5C11A

Crystal structure of jarid1a phd finger bound to histone h3c4me3 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 5A
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c11A00
1VYXA 2VJFB 4LK9A 2IDAA 3N9MA 2LXHC 2D8SA 4YBSA 2KWOA 1Z2QA 5G04B 2H0DA 2L43A 3ZYQA 3O33A 3T6RA 2KIZA 2MA6A 4LADB 1RMDA 5B76A 2K16A 3O36A 2M1RA 5I3LA 2M85A 5D1KB 1K2FA 4XI1A 1X4UA 3U5OA 2RSDA 2ECGA 4CA1A 4QF3A 2Y43A 5KH7A 2CT2A 4C9ZA 1WEOA 2YREA 3HCSA 2CSZA 5H1TA 1WEWA 4V3KC 5LKXA 3DPLR 4BHWA 2KFTA 3SOXA 2EODA 4YADA 5AITA 4GNDA 5B75A 5TDRA 2F42A 2LGKA 1WESA 2FSAA 2PUYA 4WZ0A 2QIZA 1ZBDB 1U6GB 1G25A 5TBNA 2F6JA 2JMDA 2LGVA 4AYCB 2L0BA 5B77A 2HYED 4P5OB 4TKPB 5EYAF 1BORA 2ECVA 5FERA 2LQ6A 4LJNA 3N9PA 2VJEA 2JMIA 1WEPA 2Y1NA 4LLBA 1E4UA 2VNFA 2CSYA 2CKLA 4N4FA 5FB0A 2LDRA 2YURA 3L1XA 2VPBA 2KWJA 3GV4A 1T1HA 4LKAA 2QICA 3SOWA 3T7LA 2KWNA 1VD4A 3RPGC 2ECWA 4A0CD 4YBTA 3N9NA 3VK6A 2LV9A 2BAYA 2G43A 3L1ZB 3O35A 3M63A 4FK5A 3U5NA 2PNXA 5H1VA 4GNFA 2MNZA 3KV6A 5G05B 2EGPA 1Z60A 4UP0A 2K1JA 4FJCA 4IC3A 4UP5A 4GB0A 3KV5A 3MHSA 2JRJA 2MT5A 5B8DA 2YU4A 3ZTGA 5TDWA 2E6RA 1MM2A 2G45A 2L5UA 4WZ3B 3SOUA 2H0DB 4B7YC 2ECJA 4I7DA 1HYIA 2ECTA 2ECNA 3I2DA 1WENA 5C13A 5LKZA 3PUQA 4V3LC 1MM3A 5TABA 4I7BA 4PTBA 3SHBA 3HCUA 4GNGA 4S3OB 2KGGA 1JM7A 5JG6A 4IC2A 1WEEA 5B79A 3HTKC 3LQHA 1F62A 4W4UA 2LRIC 3MHHA 1Z6UA 2RI7A 1X4IA 2C2VS 3LRQA 2MD8C 4A4BA 2F6NA 3N9QA 1FBVA 4WA6A 1WFKA 1LDJB 2FUUA 3ZVYA 2HDPA 3ZPVE 1VFYA 2MD7B 4UI9B 1WEQA 3DQVR 1DVPA 2Y1MA 1V87A 4S3OC 5B78A 5H9MA 5LKTA 2MA5A 3M62A 2ECIA 1FP0A 5FEYA 4AUQB 2L75A 3N9OA 1IYMA 1X4JA 4ZDTA 2L80A 3NG2A 2VJEB 3U5MA 2LGLA 2YHNA 4Q6FA 4R7EA 2CKLB 5LCWB 2LN0A 2VPEA 2VJFA 3O37A 2KYUA 4R2YA 2FUIA 2VPDA 5KH9A 3RTRB 2KWKA 2YW8A 5D1LB 2VP7A 4GNEA 5TRBA 1CHCA 3ZPV1 2YQLA 3HCTA 5LKUA 2MUMA 4PPEA 2KE1A 2EA6A 3EB5A 5C11A 1HYJA 3FL2A 2KGIA 4FO9A 4L58A 1WILA 4B86C 3ZVZB 4MSXA 4WZ2A 4R8PK 4I7CA 4MVTA 4A4CA 3ASLA 5DINA 5D1MB 5KH3A 2E6SA 4QF2A 4NN2A 3N9LA 4FIPA 2KREA 1JOCA 3C5KA 1WGMA 3M99A 2ZETC 5AIUA 3LQJA 3O70A 4ZUXU 3LQIA 4AYCA 4BBQA 3KNVA 2NAAA 3U5PA 4YBMA 1WIMA 1JM7B 4O64A 2DX8A 3EB6A 2YQMA 2YSJA 2YHOA 4F52B 3V43A 2YUCA 4YATA 2KU3A 2YSMA 4N3WA 4L7XA 5DKAA 4CCGX 4X3GA 1WEUA 2VPGA 3RPGB 4A49A 4AVXA 2MNYA 5FB1A 3GL6A 1WEMA 2XB1A 2MIQA 3L11A 3PHDA 4YABA 2K17A 2QJ0A 3PURA 2YT5A 2AN6A 5J3XA 5G0FA 2XEUA 2I50A 2KR4A 1LDKC 3IHPA 2UZGA 2M6MA 3QZVA 1N87A 3O7AA 4ZQLA 1WE9A 2C2LA 3KQIA 2LGGA 1WEVA 4YC9A 2JMJA 3C6WA 2YYRA 2OXQC 4AP4A 4YAXA 2G6QA 3O34A 2M3HA 2K4DA 2LXPC 3ZNIA 5H1UA 1XWHA
