2KWKA

Solution structures of the double phd fingers of human transcriptional protein dpf3b bound to a h3 peptide wild type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone peptide
publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 18
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwkA00
1VD4A 2MA6A 2VP7A 3SHBA 3LQJA 2VNFA 4MSXA 5FEYA 2YYRA 5LKUA 5H1UA 2H0DA 5C11A 2LXPC 4N3WA 2LGLA 4CA1A 5TBNA 2ECVA 2MIQA 2XEUA 2CSZA 3KV5A 2YSJA 5J3XA 4WA6A 3MHSA 4A0CD 1DVPA 1K2FA 2LGKA 3ZVYA 3L1ZB 4AUQB 4XI1A 2Y43A 3T7LA 2KE1A 5AITA 4BHWA 4B7YC 4AYCB 4LJNA 3O37A 2F42A 1WGMA 1X4JA 1VFYA 2L5UA 5I3LA 2F6NA 2MD8C 2M3HA 5DINA 4LKAA 4ZUXU 3PURA 1WIMA 2YQLA 2KYUA 3NG2A 5LKZA 1V87A 3M63A 1X4IA 3V43A 2C2LA 2ECGA 4AYCA 2ECTA 4I7BA 2LN0A 3N9LA 3GV4A 2KU3A 3L11A 5FERA 1WESA 2UZGA 1HYIA 3U5MA 4PPEA 2MT5A 4UP5A 3FL2A 4I7DA 2ECWA 4WZ3B 4B86C 5KH9A 5C13A 5G0FA 2H0DB 3SOUA 1CHCA 5FB0A 1WEEA 1LDKC 4L7XA 1MM2A 1WEWA 2KFTA 2VJFB 2M85A 3U5OA 1FP0A 2L43A 5D1KB 2C2VS 4IC2A 3ZVZB 1X4UA 1WILA 2M1RA 2ECNA 2LV9A 4R2YA 2K4DA 4FK5A 1HYJA 1JM7A 3LQHA 2JMIA 4YATA 3HCSA 1WENA 3ZPV1 1WFKA 2E6SA 2KGGA 2NAAA 2ECIA 2VJFA 5KH7A 4V3KC 4YADA 3N9NA 1WEPA 5KH3A 3LQIA 3T6RA 2KGIA 3PUQA 3SOXA 4C9ZA 3C6WA 2QJ0A 2MA5A 1WEOA 2EODA 5B76A 3O35A 3MHHA 3N9MA 2FUUA 2VJEB 1Z2QA 2QICA 3M62A 3U5NA 2D8SA 2KREA 1WEUA 3ZNIA 4WZ0A 2FUIA 5D1LB 3C5KA 1BORA 4UI9B 3DPLR 2DX8A 3DQVR 2BAYA 1WE9A 4QF3A 4L58A 4X3GA 2EGPA 4BBQA 2G45A 2YW8A 4A4CA 2VPDA 1U6GB 4R8PK 2HDPA 3O33A 2HYED 2MUMA 2K17A 2AN6A 2VJEA 2KWKA 2PNXA 2FSAA 5TRBA 4S3OB 1MM3A 3KV6A 3VK6A 4A4BA 2F6JA 5LKTA 4YC9A 3HTKC 2RI7A 2VPGA 3KQIA 3ZYQA 4I7CA 2CT2A 3N9OA 2M6MA 1JM7B 4FIPA 1JOCA 5B79A 5G05B 3LRQA 2LXHC 2QIZA 2XB1A 4LLBA 5JG6A 5TABA 3N9PA 2OXQC 4V3LC 2LGGA 1XWHA 4LK9A 2G43A 2JMDA 4PTBA 2YQMA 4AP4A 3I2DA 2YHNA 4QF2A 4IC3A 3EB5A 2ECJA 1G25A 4GNGA 4YBSA 4Q6FA 3GL6A 2K1JA 5B8DA 4FO9A 2MNYA 2E6RA 2VPEA 4NN2A 1WEVA 3ASLA 3HCTA 4LADB 