5C11A

Crystal structure of jarid1a phd finger bound to histone h3c4me3 peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICINCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lysine-specific demethylase 5A
publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
source organism Homo sapiens
total genus 9
structure length 52
sequence length 52
ec nomenclature ec 1.14.11.-:
pdb deposition date 2015-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c11A00
2JMIA 5LCWB 2M1RA 2YURA 3U5MA 3O33A 1JM7B 4BHWA 2JMDA 2L43A 3RTRB 5FEYA 2MUMA 2PNXA 4WZ2A 4LJNA 2KREA 5B77A 2XEUA 4MVTA 2G6QA 2ECNA 4GNDA 4B7YC 2CKLA 3M62A 5I3LA 3N9LA 3FL2A 1WIMA 1G25A 4YAXA 2BAYA 3N9MA 4ZQLA 1HYIA 2L5UA 3ZYQA 5TRBA 3MHSA 4AVXA 4X3GA 2HDPA 5C11A 3PUQA 1X4UA 2KIZA 5G0FA 2C2LA 5D1MB 4V3LC 2YQLA 1WILA 4L58A 2VJEA 5C13A 3DQVR 4I7BA 3O7AA 4QF2A 1Z60A 4XI1A 1N87A 4CCGX 4GB0A 3ZPV1 1HYJA 3N9PA 2Y43A 3MHHA 5H9MA 4W4UA 3V43A 2F6NA 4TKPB 3O37A 5B76A 2LQ6A 4PPEA 4UI9B 2MNZA 2UZGA 2ZETC 2EA6A 2LN0A 3RPGC 2QJ0A 3N9OA 2CKLB 3U5PA 1WEWA 2YHNA 5J3XA 5H1VA 3HCUA 2M6MA 4AP4A 1K2FA 4YC9A 2M3HA 3I2DA 3LQHA 2KU3A 4C9ZA 2KWNA 2KWOA 5AITA 4R2YA 2VPBA 4S3OC 4GNEA 4YBSA 2MIQA 4LK9A 2JMJA 4WZ3B 4I7CA 4NN2A 5FERA 5KH9A 3LQJA 2M85A 2LDRA 4FJCA 3SOUA 2YSJA 2CSYA 4A4BA 5LKTA 3GL6A 3GV4A 4AUQB 4ZDTA 2L0BA 2MD8C 4CA1A 2ECJA 3O35A 1FBVA 2FSAA 4GNGA 5AIUA 2YUCA 5G04B 4AYCA 3SOXA 2H0DA 2K17A 2ECVA 2LGVA 3KNVA 2YYRA 4LKAA 3T6RA 1LDJB 2VJFB 4R8PK 2AN6A 1IYMA 2YQMA 2FUUA 4N3WA 3U5NA 5KH7A 1WESA 3VK6A 1WGMA 2VPGA 5H1TA 3HCSA 4WZ0A 3ZPVE 1WENA 3LQIA 2YREA 3SOWA 2FUIA 2LGKA 2KYUA 2ECWA 4F52B 5D1KB 4YATA 2KGGA 2OXQC 2VPEA 5TDWA 2MT5A 2ECIA 4LADB 4R7EA 4L7XA 5B8DA 5D1LB 2HYED 1CHCA 2YW8A 2DX8A 5TBNA 4S3OB 3HCTA 3N9NA 2KGIA 5DKAA 4FIPA 3O36A 2H0DB 2I50A 3KV5A 3N9QA 2RI7A 2EODA 2K4DA 3T7LA 5B75A 4QF3A 3ZVZB 3C6WA 1LDKC 2LGGA 2VJEB 2MD7B 1V87A 1WEPA 1VD4A 4B86C 2CT2A 2K16A 4A49A 1WFKA 2D8SA 2JRJA 2KFTA 2E6SA 2YHOA 5TDRA 2LGLA 1MM3A 1WEEA 4BBQA 1FP0A 4FK5A 2VNFA 1Z2QA 3O34A 4O64A 5G05B 3QZVA 2QIZA 1WEUA 1ZBDB 2Y1NA 3C5KA 2ECTA 2F42A 4ZUXU 2K1JA 2EGPA 3M63A 4WA6A 2LXHC 4GNFA 2CSZA 1WEMA 2KWKA 3HTKC 3KQIA 4IC2A 4Q6FA 2KE1A 4N4FA 5FB0A 1MM2A 4MSXA 2G45A 2YSMA 3L1XA 2Y1MA 1WEQA 1X4IA 2VP7A 3RPGB 5FB1A 3DPLR 1WEVA 3M99A 1WE9A 2F6JA 5KH3A 2LV9A 2RSDA 2IDAA 4LLBA 1E4UA 4YBMA 2KR4A 2NAAA 5EYAF 1WEOA 4I7DA 3U5OA 5LKUA 3SHBA 5LKXA 4IC3A 2YT5A 3EB5A 