chains in the Genus database with same CATH superfamily
1VYXA 2VJFB 4LK9A 2IDAA 3N9MA 2P57A 2LXHC 2D8SA 4YBSA 2KWOA 1Z2QA 2JUNA 5G04B 2H0DA 2L43A 3ZYQA 3O33A 3T6RA 2KIZA 2MA6A 4LADB 1RMDA 5B76A 3T9KA 2JM3A 2K16A 3O36A 2M1RA 5I3LA 2M85A 5D1KB 1K2FA 4XI1A 2EXUA 1X4UA 3DWDA 3U5OA 2RSDA 2M13A 2ECGA 4CA1A 4QF3A 2Y43A 5KH7A 2CT2A 4C9ZA 1WEOA 2YREA 3HCSA 3LVQE 2CSZA 5H1TA 1WEWA 3FJUB 4V3KC 5LKXA 3DPLR 4BHWA 2KFTA 3SOXA 2EODA 4YADA 5AITA 4GNDA 5B75A 5TDRA 3DDTA 2F42A 2LGKA 1WESA 2FSAA 2PUYA 4WZ0A 2QIZA 1ZBDB 1U6GB 1G25A 4Z0OA 5TBNA 2F6JA 2JMDA 2LGVA 3LJUX 2XOCA 4AYCB 2L0BA 5B77A 2HYED 4P5OB 4TKPB 2CRRA 5EYAF 1BORA 2ECVA 5FERA 2LQ6A 4LJNA 3N9PA 2VJEA 2JMIA 2CSVA 1WEPA 2Y1NA 4LLBA 1E4UA 2VNFA 2CSYA 2CKLA 3E2DA 4N4FA 2CONA 5FB0A 2LDRA 2YURA 2FD4A 4QQ4A 3L1XA 2VPBA 2KWJA 3GV4A 1T1HA 4LKAA 2QICA 3SOWA 3T7LA 2KWNA 1VD4A 3RPGC 2ECWA 5K3QA 4A0CD 4YBTA 3Q1DA 3N9NA 3VK6A 2LV9A 2BAYA 2G43A 2FFWA 2YVRA 3L1ZB 3O35A 3M63A 4FK5A 3U5NA 2PNXA 5H1VA 4GNFA 2MNZA 3KV6A 5G05B 1MBMA 2EGPA 1Z60A 4UP0A 2K1JA 4FJCA 4IC3A 4UP5A 4GB0A 3KV5A 3MHSA 2JRJA 2MT5A 5B8DA 2YU4A 3ZTGA 5TDWA 2E6RA 3O47A 2XOYA 1MM2A 3M7KA 2G45A 2L5UA 4WZ3B 3H7HA 3SOUA 2H0DB 4B7YC 4O62A 2ECJA 4I7DA 1HYIA 2ECTA 2ECNA 3I2DA 1WENA 5C13A 5LKZA 3PUQA 4V3LC 1MM3A 4F1PA 5TABA 4I7BA 4PTBA 3FANA 3SHBA 3HCUA 4GNGA 4S3OB 2KGGA 1JM7A 5JG6A 4IC2A 1WEEA 5B79A 3HTKC 3LQHA 1F62A 4W4UA 2LRIC 3MHHA 1Z6UA 2CRWA 2RI7A 1X4IA 2C2VS 3LRQA 2MD8C 2L7PA 4A4BA 2MKEA 2F6NA 3N9QA 1FBVA 4WA6A 1WFKA 2IQJA 1LDJB 2FUUA 3ZVYA 2HDPA 3ZPVE 1VFYA 2MD7B 2RR4A 4UI9B 1WEQA 4H9DA 3DQVR 2D8UA 1DVPA 2Y1MA 1V87A 4S3OC 5B78A 5H9MA 5LKTA 2MA5A 3M62A 2ECIA 1FP0A 5FEYA 4AUQB 2L75A 3N9OA 1IYMA 4Z0RA 1X4JA 4ZDTA 2L80A 3NG2A 2VJEB 3U5MA 2LGLA 2YHNA 3LDYA 4Q6FA 3KDEC 4R7EA 5SVIA 2CKLB 5LCWB 2LN0A 2B0OE 2DJAA 2VPEA 1DCQA 2VJFA 3O37A 2KYUA 2XP0A 4R2YA 2FUIA 2VPDA 5KH9A 3RTRB 2KWKA 2YW8A 5SVYA 5D1LB 2VP7A 4GNEA 3SUBA 5TRBA 1CHCA 3ZPV1 2YQLA 3HCTA 5LKUA 2LAUA 2MUMA 4PPEA 2KE1A 2EA6A 3EB5A 5C11A 1HYJA 3PLWA 3FL2A 3FEHA 2KGIA 4FO9A 4L58A 1WILA 2DSMA 3MDBC 4B86C 3ZVZB 2XOZA 4MSXA 4WZ2A 4R8PK 2E61A 4I7CA 2KKYA 4MVTA 4A4CA 3ASLA 5DINA 5D1MB 5KH3A 2E6SA 4QF2A 4NN2A 3N9LA 4FIPA 2KREA 1JOCA 3C5KA 1WGMA 3M99A 3FAOA 2ZETC 5AIUA 