  4LKA A;  2MD7 B;  3T7L A;  4FK5 A;  1MM3 A;  1X4I A;  2KWK A;  3EB6 A;  4I7C A;  2QJ0 A;  2K17 A;  1MM2 A;  4PTB A;  4UP5 A;  3KV5 A;  2XB1 A;  4AYC B;  3U5O A;  3ZPV E;  3LVR E;  2RI7 A;  2H0D B;  4MVT A;  5H1T A;  4BHW A;  2I50 A;  2YQL A;  3DQV R;  5D1K B;  4QQ4 A;  2YUC A;  3MHS A;  1X4U A;  4L7X A;  5H9M A;  3MHH A;  4OGC A;  2LXP C;  3PLW A;  4XI1 A;  3HCS A;  1JM7 B;  2ECJ A;  2YUR A;  2YT5 A;  2LN0 A;  5KH3 A;  2KWO A;  1WIL A;  2KKX A;  4AVX A;  2YSM A;  3PUQ A;  3LQI A;  1XWH A;  2XP0 A;  3I2D A;  3M7K A;  5FER A;  2UZG A;  4GB0 A;  2QIZ A;  2M13 A;  2KGG A;  2C2V S;  2FSA A;  4YAT A;  4MSX A;  2KKY A;  2JMD A;  3N9O A;  2ECV A;  3Q1D A;  2DJA A;  1U6G B;  3N9Q A;  4C9Z A;  1MBM A;  3H7H A;  2YU4 A;  4H9D A;  5FB0 A;  1VD4 A;  3ZPV 1;  5KH9 A;  2L7P A;  4R8P K;  1WGM A;  3SHB A;  1G25 A;  2YYR A;  3FAO A;  4R2Y A;  2EXU A;  5SVI A;  1Z2Q A;  2FD4 A;  1WIM A;  2CKL B;  4A4C A;  2LQ6 A;  4F1P A;  2LRI C;  5FB1 A;  5D1M B;  3DPL R;  3VK6 A;  2LXH C;  1WEU A;  4O62 A;  2NAA A;  3U5P A;  2RR4 A;  2Y1N A;  4LJN A;  5TBN A;  3SOX A;  2MNZ A;  3QZV A;  4WZ2 A;  2ECN A;  2L80 A;  2F6J A;  4I7B A;  5DKA A;  3ZNI A;  3LVQ E;  4X3G A;  3C5K A;  4R7E A;  4YAX A;  4GNE A;  2XOC A;  2VJE A;  2M1R A;  3HCU A;  3N9P A;  2KYU A;  1Z6U A;  2G43 A;  4A0C D;  1F62 A;  2F42 A;  2F6N A;  5SVI B;  3O34 A;  3U5M A;  5JG6 A;  3O47 A;  5FEY A;  2D8S A;  3LRQ A;  2PUY A;  2YHN A;  2D8U A;  3C6W A;  3SUB A;  3O37 A;  2XOY A;  5H1U A;  3HCT A;  5LKZ A;  2K16 A;  2JMJ A;  3ZYQ A;  2YSJ A;  4GNF A;  3V43 A;  2ECI A;  3O7A A;  2MA6 A;  2CON A;  3NG2 A;  3L1Z B;  3M62 A;  5C11 A;  2CRR A;  2FUU A;  2L43 A;  3T6R A;  2YVR A;  3O35 A;  2LGL A;  2JM3 A;  2CRW A;  3FAN A;  5B76 A;  1DCQ A;  2CT2 A;  1HYI A;  3GV4 A;  2M6M A;  1CHC A;  2KIZ A;  2IDA A;  1FP0 A;  2K4D A;  5B78 A;  4F52 B;  4YBS A;  4A4B A;  4P5O B;  5AIT A;  3KNV A;  5LKX A;  4YAD A;  3RTR B;  2BAY A;  3RPG B;  2VJF B;  1JOC A;  2LV9 A;  4W4U A;  2MD8 C;  4LK9 A;  3JUE