4FO9A 4UP5A 1T1HA 3IHPA 5H1UA 2YU4A 3LRQA 3KV6A 2MA5A 4P5OB 5JG6A 1XWHA 2ECGA 1U6GB 1RMDA 5TABA 3ZVYA 1JM7A 1VYXA 4V3KC 4AYCB 4YBTA 1DVPA 3O70A 3PHDA 2KWJA 1F62A 2L80A 2QICA 2LXPC 2PUYA 4UP0A 5B78A 4YADA 3L1ZB 4PTBA 1BORA 3NG2A 4A0CD 2MNYA 3ZTGA 2MA6A 3ZNIA 1X4JA 3EB6A 2E6RA 2L75A 2LRIC 2VPDA 1Z6UA 2G43A 2VJFA 5DINA 2XB1A 1VFYA 2C2VS 4YABA 3L11A 1JOCA 5B79A 3PURA 3ASLA 5LKZA 4A4CA
chains in the Genus database with same CATH superfamily
2JMIA 5LCWB 2M1RA 2YURA 2JM3A 3U5MA 3O33A 1JM7B 4BHWA 2JMDA 2L43A 5K3QA 3RTRB 5FEYA 2MUMA 2PNXA 4WZ2A 2XOZA 4LJNA 2KREA 5B77A 2XEUA 1MBMA 4MVTA 2G6QA 2ECNA 2MKEA 4GNDA 4B7YC 2CKLA 3M62A 5I3LA 3N9LA 4Z0OA 3FL2A 1WIMA 3PLWA 1G25A 2FD4A 4YAXA 2BAYA 3N9MA 4ZQLA 1HYIA 2L5UA 4O62A 3ZYQA 2XOCA 5TRBA 3MHSA 4AVXA 4X3GA 2HDPA 5C11A 3PUQA 1X4UA 2KIZA 5SVXA 5SVYA 4OGCA 2D8UA 2C2LA 5D1MB 5G0FA 4V3LC 2YQLA 1WILA 4L58A 2VJEA 5C13A 3DQVR 4I7BA 3O7AA 4QF2A 1Z60A 4XI1A 1N87A 4CCGX 4GB0A 4H9DA 3ZPV1 1HYJA 3N9PA 2Y43A 3MHHA 5H9MA 4W4UA 3V43A 2F6NA 4TKPB 4OGEA 3O37A 5B76A 2LQ6A 4PPEA 4UI9B 2MNZA 2UZGA 4F1PA 2ZETC 2EA6A 2LN0A 3RPGC 2QJ0A 3N9OA 2CKLB 3U5PA 1WEWA 2YHNA 5J3XA 5H1VA 3HCUA 2M6MA 4AP4A 1K2FA 4YC9A 2M3HA 3I2DA 2KKXA 3LQHA 2KU3A 4C9ZA 5SVIA 2KWNA 2KWOA 2CRRA 5AITA 4R2YA 3JUEA 1DCQA 2VPBA 4S3OC 4GNEA 4QQ4A 4YBSA 2MIQA 4LK9A 2JMJA 4WZ3B 4Z0RA 4I7CA 4NN2A 5FERA 5KH9A 3LQJA 2M85A 2LDRA 4FJCA 3SOUA 2EGMA 2YSJA 2CSYA 4A4BA 5LKTA 3GL6A 3GV4A 4AUQB 4ZDTA 2L0BA 2MD8C 4CA1A 2ECJA 3O35A 1FBVA 2FSAA 4GNGA 5AIUA 2YUCA 5G04B 4AYCA 3T9KA 3SOXA 2H0DA 3H7HA 2K17A 2ECVA 2LGVA 3KNVA 2YYRA 4LKAA 3T6RA 1LDJB 2VJFB 5SVIB 2AN6A 4R8PK 1IYMA 2L7PA 2YQMA 2FUUA 4N3WA 3LJUX 3U5NA 5KH7A 3SUBA 1WESA 3VK6A 1WGMA 2VPGA 5H1TA 3HCSA 4WZ0A 3ZPVE 1WENA 3LQIA 2YREA 3SOWA 2LAUA 2RR4A 2FUIA 2E61A 2LGKA 2CSVA 2KYUA 2ECWA 4F52B 5D1KB 4YATA 2KGGA 2OXQC 2VPEA 5TDWA 2MT5A 2ECIA 4LADB 4R7EA 4L7XA 5B8DA 5D1LB 2HYED 1CHCA 2YW8A 2DX8A 5TBNA 4S3OB 3HCTA 3N9NA 2KGIA 5DKAA 4FIPA 2DSMA 2M13A 3O36A 2H0DB 2I50A 3FAOA 3KV5A 3M7KA 3N9QA 2RI7A 2EODA 2DJAA 2K4DA 3T7LA 5B75A 3Q1DA 4QF3A 3ZVZB 3C6WA 1LDKC 2LGGA 2VJEB 2MD7B 1V87A 2CONA 1WEPA 1VD4A 4B86C 2CT2A 2JUNA 2K16A 3MDBC 4A49A 1WFKA 2D8SA 2JRJA 2KFTA 2E6SA 2YHOA 5TDRA 2LGLA 1MM3A 1WEEA 4BBQA 1FP0A 4FK5A 2VNFA 1Z2QA 3O34A 4O64A 5G05B 3QZVA 2QIZA 1WEUA 1ZBDB 2KKYA 2Y1NA 3C5KA 2ECTA 2F42A 4ZUXU 3FJUB 2K1JA 2EGPA 3M63A 4WA6A 2LXHC 4GNFA 2CSZA 1WEMA 2KWKA 