3LQJA 3O70A 4ZUXU 3LQIA 3LVRE 4AYCA 4BBQA 3KNVA 2NAAA 3U5PA 4YBMA 1WIMA 1JM7B 4O64A 2DX8A 3EB6A 2OWAA 2YQMA 2YSJA 2YHOA 4F52B 3V43A 2EGMA 2YUCA 4YATA 2KU3A 2YSMA 4N3WA 4L7XA 5DKAA 3JUEA 4X3GA 4CCGX 1WEUA 2VPGA 3RPGB 4A49A 4AVXA 3FM8C 2MNYA 5FB1A 3GL6A 1WEMA 2XB1A 2MIQA 3L11A 3PHDA 4OGEA 4YABA 2K17A 2QJ0A 3PURA 2YT5A 2AN6A 5J3XA 5G0FA 2XEUA 2I50A 2KR4A 1LDKC 3IHPA 2UZGA 2M6MA 3QZVA 1N87A 2KKXA 3O7AA 4ZQLA 1WE9A 2C2LA 3KQIA 2LGGA 1WEVA 4YC9A 2JMJA 3C6WA 2YYRA 4OGCA 2OXQC 5SVXA 4AP4A 4YAXA 2G6QA 3O34A 2M3HA 5SVIB 2K4DA 2LXPC 3ZNIA 5H1UA 1XWHA
chains in the Genus database with same CATH topology
1VYXA 2VJFB 4LK9A 2IDAA 3N9MA 2LXHC 2D8SA 4YBSA 2KWOA 1Z2QA 5G04B 2H0DA 2L43A 3ZYQA 3O33A 3T6RA 2KIZA 2MA6A 4LADB 1RMDA 5B76A 2K16A 3O36A 2M1RA 5I3LA 2M85A 5D1KB 1K2FA 4XI1A 1X4UA 3U5OA 2RSDA 2ECGA 4CA1A 4QF3A 2Y43A 5KH7A 2CT2A 4C9ZA 1WEOA 2YREA 3HCSA 2CSZA 5H1TA 1WEWA 4V3KC 5LKXA 3DPLR 4BHWA 2KFTA 3SOXA 2EODA 4YADA 5AITA 4GNDA 5B75A 5TDRA 2F42A 2LGKA 1WESA 2FSAA 2PUYA 4WZ0A 2QIZA 1ZBDB 1U6GB 1G25A 5TBNA 2F6JA 2JMDA 2LGVA 4AYCB 2L0BA 5B77A 2HYED 4P5OB 4TKPB 5EYAF 1BORA 2ECVA 5FERA 2LQ6A 4LJNA 3N9PA 2VJEA 2JMIA 1WEPA 2Y1NA 4LLBA 1E4UA 2VNFA 2CSYA 2CKLA 4N4FA 5FB0A 2LDRA 2YURA 3L1XA 2VPBA 2KWJA 3GV4A 1T1HA 4LKAA 2QICA 3SOWA 3T7LA 2KWNA 1VD4A 3RPGC 2ECWA 4A0CD 4YBTA 3N9NA 3VK6A 2LV9A 2BAYA 2G43A 3L1ZB 3O35A 3M63A 4FK5A 3U5NA 2PNXA 5H1VA 4GNFA 2MNZA 3KV6A 5G05B 2EGPA 1Z60A 4UP0A 2K1JA 4FJCA 4IC3A 4UP5A 4GB0A 3KV5A 3MHSA 2JRJA 2MT5A 5B8DA 2YU4A 3ZTGA 5TDWA 2E6RA 1MM2A 2G45A 2L5UA 4WZ3B 3SOUA 2H0DB 4B7YC 2ECJA 4I7DA 1HYIA 2ECTA 2ECNA 3I2DA 1WENA 5C13A 5LKZA 3PUQA 4V3LC 1MM3A 5TABA 4I7BA 4PTBA 3SHBA 3HCUA 4GNGA 4S3OB 2KGGA 1JM7A 5JG6A 4IC2A 1WEEA 5B79A 3HTKC 3LQHA 1F62A 4W4UA 2LRIC 3MHHA 1Z6UA 2RI7A 1X4IA 2C2VS 3LRQA 2MD8C 4A4BA 2F6NA 3N9QA 1FBVA 4WA6A 1WFKA 1LDJB 2FUUA 3ZVYA 2HDPA 3ZPVE 1VFYA 2MD7B 4UI9B 1WEQA 3DQVR 1DVPA 2Y1MA 1V87A 4S3OC 5B78A 5H9MA 5LKTA 2MA5A 3M62A 2ECIA 1FP0A 5FEYA 4AUQB 2L75A 3N9OA 1IYMA 1X4JA 4ZDTA 2L80A 3NG2A 2VJEB 3U5MA 2LGLA 2YHNA 4Q6FA 4R7EA 2CKLB 5LCWB 2LN0A 2VPEA 2VJFA 3O37A 2KYUA 4R2YA 2FUIA 2VPDA 5KH9A 3RTRB 2KWKA 2YW8A 5D1LB 2VP7A 4GNEA 5TRBA 1CHCA 3ZPV1 2YQLA 3HCTA 5LKUA 2MUMA 4PPEA 2KE1A 2EA6A 3EB5A 5C11A 1HYJA 3FL2A 2KGIA 4FO9A 4L58A 1WILA 4B86C 3ZVZB 4MSXA 4WZ2A 4R8PK 4I7CA 4MVTA 4A4CA 3ASLA 5DINA 5D1MB 5KH3A 2E6SA 