4WZ2A 2Y1MA 4GB0A 3O34A 3HCUA 4O64A 1Z60A 4CCGX 4YAXA 2PUYA 3L1XA 1Z6UA 3IHPA 2RSDA 3RPGB 5D1MB 4ZQLA 5LCWB 2YSMA 2KWNA 2KR4A 4TKPB 2LDRA 2LGVA 2CKLB 4AVXA 2L80A 1F62A 2ZETC 4ZDTA 4MVTA 3RTRB 2IDAA 3U5PA 1WEMA 2LRIC 5B78A 5H1VA 2EA6A 5TDRA 2YT5A 4UP0A 2LQ6A 5G04B 3O36A 3ZPVE 2YHOA 2I50A 5B77A 5AIUA 4YABA 1FBVA 4N4FA 3SOWA 4YBMA 2KIZA 3QZVA 2MNZA 1LDJB 2YU4A 2CKLA 1T1HA 4FJCA 2KWOA 3O70A 3RPGC 5B75A 2VPBA 4F52B 2Y1NA 1E4UA 1N87A 3O7AA 1ZBDB 3KNVA 4R7EA 2G6QA 5EYAF 5H9MA 2YURA 3N9QA 3M99A 4GNFA 1WEQA 1RMDA 2MD7B 4P5OB 1IYMA 2L75A 2KWJA 3PHDA 4YBTA 5H1TA 4W4UA 2YREA 4GNEA 5LKXA 5DKAA 5FB1A 2L0BA 1VYXA 2CSYA 5TDWA 2JMJA 4GNDA 4S3OC 3EB6A 4A49A 2K16A 3ZTGA 2YUCA 2JRJA
chains in the Genus database with same CATH superfamily
1VD4A 5SVXA 3FAOA 2MA6A 2VP7A 3SHBA 3LQJA 2VNFA 4MSXA 5FEYA 2YYRA 2DSMA 5LKUA 5H1UA 2H0DA 5C11A 2B0OE 2LXPC 2LGLA 4N3WA 4CA1A 5TBNA 2ECVA 3DDTA 2MIQA 3M7KA 2XEUA 2CSZA 3KV5A 2YSJA 5J3XA 4WA6A 2M13A 3MHSA 4A0CD 3JUEA 1DVPA 1K2FA 2LGKA 3ZVYA 2XOZA 3L1ZB 4F1PA 4AUQB 4XI1A 2Y43A 3T7LA 2KE1A 2CRWA 5AITA 4BHWA 4B7YC 2MKEA 4AYCB 4LJNA 3O37A 2RR4A 2F42A 1WGMA 1X4JA 1VFYA 2L5UA 3O47A 5I3LA 2F6NA 2MD8C 2M3HA 5DINA 2L7PA 4LKAA 4ZUXU 3PURA 5SVYA 1WIMA 3LVRE 2YQLA 2KYUA 3NG2A 5LKZA 1V87A 2EXUA 3M63A 1X4IA 3V43A 2C2LA 2P57A 2ECGA 4AYCA 2CSVA 2ECTA 4I7BA 2LN0A 3N9LA 3GV4A 2KU3A 3L11A 5FERA 1WESA 2UZGA 1HYIA 3U5MA 4PPEA 4O62A 2MT5A 4UP5A 3FL2A 4I7DA 2XOYA 2ECWA 4WZ3B 4B86C 5KH9A 5C13A 5G0FA 2H0DB 5K3QA 3SOUA 2FFWA 1CHCA 5FB0A 1WEEA 1LDKC 4L7XA 1MM2A 1WEWA 2KFTA 2VJFB 2M85A 3U5OA 1FP0A 2L43A 5D1KB 2C2VS 4IC2A 3ZVZB 4Z0OA 1X4UA 3FEHA 4H9DA 1WILA 2M1RA 2ECNA 2LV9A 4R2YA 2K4DA 4FK5A 1HYJA 1JM7A 3LQHA 2JMIA 4YATA 2XP0A 3HCSA 3MDBC 1WENA 3ZPV1 1WFKA 2E6SA 2KGGA 2NAAA 2ECIA 2VJFA 5KH7A 4V3KC 4YADA 3N9NA 3KDEC 1WEPA 5KH3A 3LQIA 3T6RA 2KGIA 3PUQA 3SOXA 5SVIA 4C9ZA 3LVQE 3C6WA 2QJ0A 2MA5A 1WEOA 2EODA 5B76A 3O35A 3MHHA 1DCQA 3N9MA 2FUUA 