3HTKC 3KQIA 4IC2A 4Q6FA 2KE1A 4N4FA 5FB0A 1MM2A 4MSXA 3LVQE 2G45A 2YSMA 3L1XA 2Y1MA 1WEQA 3LVRE 2YVRA 1X4IA 2VP7A 3RPGB 5FB1A 3DPLR 1WEVA 3M99A 1WE9A 2F6JA 5KH3A 2LV9A 2RSDA 2IDAA 4LLBA 1E4UA 4YBMA 2KR4A 2NAAA 5EYAF 1WEOA 4I7DA 3U5OA 3E2DA 5LKUA 3SHBA 5LKXA 2XP0A 4IC3A 2YT5A 3EB5A 4FO9A 4UP5A 1T1HA 3IHPA 5H1UA 2YU4A 2IQJA 3LRQA 3KV6A 2MA5A 4P5OB 5JG6A 1XWHA 2B0OE 3O47A 3LDYA 2ECGA 1U6GB 1RMDA 5TABA 3ZVYA 1JM7A 1VYXA 3FANA 4V3KC 4AYCB 4YBTA 2P57A 1DVPA 3O70A 3PHDA 3FEHA 2KWJA 1F62A 2L80A 2QICA 2LXPC 2PUYA 4UP0A 5B78A 4YADA 3FM8C 3L1ZB 4PTBA 1BORA 3NG2A 4A0CD 2MNYA 3ZTGA 2MA6A 2OWAA 2XOYA 1X4JA 2CRWA 3DDTA 3ZNIA 3EB6A 2E6RA 2L75A 2LRIC 2EXUA 2VPDA 1Z6UA 2G43A 2VJFA 5DINA 2XB1A 1VFYA 2C2VS 3DWDA 4YABA 3L11A 3KDEC 2FFWA 1JOCA 5B79A 3PURA 3ASLA 5LKZA 4A4CA
chains in the Genus database with same CATH topology
2JMIA 5LCWB 2M1RA 2YURA 3U5MA 3O33A 1JM7B 4BHWA 2JMDA 2L43A 3RTRB 5FEYA 2MUMA 2PNXA 4WZ2A 4LJNA 2KREA 5B77A 2XEUA 4MVTA 2G6QA 2ECNA 4GNDA 4B7YC 2CKLA 3M62A 5I3LA 3N9LA 3FL2A 1WIMA 1G25A 4YAXA 2BAYA 3N9MA 4ZQLA 1HYIA 2L5UA 3ZYQA 5TRBA 3MHSA 4AVXA 4X3GA 2HDPA 5C11A 3PUQA 1X4UA 2KIZA 5G0FA 2C2LA 5D1MB 4V3LC 2YQLA 1WILA 4L58A 2VJEA 5C13A 3DQVR 4I7BA 3O7AA 4QF2A 1Z60A 4XI1A 1N87A 4CCGX 4GB0A 3ZPV1 1HYJA 3N9PA 2Y43A 3MHHA 5H9MA 4W4UA 3V43A 2F6NA 4TKPB 3O37A 5B76A 2LQ6A 4PPEA 4UI9B 2MNZA 2UZGA 2ZETC 2EA6A 2LN0A 3RPGC 2QJ0A 3N9OA 2CKLB 3U5PA 1WEWA 2YHNA 5J3XA 5H1VA 3HCUA 2M6MA 4AP4A 1K2FA 4YC9A 2M3HA 3I2DA 3LQHA 2KU3A 4C9ZA 2KWNA 2KWOA 5AITA 4R2YA 2VPBA 4S3OC 4GNEA 4YBSA 2MIQA 4LK9A 2JMJA 4WZ3B 4I7CA 4NN2A 5FERA 5KH9A 3LQJA 2M85A 2LDRA 4FJCA 3SOUA 2YSJA 2CSYA 4A4BA 5LKTA 3GL6A 3GV4A 4AUQB 4ZDTA 2L0BA 2MD8C 4CA1A 2ECJA 3O35A 1FBVA 2FSAA 4GNGA 5AIUA 2YUCA 5G04B 4AYCA 3SOXA 2H0DA 2K17A 2ECVA 2LGVA 3KNVA 2YYRA 4LKAA 3T6RA 1LDJB 2VJFB 4R8PK 2AN6A 1IYMA 2YQMA 2FUUA 4N3WA 3U5NA 5KH7A 1WESA 3VK6A 1WGMA 2VPGA 5H1TA 3HCSA 4WZ0A 3ZPVE 1WENA 3LQIA 2YREA 3SOWA 2FUIA 2LGKA 2KYUA 2ECWA 4F52B 5D1KB 4YATA 2KGGA 2OXQC 2VPEA 5TDWA 2MT5A 2ECIA 4LADB 4R7EA 4L7XA 5B8DA 5D1LB 2HYED 1CHCA 2YW8A 2DX8A 5TBNA 4S3OB 3HCTA 3N9NA 2KGIA 5DKAA 4FIPA 3O36A 2H0DB 2I50A 3KV5A 3N9QA 2RI7A 2EODA 2K4DA 3T7LA 5B75A 4QF3A 3ZVZB 3C6WA 1LDKC 2LGGA 2VJEB 2MD7B 1V87A 1WEPA 1VD4A 4B86C 2CT2A 2K16A 4A49A 1WFKA 2D8SA 2JRJA 2KFTA 2E6SA 2YHOA 5TDRA 2LGLA 1MM3A 1WEEA 4BBQA 1FP0A 4FK5A 2VNFA 1Z2QA 3O34A 4O64A 5G05B 3QZVA 2QIZA 1WEUA 