4QF2A 4NN2A 3N9LA 4FIPA 2KREA 1JOCA 3C5KA 1WGMA 3M99A 2ZETC 5AIUA 3LQJA 3O70A 4ZUXU 3LQIA 4AYCA 4BBQA 3KNVA 2NAAA 3U5PA 4YBMA 1WIMA 1JM7B 4O64A 2DX8A 3EB6A 2YQMA 2YSJA 2YHOA 4F52B 3V43A 2YUCA 4YATA 2KU3A 2YSMA 4N3WA 4L7XA 5DKAA 4CCGX 4X3GA 1WEUA 2VPGA 3RPGB 4A49A 4AVXA 2MNYA 5FB1A 3GL6A 1WEMA 2XB1A 2MIQA 3L11A 3PHDA 4YABA 2K17A 2QJ0A 3PURA 2YT5A 2AN6A 5J3XA 5G0FA 2XEUA 2I50A 2KR4A 1LDKC 3IHPA 2UZGA 2M6MA 3QZVA 1N87A 3O7AA 4ZQLA 1WE9A 2C2LA 3KQIA 2LGGA 1WEVA 4YC9A 2JMJA 3C6WA 2YYRA 2OXQC 4AP4A 4YAXA 2G6QA 3O34A 2M3HA 2K4DA 2LXPC 3ZNIA 5H1UA 1XWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYX A;  2VJF B;  4LK9 A;  2IDA A;  3N9M A;  2LXH C;  2D8S A;  4YBS A;  2KWO A;  1Z2Q A;  5G04 B;  2H0D A;  2L43 A;  3ZYQ A;  3O33 A;  3T6R A;  2KIZ A;  2MA6 A;  4LAD B;  1RMD A;  5B76 A;  2K16 A;  3O36 A;  2M1R A;  5I3L A;  2M85 A;  5D1K B;  1K2F A;  4XI1 A;  1X4U A;  3U5O A;  2RSD A;  2ECG A;  4CA1 A;  4QF3 A;  2Y43 A;  5KH7 A;  2CT2 A;  4C9Z A;  1WEO A;  2YRE A;  3HCS A;  2CSZ A;  5H1T A;  1WEW A;  4V3K C;  5LKX A;  3DPL R;  4BHW A;  2KFT A;  3SOX A;  2EOD A;  4YAD A;  5AIT A;  4GND A;  5B75 A;  5TDR A;  2F42 A;  2LGK A;  1WES A;  2FSA A;  2PUY A;  4WZ0 A;  2QIZ A;  1ZBD B;  1U6G B;  1G25 A;  5TBN A;  2F6J A;  2JMD A;  2LGV A;  4AYC B;  2L0B A;  5B77 A;  2HYE D;  4P5O B;  4TKP B;  5EYA F;  1BOR A;  2ECV A;  5FER A;  2LQ6 A;  4LJN A;  3N9P A;  2VJE A;  2JMI A;  1WEP A;  2Y1N A;  4LLB A;  1E4U A;  2VNF A;  2CSY A;  2CKL A;  4N4F A;  5FB0 A;  2LDR A;  2YUR A;  3L1X A;  2VPB A;  2KWJ A;  3GV4 A;  1T1H A;  4LKA A;  2QIC A;  3SOW A;  3T7L A;  2KWN A;  1VD4 A;  3RPG C;  2ECW A;  4A0C D;  4YBT A;  3N9N A;  3VK6 A;  2LV9 A;  2BAY A;  2G43 A;  3L1Z B;  3O35 A;  3M63 A;  4FK5 A;  3U5N A;  2PNX A;  5H1V A;  4GNF A;  2MNZ A;  3KV6 A;  5G05 B;  2EGP A;  1Z60 A;  4UP0 A;  2K1J A;  4FJC A;  4IC3 A;  4UP5 A;  4GB0 A;  3KV5 A;  3MHS A;  2JRJ A;  2MT5 A;  5B8D A;  2YU4 A;  3ZTG A;  5TDW A;  2E6R A;  1MM2 A;  2G45 A;  2L5U A;  4WZ3 B;  3SOU A;  2H0D B;  4B7Y C;  2ECJ A;  4I7D A;  1HYI A;  2ECT A;  2ECN A;  3I2D A;  1WEN A;  5C13 A;  5LKZ A;  3PUQ A;  4V3L C;  1MM3 A;  5TAB A;  4I7B A;  4PTB A;  3SHB A;  3HCU A;  4GNG A;  4S3O B;  2KGG A;  1JM7 A;  5JG6 A;  4IC2 A;  1WEE A;  5B79 A;  3HTK C;  3LQH A;  1F62 A;  4W4U A;  2LRI C;  3MHH A;  1Z6U A;  2RI7 A;  1X4I A;  2C2V