2VJEB 1Z2QA 2QICA 3M62A 2CONA 3U5NA 2KKXA 2D8SA 2KREA 3FJUB 1WEUA 3ZNIA 4WZ0A 2FD4A 2FUIA 4OGCA 5D1LB 3C5KA 1BORA 4UI9B 3DPLR 2DX8A 3DQVR 2BAYA 1WE9A 4QF3A 4L58A 2CRRA 4X3GA 2EGPA 4BBQA 2G45A 2EGMA 2YW8A 4A4CA 2VPDA 1U6GB 4R8PK 2HDPA 3O33A 3DWDA 2HYED 2MUMA 2K17A 2AN6A 2VJEA 2KWKA 2PNXA 2FSAA 5TRBA 4S3OB 1MM3A 3KV6A 3VK6A 4A4BA 2F6JA 5LKTA 4YC9A 3HTKC 2RI7A 2VPGA 3KQIA 3ZYQA 4I7CA 2CT2A 3N9OA 2M6MA 1JM7B 2OWAA 4FIPA 3Q1DA 1JOCA 5B79A 5G05B 3LRQA 2LXHC 2YVRA 2QIZA 2XB1A 4LLBA 5JG6A 5TABA 3N9PA 2OXQC 4V3LC 2LGGA 2XOCA 1XWHA 4LK9A 2G43A 2JMDA 4PTBA 5SVIB 2YQMA 4AP4A 3I2DA 2YHNA 4QF2A 4IC3A 3EB5A 2ECJA 1G25A 4GNGA 4YBSA 4Q6FA 3GL6A 2K1JA 5B8DA 4FO9A 2DJAA 2MNYA 2E6RA 2VPEA 4NN2A 1WEVA 3ASLA 3HCTA 4LADB 2JM3A 3H7HA 4WZ2A 2Y1MA 3FM8C 4GB0A 3O34A 2KKYA 3HCUA 4O64A 1Z60A 4CCGX 4YAXA 2PUYA 3L1XA 1Z6UA 3IHPA 2RSDA 2LAUA 3RPGB 5D1MB 4ZQLA 5LCWB 2YSMA 3T9KA 2KWNA 2KR4A 4TKPB 2LDRA 2E61A 2LGVA 3LDYA 3LJUX 2CKLB 4AVXA 2L80A 1F62A 2ZETC 4ZDTA 4MVTA 3RTRB 2JUNA 2IDAA 3U5PA 1WEMA 2LRIC 5B78A 5H1VA 2EA6A 4QQ4A 5TDRA 2YT5A 4UP0A 4Z0RA 2LQ6A 5G04B 3O36A 3ZPVE 1MBMA 2YHOA 2I50A 5B77A 5AIUA 4YABA 1FBVA 4N4FA 3SOWA 4YBMA 4OGEA 2KIZA 3QZVA 2MNZA 1LDJB 2YU4A 2CKLA 1T1HA 4FJCA 2KWOA 3O70A 3RPGC 5B75A 2VPBA 3E2DA 4F52B 2Y1NA 1E4UA 1N87A 3O7AA 2IQJA 1ZBDB 3KNVA 4R7EA 3PLWA 2G6QA 5EYAF 5H9MA 2YURA 3N9QA 3M99A 3FANA 3SUBA 4GNFA 1WEQA 1RMDA 2MD7B 4P5OB 1IYMA 2L75A 2D8UA 2KWJA 3PHDA 4YBTA 5H1TA 4W4UA 2YREA 4GNEA 5LKXA 5DKAA 5FB1A 2L0BA 1VYXA 2CSYA 5TDWA 2JMJA 4GNDA 4S3OC 3EB6A 4A49A 2K16A 3ZTGA 2YUCA 2JRJA
chains in the Genus database with same CATH topology
1VD4A 2MA6A 2VP7A 3SHBA 3LQJA 2VNFA 4MSXA 5FEYA 2YYRA 5LKUA 5H1UA 2H0DA 5C11A 2LXPC 4N3WA 2LGLA 4CA1A 5TBNA 2ECVA 2MIQA 2XEUA 2CSZA 3KV5A 2YSJA 5J3XA 4WA6A 3MHSA 4A0CD 1DVPA 1K2FA 2LGKA 3ZVYA 3L1ZB 4AUQB 4XI1A 2Y43A 3T7LA 2KE1A 5AITA 4BHWA 4B7YC 4AYCB 4LJNA 3O37A 2F42A 1WGMA 1X4JA 1VFYA 2L5UA 5I3LA 2F6NA 2MD8C 