1ZBDB 2Y1NA 3C5KA 2ECTA 2F42A 4ZUXU 2K1JA 2EGPA 3M63A 4WA6A 2LXHC 4GNFA 2CSZA 1WEMA 2KWKA 3HTKC 3KQIA 4IC2A 4Q6FA 2KE1A 4N4FA 5FB0A 1MM2A 4MSXA 2G45A 2YSMA 3L1XA 2Y1MA 1WEQA 1X4IA 2VP7A 3RPGB 5FB1A 3DPLR 1WEVA 3M99A 1WE9A 2F6JA 5KH3A 2LV9A 2RSDA 2IDAA 4LLBA 1E4UA 4YBMA 2KR4A 2NAAA 5EYAF 1WEOA 4I7DA 3U5OA 5LKUA 3SHBA 5LKXA 4IC3A 2YT5A 3EB5A 4FO9A 4UP5A 1T1HA 3IHPA 5H1UA 2YU4A 3LRQA 3KV6A 2MA5A 4P5OB 5JG6A 1XWHA 2ECGA 1U6GB 1RMDA 5TABA 3ZVYA 1JM7A 1VYXA 4V3KC 4AYCB 4YBTA 1DVPA 3O70A 3PHDA 2KWJA 1F62A 2L80A 2QICA 2LXPC 2PUYA 4UP0A 5B78A 4YADA 3L1ZB 4PTBA 1BORA 3NG2A 4A0CD 2MNYA 3ZTGA 2MA6A 3ZNIA 1X4JA 3EB6A 2E6RA 2L75A 2LRIC 2VPDA 1Z6UA 2G43A 2VJFA 5DINA 2XB1A 1VFYA 2C2VS 4YABA 3L11A 1JOCA 5B79A 3PURA 3ASLA 5LKZA 4A4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMI A;  5LCW B;  2M1R A;  2YUR A;  3U5M A;  3O33 A;  1JM7 B;  4BHW A;  2JMD A;  2L43 A;  3RTR B;  5FEY A;  2MUM A;  2PNX A;  4WZ2 A;  4LJN A;  2KRE A;  5B77 A;  2XEU A;  4MVT A;  2G6Q A;  2ECN A;  4GND A;  4B7Y C;  2CKL A;  3M62 A;  5I3L A;  3N9L A;  3FL2 A;  1WIM A;  1G25 A;  4YAX A;  2BAY A;  3N9M A;  4ZQL A;  1HYI A;  2L5U A;  3ZYQ A;  5TRB A;  3MHS A;  4AVX A;  4X3G A;  2HDP A;  5C11 A;  3PUQ A;  1X4U A;  2KIZ A;  5G0F A;  2C2L A;  5D1M B;  4V3L C;  2YQL A;  1WIL A;  4L58 A;  2VJE A;  5C13 A;  3DQV R;  4I7B A;  3O7A A;  4QF2 A;  1Z60 A;  4XI1 A;  1N87 A;  4CCG X;  4GB0 A;  3ZPV 1;  1HYJ A;  3N9P A;  2Y43 A;  3MHH A;  5H9M A;  4W4U A;  3V43 A;  2F6N A;  4TKP B;  3O37 A;  5B76 A;  2LQ6 A;  4PPE A;  4UI9 B;  2MNZ A;  2UZG A;  2ZET C;  2EA6 A;  2LN0 A;  3RPG C;  2QJ0 A;  3N9O A;  2CKL B;  3U5P A;  1WEW A;  2YHN A;  5J3X A;  5H1V A;  3HCU A;  2M6M A;  4AP4 A;  1K2F A;  4YC9 A;  2M3H A;  3I2D A;  3LQH A;  2KU3 A;  4C9Z A;  2KWN A;  2KWO A;  5AIT A;  4R2Y A;  2VPB A;  4S3O C;  4GNE A;  4YBS A;  2MIQ A;  4LK9 A;  2JMJ A;  4WZ3 B;  4I7C A;  4NN2 A;  5FER A;  5KH9 A;  3LQJ A;  2M85 A;  2LDR A;  4FJC A;  3SOU A;  2YSJ A;  2CSY A;  4A4B A;  5LKT A;  3GL6 A;  3GV4 A;  4AUQ B;  4ZDT A;  2L0B A;  2MD8 C;  4CA1 A;  2ECJ A;  3O35 A;  1FBV A;  2FSA A;  4GNG A;  5AIU A;  2YUC A;  5G04 B;  4AYC A;  3SOX A;  2H0D A;  2K17 A;  2ECV A;  2LGV A;  3KNV A;  2YYR A;  4LKA A;  3T6R A;  1LDJ B;  2VJF B;  4R8P K;  2AN6 A;  1IYM A;  2YQM A;  2FUU A;  4N3W A;  3U5N A;  5KH7 A;  1WES A;  3VK6 A;  1WGM A;  2VPG A;  5H1T A;  3HCS A;  4WZ0 