S;  3LRQ A;  2MD8 C;  4A4B A;  2F6N A;  3N9Q A;  1FBV A;  4WA6 A;  1WFK A;  1LDJ B;  2FUU A;  3ZVY A;  2HDP A;  3ZPV E;  1VFY A;  2MD7 B;  4UI9 B;  1WEQ A;  3DQV R;  1DVP A;  2Y1M A;  1V87 A;  4S3O C;  5B78 A;  5H9M A;  5LKT A;  2MA5 A;  3M62 A;  2ECI A;  1FP0 A;  5FEY A;  4AUQ B;  2L75 A;  3N9O A;  1IYM A;  1X4J A;  4ZDT A;  2L80 A;  3NG2 A;  2VJE B;  3U5M A;  2LGL A;  2YHN A;  4Q6F A;  4R7E A;  2CKL B;  5LCW B;  2LN0 A;  2VPE A;  2VJF A;  3O37 A;  2KYU A;  4R2Y A;  2FUI A;  2VPD A;  5KH9 A;  3RTR B;  2KWK A;  2YW8 A;  5D1L B;  2VP7 A;  4GNE A;  5TRB A;  1CHC A;  3ZPV 1;  2YQL A;  3HCT A;  5LKU A;  2MUM A;  4PPE A;  2KE1 A;  2EA6 A;  3EB5 A;  5C11 A;  1HYJ A;  3FL2 A;  2KGI A;  4FO9 A;  4L58 A;  1WIL A;  4B86 C;  3ZVZ B;  4MSX A;  4WZ2 A;  4R8P K;  4I7C A;  4MVT A;  4A4C A;  3ASL A;  5DIN A;  5D1M B;  5KH3 A;  2E6S A;  4QF2 A;  4NN2 A;  3N9L A;  4FIP A;  2KRE A;  1JOC A;  3C5K A;  1WGM A;  3M99 A;  2ZET C;  5AIU A;  3LQJ A;  3O70 A;  4ZUX U;  3LQI A;  4AYC A;  4BBQ A;  3KNV A;  2NAA A;  3U5P A;  4YBM A;  1WIM A;  1JM7 B;  4O64 A;  2DX8 A;  3EB6 A;  2YQM A;  2YSJ A;  2YHO A;  4F52 B;  3V43 A;  2YUC A;  4YAT A;  2KU3 A;  2YSM A;  4N3W A;  4L7X A;  5DKA A;  4CCG X;  4X3G A;  1WEU A;  2VPG A;  3RPG B;  4A49 A;  4AVX A;  2MNY A;  5FB1 A;  3GL6 A;  1WEM A;  2XB1 A;  2MIQ A;  3L11 A;  3PHD A;  4YAB A;  2K17 A;  2QJ0 A;  3PUR A;  2YT5 A;  2AN6 A;  5J3X A;  5G0F A;  2XEU A;  2I50 A;  2KR4 A;  1LDK C;  3IHP A;  2UZG A;  2M6M A;  3QZV A;  1N87 A;  3O7A A;  4ZQL A;  1WE9 A;  2C2L A;  3KQI A;  2LGG A;  1WEV A;  4YC9 A;  2JMJ A;  3C6W A;  2YYR A;  2OXQ C;  4AP4 A;  4YAX A;  2G6Q A;  3O34 A;  2M3H A;  2K4D A;  2LXP C;  3ZNI A;  5H1U A;  1XWH A; 
#chains in the Genus database with same CATH topology
 1VYX A;  2VJF B;  4LK9 A;  2IDA A;  3N9M A;  2P57 A;  2LXH C;  2D8S A;  4YBS A;  2KWO A;  1Z2Q A;  2JUN A;  5G04 B;  2H0D A;  2L43 A;  3ZYQ A;  3O33 A;  3T6R A;  2KIZ A;  2MA6 A;  4LAD B;  1RMD A;  5B76 A;  3T9K A;  2JM3 A;  2K16 A;  3O36 A;  2M1R A;  5I3L A;  2M85 A;  5D1K B;  1K2F A;  4XI1 A;  2EXU A;  1X4U A;  3DWD A;  3U5O A;  2RSD A;  2M13 A;  2ECG A;  4CA1 A;  4QF3 A;  2Y43 A;  5KH7 A;  2CT2 A;  4C9Z A;  1WEO A;  2YRE A;  3HCS A;  3LVQ E;  2CSZ A;  5H1T A;  1WEW A;  3FJU B;  4V3K C;  5LKX A;  3DPL R;  4BHW A;  2KFT A;  3SOX A;  2EOD A;  4YAD A;  