2M3HA 5DINA 4LKAA 4ZUXU 3PURA 1WIMA 2YQLA 2KYUA 3NG2A 5LKZA 1V87A 3M63A 1X4IA 3V43A 2C2LA 2ECGA 4AYCA 2ECTA 4I7BA 2LN0A 3N9LA 3GV4A 2KU3A 3L11A 5FERA 1WESA 2UZGA 1HYIA 3U5MA 4PPEA 2MT5A 4UP5A 3FL2A 4I7DA 2ECWA 4WZ3B 4B86C 5KH9A 5C13A 5G0FA 2H0DB 3SOUA 1CHCA 5FB0A 1WEEA 1LDKC 4L7XA 1MM2A 1WEWA 2KFTA 2VJFB 2M85A 3U5OA 1FP0A 2L43A 5D1KB 2C2VS 4IC2A 3ZVZB 1X4UA 1WILA 2M1RA 2ECNA 2LV9A 4R2YA 2K4DA 4FK5A 1HYJA 1JM7A 3LQHA 2JMIA 4YATA 3HCSA 1WENA 3ZPV1 1WFKA 2E6SA 2KGGA 2NAAA 2ECIA 2VJFA 5KH7A 4V3KC 4YADA 3N9NA 1WEPA 5KH3A 3LQIA 3T6RA 2KGIA 3PUQA 3SOXA 4C9ZA 3C6WA 2QJ0A 2MA5A 1WEOA 2EODA 5B76A 3O35A 3MHHA 3N9MA 2FUUA 2VJEB 1Z2QA 2QICA 3M62A 3U5NA 2D8SA 2KREA 1WEUA 3ZNIA 4WZ0A 2FUIA 5D1LB 3C5KA 1BORA 4UI9B 3DPLR 2DX8A 3DQVR 2BAYA 1WE9A 4QF3A 4L58A 4X3GA 2EGPA 4BBQA 2G45A 2YW8A 4A4CA 2VPDA 1U6GB 4R8PK 2HDPA 3O33A 2HYED 2MUMA 2K17A 2AN6A 2VJEA 2KWKA 2PNXA 2FSAA 5TRBA 4S3OB 1MM3A 3KV6A 3VK6A 4A4BA 2F6JA 5LKTA 4YC9A 3HTKC 2RI7A 2VPGA 3KQIA 3ZYQA 4I7CA 2CT2A 3N9OA 2M6MA 1JM7B 4FIPA 1JOCA 5B79A 5G05B 3LRQA 2LXHC 2QIZA 2XB1A 4LLBA 5JG6A 5TABA 3N9PA 2OXQC 4V3LC 2LGGA 1XWHA 4LK9A 2G43A 2JMDA 4PTBA 2YQMA 4AP4A 3I2DA 2YHNA 4QF2A 4IC3A 3EB5A 2ECJA 1G25A 4GNGA 4YBSA 4Q6FA 3GL6A 2K1JA 5B8DA 4FO9A 2MNYA 2E6RA 2VPEA 4NN2A 1WEVA 3ASLA 3HCTA 4LADB 4WZ2A 2Y1MA 4GB0A 3O34A 3HCUA 4O64A 1Z60A 4CCGX 4YAXA 2PUYA 3L1XA 1Z6UA 3IHPA 2RSDA 3RPGB 5D1MB 4ZQLA 5LCWB 2YSMA 2KWNA 2KR4A 4TKPB 2LDRA 2LGVA 2CKLB 4AVXA 2L80A 1F62A 2ZETC 4ZDTA 4MVTA 3RTRB 2IDAA 3U5PA 1WEMA 2LRIC 5B78A 5H1VA 2EA6A 5TDRA 2YT5A 4UP0A 2LQ6A 5G04B 3O36A 3ZPVE 2YHOA 2I50A 5B77A 5AIUA 4YABA 1FBVA 4N4FA 3SOWA 4YBMA 2KIZA 3QZVA 2MNZA 1LDJB 2YU4A 2CKLA 1T1HA 4FJCA 2KWOA 3O70A 3RPGC 5B75A 2VPBA 4F52B 2Y1NA 1E4UA 1N87A 3O7AA 1ZBDB 3KNVA 4R7EA 2G6QA 5EYAF 5H9MA 2YURA 3N9QA 3M99A 4GNFA 1WEQA 1RMDA 2MD7B 4P5OB 1IYMA 2L75A 2KWJA 3PHDA 4YBTA 5H1TA 4W4UA 2YREA 4GNEA 5LKXA 5DKAA 5FB1A 2L0BA 1VYXA 2CSYA 5TDWA 