A;  3ZPV E;  1WEN A;  3LQI A;  2YRE A;  3SOW A;  2FUI A;  2LGK A;  2KYU A;  2ECW A;  4F52 B;  5D1K B;  4YAT A;  2KGG A;  2OXQ C;  2VPE A;  5TDW A;  2MT5 A;  2ECI A;  4LAD B;  4R7E A;  4L7X A;  5B8D A;  5D1L B;  2HYE D;  1CHC A;  2YW8 A;  2DX8 A;  5TBN A;  4S3O B;  3HCT A;  3N9N A;  2KGI A;  5DKA A;  4FIP A;  3O36 A;  2H0D B;  2I50 A;  3KV5 A;  3N9Q A;  2RI7 A;  2EOD A;  2K4D A;  3T7L A;  5B75 A;  4QF3 A;  3ZVZ B;  3C6W A;  1LDK C;  2LGG A;  2VJE B;  2MD7 B;  1V87 A;  1WEP A;  1VD4 A;  4B86 C;  2CT2 A;  2K16 A;  4A49 A;  1WFK A;  2D8S A;  2JRJ A;  2KFT A;  2E6S A;  2YHO A;  5TDR A;  2LGL A;  1MM3 A;  1WEE A;  4BBQ A;  1FP0 A;  4FK5 A;  2VNF A;  1Z2Q A;  3O34 A;  4O64 A;  5G05 B;  3QZV A;  2QIZ A;  1WEU A;  1ZBD B;  2Y1N A;  3C5K A;  2ECT A;  2F42 A;  4ZUX U;  2K1J A;  2EGP A;  3M63 A;  4WA6 A;  2LXH C;  4GNF A;  2CSZ A;  1WEM A;  2KWK A;  3HTK C;  3KQI A;  4IC2 A;  4Q6F A;  2KE1 A;  4N4F A;  5FB0 A;  1MM2 A;  4MSX A;  2G45 A;  2YSM A;  3L1X A;  2Y1M A;  1WEQ A;  1X4I A;  2VP7 A;  3RPG B;  5FB1 A;  3DPL R;  1WEV A;  3M99 A;  1WE9 A;  2F6J A;  5KH3 A;  2LV9 A;  2RSD A;  2IDA A;  4LLB A;  1E4U A;  4YBM A;  2KR4 A;  2NAA A;  5EYA F;  1WEO A;  4I7D A;  3U5O A;  5LKU A;  3SHB A;  5LKX A;  4IC3 A;  2YT5 A;  3EB5 A;  4FO9 A;  4UP5 A;  1T1H A;  3IHP A;  5H1U A;  2YU4 A;  3LRQ A;  3KV6 A;  2MA5 A;  4P5O B;  5JG6 A;  1XWH A;  2ECG A;  1U6G B;  1RMD A;  5TAB A;  3ZVY A;  1JM7 A;  1VYX A;  4V3K C;  4AYC B;  4YBT A;  1DVP A;  3O70 A;  3PHD A;  2KWJ A;  1F62 A;  2L80 A;  2QIC A;  2LXP C;  2PUY A;  4UP0 A;  5B78 A;  4YAD A;  3L1Z B;  4PTB A;  1BOR A;  3NG2 A;  4A0C D;  2MNY A;  3ZTG A;  2MA6 A;  3ZNI A;  1X4J A;  3EB6 A;  2E6R A;  2L75 A;  2LRI C;  2VPD A;  1Z6U A;  2G43 A;  2VJF A;  5DIN A;  2XB1 A;  1VFY A;  2C2V S;  4YAB A;  3L11 A;  1JOC A;  5B79 A;  3PUR A;  3ASL A;  5LKZ A;  4A4C A; 
#chains in the Genus database with same CATH topology
 2JMI A;  5LCW B;  2M1R A;  2YUR A;  2JM3 A;  3U5M A;  3O33 A;  1JM7 B;  4BHW A;  2JMD A;  2L43 A;  5K3Q A;  3RTR B;  5FEY A;  2MUM A;  2PNX A;  4WZ2 A;  2XOZ A;  4LJN A;  2KRE A;  5B77 A;  2XEU A;  1MBM A;  4MVT A;  2G6Q A;  2ECN A;  2MKE A;  4GND A;  4B7Y C;  2CKL A;  3M62 A;  5I3L A;  3N9L A;  4Z0O A;  3FL2 A;  1WIM A;  3PLW A;  1G25 A;  2FD4 A;  4YAX A;  2BAY A;  3N9M A;  4ZQL A;  1HYI A;  2L5U A;  4O62 A;  3ZYQ A;  2XOC A;  5TRB A;  3MHS A;  4AVX