5AIT A;  4GND A;  5B75 A;  5TDR A;  3DDT A;  2F42 A;  2LGK A;  1WES A;  2FSA A;  2PUY A;  4WZ0 A;  2QIZ A;  1ZBD B;  1U6G B;  1G25 A;  4Z0O A;  5TBN A;  2F6J A;  2JMD A;  2LGV A;  3LJU X;  2XOC A;  4AYC B;  2L0B A;  5B77 A;  2HYE D;  4P5O B;  4TKP B;  2CRR A;  5EYA F;  1BOR A;  2ECV A;  5FER A;  2LQ6 A;  4LJN A;  3N9P A;  2VJE A;  2JMI A;  2CSV A;  1WEP A;  2Y1N A;  4LLB A;  1E4U A;  2VNF A;  2CSY A;  2CKL A;  3E2D A;  4N4F A;  2CON A;  5FB0 A;  2LDR A;  2YUR A;  2FD4 A;  4QQ4 A;  3L1X A;  2VPB A;  2KWJ A;  3GV4 A;  1T1H A;  4LKA A;  2QIC A;  3SOW A;  3T7L A;  2KWN A;  1VD4 A;  3RPG C;  2ECW A;  5K3Q A;  4A0C D;  4YBT A;  3Q1D A;  3N9N A;  3VK6 A;  2LV9 A;  2BAY A;  2G43 A;  2FFW A;  2YVR A;  3L1Z B;  3O35 A;  3M63 A;  4FK5 A;  3U5N A;  2PNX A;  5H1V A;  4GNF A;  2MNZ A;  3KV6 A;  5G05 B;  1MBM A;  2EGP A;  1Z60 A;  4UP0 A;  2K1J A;  4FJC A;  4IC3 A;  4UP5 A;  4GB0 A;  3KV5 A;  3MHS A;  2JRJ A;  2MT5 A;  5B8D A;  2YU4 A;  3ZTG A;  5TDW A;  2E6R A;  3O47 A;  2XOY A;  1MM2 A;  3M7K A;  2G45 A;  2L5U A;  4WZ3 B;  3H7H A;  3SOU A;  2H0D B;  4B7Y C;  4O62 A;  2ECJ A;  4I7D A;  1HYI A;  2ECT A;  2ECN A;  3I2D A;  1WEN A;  5C13 A;  5LKZ A;  3PUQ A;  4V3L C;  1MM3 A;  4F1P A;  5TAB A;  4I7B A;  4PTB A;  3FAN A;  3SHB A;  3HCU A;  4GNG A;  4S3O B;  2KGG A;  1JM7 A;  5JG6 A;  4IC2 A;  1WEE A;  5B79 A;  3HTK C;  3LQH A;  1F62 A;  4W4U A;  2LRI C;  3MHH A;  1Z6U A;  2CRW A;  2RI7 A;  1X4I A;  2C2V S;  3LRQ A;  2MD8 C;  2L7P A;  4A4B A;  2MKE A;  2F6N A;  3N9Q A;  1FBV A;  4WA6 A;  1WFK A;  2IQJ A;  1LDJ B;  2FUU A;  3ZVY A;  2HDP A;  3ZPV E;  1VFY A;  2MD7 B;  2RR4 A;  4UI9 B;  1WEQ A;  4H9D A;  3DQV R;  2D8U A;  1DVP A;  2Y1M A;  1V87 A;  4S3O C;  5B78 A;  5H9M A;  5LKT A;  2MA5 A;  3M62 A;  2ECI A;  1FP0 A;  5FEY A;  4AUQ B;  2L75 A;  3N9O A;  1IYM A;  4Z0R A;  1X4J A;  4ZDT A;  2L80 A;  3NG2 A;  2VJE B;  3U5M A;  2LGL A;  2YHN A;  3LDY A;  4Q6F A;  3KDE C;  4R7E A;  5SVI A;  2CKL B;  5LCW B;  2LN0 A;  2B0O E;  2DJA A;  2VPE A;  1DCQ A;  2VJF A;  3O37 A;  2KYU A;  2XP0 A;  4R2Y A;  2FUI A;  2VPD A;  5KH9 A;  3RTR B;  2KWK A;  2YW8 A;  5SVY A;  5D1L B;  2VP7 A;  4GNE A;  3SUB A;  5TRB A;  1CHC A;  3ZPV 1;  2YQL A;  3HCT A;  5LKU A;  2LAU A;  2MUM A;  4PPE A;  2KE1 A;  2EA6 A;  3EB5 A;  5C11 A;  1HYJ A;  3PLW A;  3FL2 A;  3FEH A;  2KGI A;  4FO9 A;  