2JMJA 4GNDA 4S3OC 3EB6A 4A49A 2K16A 3ZTGA 2YUCA 2JRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD4 A;  2MA6 A;  2VP7 A;  3SHB A;  3LQJ A;  2VNF A;  4MSX A;  5FEY A;  2YYR A;  5LKU A;  5H1U A;  2H0D A;  5C11 A;  2LXP C;  4N3W A;  2LGL A;  4CA1 A;  5TBN A;  2ECV A;  2MIQ A;  2XEU A;  2CSZ A;  3KV5 A;  2YSJ A;  5J3X A;  4WA6 A;  3MHS A;  4A0C D;  1DVP A;  1K2F A;  2LGK A;  3ZVY A;  3L1Z B;  4AUQ B;  4XI1 A;  2Y43 A;  3T7L A;  2KE1 A;  5AIT A;  4BHW A;  4B7Y C;  4AYC B;  4LJN A;  3O37 A;  2F42 A;  1WGM A;  1X4J A;  1VFY A;  2L5U A;  5I3L A;  2F6N A;  2MD8 C;  2M3H A;  5DIN A;  4LKA A;  4ZUX U;  3PUR A;  1WIM A;  2YQL A;  2KYU A;  3NG2 A;  5LKZ A;  1V87 A;  3M63 A;  1X4I A;  3V43 A;  2C2L A;  2ECG A;  4AYC A;  2ECT A;  4I7B A;  2LN0 A;  3N9L A;  3GV4 A;  2KU3 A;  3L11 A;  5FER A;  1WES A;  2UZG A;  1HYI A;  3U5M A;  4PPE A;  2MT5 A;  4UP5 A;  3FL2 A;  4I7D A;  2ECW A;  4WZ3 B;  4B86 C;  5KH9 A;  5C13 A;  5G0F A;  2H0D B;  3SOU A;  1CHC A;  5FB0 A;  1WEE A;  1LDK C;  4L7X A;  1MM2 A;  1WEW A;  2KFT A;  2VJF B;  2M85 A;  3U5O A;  1FP0 A;  2L43 A;  5D1K B;  2C2V S;  4IC2 A;  3ZVZ B;  1X4U A;  1WIL A;  2M1R A;  2ECN A;  2LV9 A;  4R2Y A;  2K4D A;  4FK5 A;  1HYJ A;  1JM7 A;  3LQH A;  2JMI A;  4YAT A;  3HCS A;  1WEN A;  3ZPV 1;  1WFK A;  2E6S A;  2KGG A;  2NAA A;  2ECI A;  2VJF A;  5KH7 A;  4V3K C;  4YAD A;  3N9N A;  1WEP A;  5KH3 A;  3LQI A;  3T6R A;  2KGI A;  3PUQ A;  3SOX A;  4C9Z A;  3C6W A;  2QJ0 A;  2MA5 A;  1WEO A;  2EOD A;  5B76 A;  3O35 A;  3MHH A;  3N9M A;  2FUU A;  2VJE B;  1Z2Q A;  2QIC A;  3M62 A;  3U5N A;  2D8S A;  2KRE A;  1WEU A;  3ZNI A;  4WZ0 A;  2FUI A;  5D1L B;  3C5K A;  1BOR A;  4UI9 B;  3DPL R;  2DX8 A;  3DQV R;  2BAY A;  1WE9 A;  4QF3 A;  4L58 A;  4X3G A;  2EGP A;  4BBQ A;  2G45 A;  2YW8 A;  4A4C A;  2VPD A;  1U6G B;  4R8P K;  2HDP A;  3O33 A;  2HYE D;  2MUM A;  2K17 A;  2AN6 A;  2VJE A;  2KWK A;  2PNX A;  