A;  2G45 A;  4B86 C;  3LQJ A;  2FUI A;  2CSY A;  2MT5 A;  3HTK C;  4AYC A;  3T9K A;  3O36 A;  4GND A;  2H0D A;  3FJU B;  4BBQ A;  5TDR A;  3U5N A;  3ZVY A;  5LKU A;  2LGG A;  2E6S A;  2ECT A;  2XOZ A;  4FJC A;  4V3K C;  5LKT A;  4ZQL A;  2LDR A;  4ZUX U;  3LJU X;  5AIU A;  4IC2 A;  1Z60 A;  1VFY A;  3L1X A;  4UI9 B;  3E2D A;  2OWA A;  5TRB A;  2L0B A;  4A49 A;  2FFW A;  2LGV A;  2XEU A;  4N3W A;  3GL6 A;  2EA6 A;  1WEW A;  2EGP A;  2G6Q A; 
#chains in the Genus database with same CATH homology
 2E6R A;  2M3H A;  1N87 A;  5G05 B;  1T1H A;  1DVP A;  2OXQ C;  3L11 A;  3SOW A;  3O33 A;  2M85 A;  3IHP A;  1HYJ A;  4V3L C;  2KRE A;  4YC9 A;  2KGI A;  2CKL A;  2KU3 A;  4UP0 A;  4PPE A;  5DIN A;  4YAB A;  4AUQ B;  2VPG A;  4GNG A;  2ECW A;  5B79 A;  2MA5 A;  3EB5 A;  3SOU A;  1WEP A;  5D1L B;  2DX8 A;  1LDK C;  1JM7 A;  1WES A;  1WEV A;  2KE1 A;  4ZDT A;  4LAD B;  4I7D A;  1FBV A;  2VPE A;  5I3L A;  5LCW B;  2ECG A;  4YBT A;  2Y1M A;  5H1V A;  5C13 A;  1K2F A;  1LDJ B;  1RMD A;  2MNY A;  5G04 B;  1WFK A;  2VPB A;  2Y43 A;  3N9L A;  4QF2 A;  4CCG X;  2L5U A;  2LGK A;  4NN2 A;  3O70 A;  4WZ3 B;  4Q6F A;  4B7Y C;  2MIQ A;  2RSD A;  2L75 A;  3M99 A;  2QIC A;  3ASL A;  4S3O C;  5G0F A;  4N4F A;  3LQH A;  3KQI A;  2YQM A;  4CA1 A;  3PUR A;  4AP4 A;  5J3X A;  5TDW A;  4IC3 A;  2KFT A;  1WEQ A;  2C2L A;  1WEO A;  1VYX A;  2MUM A;  5B8D A;  2JMI A;  1E4U A;  1WE9 A;  4FO9 A;  4L58 A;  4O64 A;  1ZBD B;  1WEN A;  5B77 A;  2KR4 A;  4YBM A;  2YHO A;  4LLB A;  2AN6 A;  2HDP A;  1WEM A;  3M63 A;  2JRJ A;  4WA6 A;  2PNX A;  5KH7 A;  2VJF A;  2VP7 A;  1X4J A;  3N9N A;  4FIP A;  4QF3 A;  2KWJ A;  4S3O B;  4WZ0 A;  1V87 A;  3FL2 A;  2VJE B;  3N9M A;  1BOR A;  4TKP B;  1IYM A;  3PHD A;  2KWN A;  2EOD A;  2YW8 A;  2K1J A;  2VPD A;  3ZVZ B;  3KV6 A;  3RPG C;  1WEE A;  5EYA F;  2VNF A;  2ZET C;  5B75 A;  5TAB A;  2CSZ A;  2HYE D;  2YRE A;  3ZTG A;  4LKA A;  2MD7 B;  3T7L A;  4FK5 A;  1MM3 A;  1X4I A;  2KWK A;  3EB6 A;  4I7C A;  2QJ0 A;  2K17 