4L58 A;  1WIL A;  2DSM A;  3MDB C;  4B86 C;  3ZVZ B;  2XOZ A;  4MSX A;  4WZ2 A;  4R8P K;  2E61 A;  4I7C A;  2KKY A;  4MVT A;  4A4C A;  3ASL A;  5DIN A;  5D1M B;  5KH3 A;  2E6S A;  4QF2 A;  4NN2 A;  3N9L A;  4FIP A;  2KRE A;  1JOC A;  3C5K A;  1WGM A;  3M99 A;  3FAO A;  2ZET C;  5AIU A;  3LQJ A;  3O70 A;  4ZUX U;  3LQI A;  3LVR E;  4AYC A;  4BBQ A;  3KNV A;  2NAA A;  3U5P A;  4YBM A;  1WIM A;  1JM7 B;  4O64 A;  2DX8 A;  3EB6 A;  2OWA A;  2YQM A;  2YSJ A;  2YHO A;  4F52 B;  3V43 A;  2EGM A;  2YUC A;  4YAT A;  2KU3 A;  2YSM A;  4N3W A;  4L7X A;  5DKA A;  3JUE A;  4X3G A;  4CCG X;  1WEU A;  2VPG A;  3RPG B;  4A49 A;  4AVX A;  3FM8 C;  2MNY A;  5FB1 A;  3GL6 A;  1WEM A;  2XB1 A;  2MIQ A;  3L11 A;  3PHD A;  4OGE A;  4YAB A;  2K17 A;  2QJ0 A;  3PUR A;  2YT5 A;  2AN6 A;  5J3X A;  5G0F A;  2XEU A;  2I50 A;  2KR4 A;  1LDK C;  3IHP A;  2UZG A;  2M6M A;  3QZV A;  1N87 A;  2KKX A;  3O7A A;  4ZQL A;  1WE9 A;  2C2L A;  3KQI A;  2LGG A;  1WEV A;  4YC9 A;  2JMJ A;  3C6W A;  2YYR A;  4OGC A;  2OXQ C;  5SVX A;  4AP4 A;  4YAX A;  2G6Q A;  3O34 A;  2M3H A;  5SVI B;  2K4D A;  2LXP C;  3ZNI A;  5H1U A;  1XWH A; 
#chains in the Genus database with same CATH homology
 1VYX A;  2VJF B;  4LK9 A;  2IDA A;  3N9M A;  2LXH C;  2D8S A;  4YBS A;  2KWO A;  1Z2Q A;  5G04 B;  2H0D A;  2L43 A;  3ZYQ A;  3O33 A;  3T6R A;  2KIZ A;  2MA6 A;  4LAD B;  1RMD A;  5B76 A;  2K16 A;  3O36 A;  2M1R A;  5I3L A;  2M85 A;  5D1K B;  1K2F A;  4XI1 A;  1X4U A;  3U5O A;  2RSD A;  2ECG A;  4CA1 A;  4QF3 A;  2Y43 A;  5KH7 A;  2CT2 A;  4C9Z A;  1WEO A;  2YRE A;  3HCS A;  2CSZ A;  5H1T A;  1WEW A;  4V3K C;  5LKX A;  3DPL R;  4BHW A;  2KFT A;  3SOX A;  2EOD A;  4YAD A;  5AIT A;  4GND A;  5B75 A;  5TDR A;  2F42 A;  2LGK A;  1WES A;  2FSA A;  2PUY A;  4WZ0 A;  2QIZ A;  1ZBD B;  1U6G B;  1G25 A;  5TBN A;  2F6J A;  2JMD A;  2LGV A;  4AYC B;  2L0B A;  5B77 A;  2HYE D;  4P5O B;  4TKP B;  5EYA F;  1BOR A;  2ECV A;  5FER A;  2LQ6 A;  4LJN A;  3N9P A;  2VJE A;  2JMI A;  1WEP A;  2Y1N A;  4LLB A;  1E4U A;  2VNF A;  2CSY A;  2CKL A;  4N4F A;  5FB0 A;  2LDR A;  2YUR A;  3L1X A;  2VPB A;  2KWJ A;  3GV4 A;  1T1H A;  4LKA A;  2QIC A;  3SOW A;  3T7L A;  2KWN A;  1VD4 A;  3RPG C;  2ECW A;  4A0C D;  4YBT A;  3N9N A;  3VK6 A;  2LV9 A;  2BAY A;  2G43 A;  3L1Z B;  3O35 A;  3M63 A;  4FK5 A;  3U5N A;  2PNX A;  5H1V