A;  4X3G A;  2HDP A;  5C11 A;  3PUQ A;  1X4U A;  2KIZ A;  5SVX A;  5SVY A;  4OGC A;  2D8U A;  2C2L A;  5D1M B;  5G0F A;  4V3L C;  2YQL A;  1WIL A;  4L58 A;  2VJE A;  5C13 A;  3DQV R;  4I7B A;  3O7A A;  4QF2 A;  1Z60 A;  4XI1 A;  1N87 A;  4CCG X;  4GB0 A;  4H9D A;  3ZPV 1;  1HYJ A;  3N9P A;  2Y43 A;  3MHH A;  5H9M A;  4W4U A;  3V43 A;  2F6N A;  4TKP B;  4OGE A;  3O37 A;  5B76 A;  2LQ6 A;  4PPE A;  4UI9 B;  2MNZ A;  2UZG A;  4F1P A;  2ZET C;  2EA6 A;  2LN0 A;  3RPG C;  2QJ0 A;  3N9O A;  2CKL B;  3U5P A;  1WEW A;  2YHN A;  5J3X A;  5H1V A;  3HCU A;  2M6M A;  4AP4 A;  1K2F A;  4YC9 A;  2M3H A;  3I2D A;  2KKX A;  3LQH A;  2KU3 A;  4C9Z A;  5SVI A;  2KWN A;  2KWO A;  2CRR A;  5AIT A;  4R2Y A;  3JUE A;  1DCQ A;  2VPB A;  4S3O C;  4GNE A;  4QQ4 A;  4YBS A;  2MIQ A;  4LK9 A;  2JMJ A;  4WZ3 B;  4Z0R A;  4I7C A;  4NN2 A;  5FER A;  5KH9 A;  3LQJ A;  2M85 A;  2LDR A;  4FJC A;  3SOU A;  2EGM A;  2YSJ A;  2CSY A;  4A4B A;  5LKT A;  3GL6 A;  3GV4 A;  4AUQ B;  4ZDT A;  2L0B A;  2MD8 C;  4CA1 A;  2ECJ A;  3O35 A;  1FBV A;  2FSA A;  4GNG A;  5AIU A;  2YUC A;  5G04 B;  4AYC A;  3T9K A;  3SOX A;  2H0D A;  3H7H A;  2K17 A;  2ECV A;  2LGV A;  3KNV A;  2YYR A;  4LKA A;  3T6R A;  1LDJ B;  2VJF B;  5SVI B;  2AN6 A;  4R8P K;  1IYM A;  2L7P A;  2YQM A;  2FUU A;  4N3W A;  3LJU X;  3U5N A;  5KH7 A;  3SUB A;  1WES A;  3VK6 A;  1WGM A;  2VPG A;  5H1T A;  3HCS A;  4WZ0 A;  3ZPV E;  1WEN A;  3LQI A;  2YRE A;  3SOW A;  2LAU A;  2RR4 A;  2FUI A;  2E61 A;  2LGK A;  2CSV A;  2KYU A;  2ECW A;  4F52 B;  5D1K B;  4YAT A;  2KGG A;  2OXQ C;  2VPE A;  5TDW A;  2MT5 A;  2ECI A;  4LAD B;  4R7E A;  4L7X A;  5B8D A;  5D1L B;  2HYE D;  1CHC A;  2YW8 A;  2DX8 A;  5TBN A;  4S3O B;  3HCT A;  3N9N A;  2KGI A;  5DKA A;  4FIP A;  2DSM A;  2M13 A;  3O36 A;  2H0D B;  2I50 A;  3FAO A;  3KV5 A;  3M7K A;  3N9Q A;  2RI7 A;  2EOD A;  2DJA A;  2K4D A;  3T7L A;  5B75 A;  3Q1D A;  4QF3 A;  3ZVZ B;  3C6W A;  1LDK C;  2LGG A;  2VJE B;  2MD7 B;  1V87 A;  2CON A;  1WEP A;  1VD4 A;  4B86 C;  2CT2 A;  2JUN A;  2K16 A;  3MDB C;  4A49 A;  1WFK A;  2D8S A;  2JRJ A;  2KFT A;  2E6S A;  2YHO A;  5TDR A;  2LGL A;  1MM3 A;  1WEE A;  4BBQ A;  1FP0 A;  4FK5 A;  2VNF A;  1Z2Q A;  3O34 A;  4O64 A;  5G05 B;  3QZV A;  2QIZ A;  1WEU A;  1ZBD B;  2KKY A;  2Y1N A;  3C5K A;  2ECT A;  2F42 A;  4ZUX U;  3FJU B;  2K1J A;  2EGP A;  3M63 A;  4WA6 A;  2LXH C;  