A;  1MM2 A;  4PTB A;  4UP5 A;  3KV5 A;  2XB1 A;  4AYC B;  3U5O A;  3ZPV E;  2RI7 A;  2H0D B;  4MVT A;  5H1T A;  4BHW A;  2I50 A;  2YQL A;  3DQV R;  5D1K B;  2YUC A;  3MHS A;  1X4U A;  4L7X A;  5H9M A;  3MHH A;  2LXP C;  4XI1 A;  3HCS A;  1JM7 B;  2ECJ A;  2YUR A;  2YT5 A;  2LN0 A;  5KH3 A;  2KWO A;  1WIL A;  4AVX A;  2YSM A;  3PUQ A;  3LQI A;  1XWH A;  3I2D A;  5FER A;  2UZG A;  4GB0 A;  2QIZ A;  2KGG A;  2C2V S;  2FSA A;  4MSX A;  4YAT A;  2JMD A;  3N9O A;  2ECV A;  1U6G B;  3N9Q A;  4C9Z A;  2YU4 A;  5FB0 A;  1VD4 A;  3ZPV 1;  5KH9 A;  4R8P K;  1WGM A;  3SHB A;  1G25 A;  2YYR A;  4R2Y A;  1Z2Q A;  1WIM A;  2CKL B;  4A4C A;  2LQ6 A;  2LRI C;  5FB1 A;  5D1M B;  3DPL R;  3VK6 A;  2LXH C;  1WEU A;  2NAA A;  3U5P A;  2Y1N A;  4LJN A;  5TBN A;  3SOX A;  2MNZ A;  3QZV A;  4WZ2 A;  2ECN A;  2L80 A;  2F6J A;  4I7B A;  5DKA A;  3ZNI A;  4X3G A;  3C5K A;  4R7E A;  4YAX A;  4GNE A;  2VJE A;  2M1R A;  3HCU A;  3N9P A;  2KYU A;  1Z6U A;  2G43 A;  4A0C D;  1F62 A;  2F42 A;  2F6N A;  3O34 A;  3U5M A;  5JG6 A;  5FEY A;  2D8S A;  3LRQ A;  2PUY A;  2YHN A;  3C6W A;  3O37 A;  5H1U A;  3HCT A;  5LKZ A;  2K16 A;  2JMJ A;  3ZYQ A;  2YSJ A;  4GNF A;  3V43 A;  2ECI A;  3O7A A;  2MA6 A;  3NG2 A;  3L1Z B;  3M62 A;  5C11 A;  2FUU A;  2L43 A;  3T6R A;  3O35 A;  2LGL A;  5B76 A;  2CT2 A;  1HYI A;  3GV4 A;  2M6M A;  1CHC A;  2KIZ A;  2IDA A;  1FP0 A;  2K4D A;  5B78 A;  4F52 B;  4YBS A;  4A4B A;  4P5O B;  5AIT A;  3KNV A;  5LKX A;  4YAD A;  3RTR B;  2BAY A;  3RPG B;  2VJF B;  1JOC A;  2LV9 A;  4W4U A;  2MD8 C;  4LK9 A;  2G45 A;  4B86 C;  3LQJ A;  2FUI A;  2CSY A;  2MT5 A;  3HTK C;  4AYC A;  3O36 A;  4GND A;  2H0D A;  4BBQ A;  5TDR A;  3U5N A;  3ZVY A;  5LKU A;  2LGG A;  2E6S A;  2ECT A;  4FJC A;  4V3K C;  5LKT A;  4ZQL A;  2LDR A;  4ZUX U;  5AIU A;  4IC2 A;  1Z60 A;  1VFY A;  3L1X A;  4UI9 B;  5TRB A;  2L0B A;  4A49 A;  2LGV A;  2XEU A;  4N3W A;  3GL6 A;  2EA6 A;  1WEW A;  2EGP A;  2G6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...