A;  4GNF A;  2MNZ A;  3KV6 A;  5G05 B;  2EGP A;  1Z60 A;  4UP0 A;  2K1J A;  4FJC A;  4IC3 A;  4UP5 A;  4GB0 A;  3KV5 A;  3MHS A;  2JRJ A;  2MT5 A;  5B8D A;  2YU4 A;  3ZTG A;  5TDW A;  2E6R A;  1MM2 A;  2G45 A;  2L5U A;  4WZ3 B;  3SOU A;  2H0D B;  4B7Y C;  2ECJ A;  4I7D A;  1HYI A;  2ECT A;  2ECN A;  3I2D A;  1WEN A;  5C13 A;  5LKZ A;  3PUQ A;  4V3L C;  1MM3 A;  5TAB A;  4I7B A;  4PTB A;  3SHB A;  3HCU A;  4GNG A;  4S3O B;  2KGG A;  1JM7 A;  5JG6 A;  4IC2 A;  1WEE A;  5B79 A;  3HTK C;  3LQH A;  1F62 A;  4W4U A;  2LRI C;  3MHH A;  1Z6U A;  2RI7 A;  1X4I A;  2C2V S;  3LRQ A;  2MD8 C;  4A4B A;  2F6N A;  3N9Q A;  1FBV A;  4WA6 A;  1WFK A;  1LDJ B;  2FUU A;  3ZVY A;  2HDP A;  3ZPV E;  1VFY A;  2MD7 B;  4UI9 B;  1WEQ A;  3DQV R;  1DVP A;  2Y1M A;  1V87 A;  4S3O C;  5B78 A;  5H9M A;  5LKT A;  2MA5 A;  3M62 A;  2ECI A;  1FP0 A;  5FEY A;  4AUQ B;  2L75 A;  3N9O A;  1IYM A;  1X4J A;  4ZDT A;  2L80 A;  3NG2 A;  2VJE B;  3U5M A;  2LGL A;  2YHN A;  4Q6F A;  4R7E A;  2CKL B;  5LCW B;  2LN0 A;  2VPE A;  2VJF A;  3O37 A;  2KYU A;  4R2Y A;  2FUI A;  2VPD A;  5KH9 A;  3RTR B;  2KWK A;  2YW8 A;  5D1L B;  2VP7 A;  4GNE A;  5TRB A;  1CHC A;  3ZPV 1;  2YQL A;  3HCT A;  5LKU A;  2MUM A;  4PPE A;  2KE1 A;  2EA6 A;  3EB5 A;  5C11 A;  1HYJ A;  3FL2 A;  2KGI A;  4FO9 A;  4L58 A;  1WIL A;  4B86 C;  3ZVZ B;  4MSX A;  4WZ2 A;  4R8P K;  4I7C A;  4MVT A;  4A4C A;  3ASL A;  5DIN A;  5D1M B;  5KH3 A;  2E6S A;  4QF2 A;  4NN2 A;  3N9L A;  4FIP A;  2KRE A;  1JOC A;  3C5K A;  1WGM A;  3M99 A;  2ZET C;  5AIU A;  3LQJ A;  3O70 A;  4ZUX U;  3LQI A;  4AYC A;  4BBQ A;  3KNV A;  2NAA A;  3U5P A;  4YBM A;  1WIM A;  1JM7 B;  4O64 A;  2DX8 A;  3EB6 A;  2YQM A;  2YSJ A;  2YHO A;  4F52 B;  3V43 A;  2YUC A;  4YAT A;  2KU3 A;  2YSM A;  4N3W A;  4L7X A;  5DKA A;  4CCG X;  4X3G A;  1WEU A;  2VPG A;  3RPG B;  4A49 A;  4AVX A;  2MNY A;  5FB1 A;  3GL6 A;  1WEM A;  2XB1 A;  2MIQ A;  3L11 A;  3PHD A;  4YAB A;  2K17 A;  2QJ0 A;  3PUR A;  2YT5 A;  2AN6 A;  5J3X A;  5G0F A;  2XEU A;  2I50 A;  2KR4 A;  1LDK C;  3IHP A;  2UZG A;  2M6M A;  3QZV A;  1N87 A;  3O7A A;  4ZQL A;  1WE9 A;  2C2L A;  3KQI A;  2LGG A;  1WEV A;  4YC9 A;  2JMJ A;  3C6W A;  2YYR A;  2OXQ C;  4AP4 A;  4YAX A;  2G6Q A;  3O34 A;  2M3H A;  2K4D A;  2LXP C;  3ZNI A;  5H1U A;  1XWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...