4GNF A;  2CSZ A;  1WEM A;  2KWK A;  3HTK C;  3KQI A;  4IC2 A;  4Q6F A;  2KE1 A;  4N4F A;  5FB0 A;  1MM2 A;  4MSX A;  3LVQ E;  2G45 A;  2YSM A;  3L1X A;  2Y1M A;  1WEQ A;  3LVR E;  2YVR A;  1X4I A;  2VP7 A;  3RPG B;  5FB1 A;  3DPL R;  1WEV A;  3M99 A;  1WE9 A;  2F6J A;  5KH3 A;  2LV9 A;  2RSD A;  2IDA A;  4LLB A;  1E4U A;  4YBM A;  2KR4 A;  2NAA A;  5EYA F;  1WEO A;  4I7D A;  3U5O A;  3E2D A;  5LKU A;  3SHB A;  5LKX A;  2XP0 A;  4IC3 A;  2YT5 A;  3EB5 A;  4FO9 A;  4UP5 A;  1T1H A;  3IHP A;  5H1U A;  2YU4 A;  2IQJ A;  3LRQ A;  3KV6 A;  2MA5 A;  4P5O B;  5JG6 A;  1XWH A;  2B0O E;  3O47 A;  3LDY A;  2ECG A;  1U6G B;  1RMD A;  5TAB A;  3ZVY A;  1JM7 A;  1VYX A;  3FAN A;  4V3K C;  4AYC B;  4YBT A;  2P57 A;  1DVP A;  3O70 A;  3PHD A;  3FEH A;  2KWJ A;  1F62 A;  2L80 A;  2QIC A;  2LXP C;  2PUY A;  4UP0 A;  5B78 A;  4YAD A;  3FM8 C;  3L1Z B;  4PTB A;  1BOR A;  3NG2 A;  4A0C D;  2MNY A;  3ZTG A;  2MA6 A;  2OWA A;  2XOY A;  1X4J A;  2CRW A;  3DDT A;  3ZNI A;  3EB6 A;  2E6R A;  2L75 A;  2LRI C;  2EXU A;  2VPD A;  1Z6U A;  2G43 A;  2VJF A;  5DIN A;  2XB1 A;  1VFY A;  2C2V S;  3DWD A;  4YAB A;  3L11 A;  3KDE C;  2FFW A;  1JOC A;  5B79 A;  3PUR A;  3ASL A;  5LKZ A;  4A4C A; 
#chains in the Genus database with same CATH homology
 2JMI A;  5LCW B;  2M1R A;  2YUR A;  3U5M A;  3O33 A;  1JM7 B;  4BHW A;  2JMD A;  2L43 A;  3RTR B;  5FEY A;  2MUM A;  2PNX A;  4WZ2 A;  4LJN A;  2KRE A;  5B77 A;  2XEU A;  4MVT A;  2G6Q A;  2ECN A;  4GND A;  4B7Y C;  2CKL A;  3M62 A;  5I3L A;  3N9L A;  3FL2 A;  1WIM A;  1G25 A;  4YAX A;  2BAY A;  3N9M A;  4ZQL A;  1HYI A;  2L5U A;  3ZYQ A;  5TRB A;  3MHS A;  4AVX A;  4X3G A;  2HDP A;  5C11 A;  3PUQ A;  1X4U A;  2KIZ A;  5G0F A;  2C2L A;  5D1M B;  4V3L C;  2YQL A;  1WIL A;  4L58 A;  2VJE A;  5C13 A;  3DQV R;  4I7B A;  3O7A A;  4QF2 A;  1Z60 A;  4XI1 A;  1N87 A;  4CCG X;  4GB0 A;  3ZPV 1;  1HYJ A;  3N9P A;  2Y43 A;  3MHH A;  5H9M A;  4W4U A;  3V43 A;  2F6N A;  4TKP B;  3O37 A;  5B76 A;  2LQ6 A;  4PPE A;  4UI9 B;  2MNZ A;  2UZG A;  2ZET C;  2EA6 A;  2LN0 A;  3RPG C;  2QJ0 A;  3N9O A;  2CKL B;  3U5P A;  1WEW A;  2YHN A;  5J3X A;  5H1V A;  3HCU A;  2M6M A;  4AP4 A;  1K2F A;  4YC9 A;  2M3H A;  3I2D A;  3LQH A;  2KU3 A;  4C9Z A;  2KWN A;  2KWO A;  5AIT A;  4R2Y A;  2VPB A;  4S3O C;  4GNE A;  4YBS A;  2MIQ A;  4LK9 A;  2JMJ A;  4WZ3 B;  4I7C A;  4NN2 A;  5FER A;  5KH9 A;  3LQJ A;  2M85 A;  2LDR A;  4FJC A;  3SOU A;  2YSJ A;  2CSY A;  4A4B A;  5LKT A;  3GL6 A;  3GV4 A;  4AUQ B;  4ZDT A;  2L0B A;  2MD8 C;  4CA1 A;  2ECJ A;  3O35 A;  1FBV A;  2FSA A;  4GNG A;  5AIU A;  2YUC A;  5G04 B;  4AYC A;  3SOX A;  2H0D A;  2K17 A;  2ECV A;  2LGV A;  3KNV A;  2YYR A;  4LKA A;  3T6R A;  1LDJ B;  2VJF B;  4R8P K;  2AN6 A;  1IYM A;  2YQM A;  2FUU A;  4N3W A;  3U5N A;  5KH7 A;  1WES A;  3VK6 A;  1WGM A;  2VPG A;  5H1T A;  3HCS A;  4WZ0 A;  3ZPV E;  1WEN A;  3LQI A;  2YRE A;  3SOW A;  2FUI A;  2LGK A;  2KYU A;  2ECW A;  4F52 B;  5D1K B;  4YAT A;  2KGG A;  2OXQ C;  2VPE A;  5TDW A;  2MT5 A;  2ECI A;  4LAD B;  4R7E A;  4L7X A;  5B8D A;  5D1L B;  2HYE D;  1CHC A;  2YW8 A;  2DX8 A;  5TBN A;  4S3O B;  3HCT A;  3N9N A;  2KGI A;  5DKA A;  4FIP A;  3O36 A;  2H0D B;  2I50 A;  3KV5 A;  3N9Q A;  2RI7 A;  2EOD A;  2K4D A;  3T7L A;  5B75 A;  4QF3 A;  3ZVZ B;  3C6W A;  1LDK C;  2LGG A;  2VJE B;  2MD7 B;  1V87 A;  1WEP A;  1VD4 A;  4B86 C;  2CT2 A;  2K16 A;  4A49 A;  1WFK A;  2D8S A;  2JRJ A;  2KFT A;  2E6S A;  2YHO A;  5TDR A;  2LGL A;  1MM3 A;  1WEE A;  4BBQ A;  1FP0 A;  4FK5 A;  2VNF A;  1Z2Q A;  3O34 A;  4O64 A;  5G05 B;  3QZV A;  2QIZ A;  1WEU A;  1ZBD B;  2Y1N A;  3C5K A;  2ECT A;  2F42 A;  4ZUX U;  2K1J A;  2EGP A;  3M63 A;  4WA6 A;  2LXH C;  4GNF A;  2CSZ A;  1WEM A;  2KWK A;  3HTK C;  3KQI A;  4IC2 A;  4Q6F A;  2KE1 A;  4N4F A;  5FB0 A;  1MM2 A;  4MSX A;  2G45 A;  2YSM A;  3L1X A;  2Y1M A;  1WEQ A;  1X4I A;  2VP7 A;  3RPG B;  5FB1 A;  3DPL R;  1WEV A;  3M99 A;  1WE9 A;  2F6J A;  5KH3 A;  2LV9 A;  2RSD A;  2IDA A;  4LLB A;  1E4U A;  4YBM A;  2KR4 A;  2NAA A;  5EYA F;  1WEO A;  4I7D A;  3U5O A;  5LKU A;  3SHB A;  5LKX A;  4IC3 A;  2YT5 A;  3EB5 A;  4FO9 A;  4UP5 A;  1T1H A;  3IHP A;  5H1U A;  2YU4 A;  3LRQ A;  3KV6 A;  2MA5 A;  4P5O B;  5JG6 A;  1XWH A;  2ECG A;  1U6G B;  1RMD A;  5TAB A;  3ZVY A;  1JM7 A;  1VYX A;  4V3K C;  4AYC B;  4YBT A;  1DVP A;  3O70 A;  3PHD A;  2KWJ A;  1F62 A;  2L80 A;  2QIC A;  2LXP C;  2PUY A;  4UP0 A;  5B78 A;  4YAD A;  3L1Z B;  4PTB A;  1BOR A;  3NG2 A;  4A0C D;  2MNY A;  3ZTG A;  2MA6 A;  3ZNI A;  1X4J A;  3EB6 A;  2E6R A;  2L75 A;  2LRI C;  2VPD A;  1Z6U A;  2G43 A;  2VJF A;  5DIN A;  2XB1 A;  1VFY A;  2C2V S;  4YAB A;  3L11 A;  1JOC A;  5B79 A;  3PUR A;  3ASL A;  5LKZ A;  4A4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...