2FSA A;  5TRB A;  4S3O B;  1MM3 A;  3KV6 A;  3VK6 A;  4A4B A;  2F6J A;  5LKT A;  4YC9 A;  3HTK C;  2RI7 A;  2VPG A;  3KQI A;  3ZYQ A;  4I7C A;  2CT2 A;  3N9O A;  2M6M A;  1JM7 B;  4FIP A;  1JOC A;  5B79 A;  5G05 B;  3LRQ A;  2LXH C;  2QIZ A;  2XB1 A;  4LLB A;  5JG6 A;  5TAB A;  3N9P A;  2OXQ C;  4V3L C;  2LGG A;  1XWH A;  4LK9 A;  2G43 A;  2JMD A;  4PTB A;  2YQM A;  4AP4 A;  3I2D A;  2YHN A;  4QF2 A;  4IC3 A;  3EB5 A;  2ECJ A;  1G25 A;  4GNG A;  4YBS A;  4Q6F A;  3GL6 A;  2K1J A;  5B8D A;  4FO9 A;  2MNY A;  2E6R A;  2VPE A;  4NN2 A;  1WEV A;  3ASL A;  3HCT A;  4LAD B;  4WZ2 A;  2Y1M A;  4GB0 A;  3O34 A;  3HCU A;  4O64 A;  1Z60 A;  4CCG X;  4YAX A;  2PUY A;  3L1X A;  1Z6U A;  3IHP A;  2RSD A;  3RPG B;  5D1M B;  4ZQL A;  5LCW B;  2YSM A;  2KWN A;  2KR4 A;  4TKP B;  2LDR A;  2LGV A;  2CKL B;  4AVX A;  2L80 A;  1F62 A;  2ZET C;  4ZDT A;  4MVT A;  3RTR B;  2IDA A;  3U5P A;  1WEM A;  2LRI C;  5B78 A;  5H1V A;  2EA6 A;  5TDR A;  2YT5 A;  4UP0 A;  2LQ6 A;  5G04 B;  3O36 A;  3ZPV E;  2YHO A;  2I50 A;  5B77 A;  5AIU A;  4YAB A;  1FBV A;  4N4F A;  3SOW A;  4YBM A;  2KIZ A;  3QZV A;  2MNZ A;  1LDJ B;  2YU4 A;  2CKL A;  1T1H A;  4FJC A;  2KWO A;  3O70 A;  3RPG C;  5B75 A;  2VPB A;  4F52 B;  2Y1N A;  1E4U A;  1N87 A;  3O7A A;  1ZBD B;  3KNV A;  4R7E A;  2G6Q A;  5EYA F;  5H9M A;  2YUR A;  3N9Q A;  3M99 A;  4GNF A;  1WEQ A;  1RMD A;  2MD7 B;  4P5O B;  1IYM A;  2L75 A;  2KWJ A;  3PHD A;  4YBT A;  5H1T A;  4W4U A;  2YRE A;  4GNE A;  5LKX A;  5DKA A;  5FB1 A;  2L0B A;  1VYX A;  2CSY A;  5TDW A;  2JMJ A;  4GND A;  4S3O C;  3EB6 A;  4A49 A;  2K16 A;  3ZTG A;  2YUC A;  2JRJ A; 
#chains in the Genus database with same CATH topology
 1VD4 A;  5SVX A;  3FAO A;  2MA6 A;  2VP7 A;  3SHB A;  3LQJ A;  2VNF A;  4MSX A;  5FEY A;  2YYR A;  2DSM A;  5LKU A;  5H1U A;  2H0D A;  5C11 A;  2B0O E;  2LXP C;  2LGL A;  4N3W A;  4CA1 A;  5TBN A;  2ECV A;  3DDT A;  2MIQ A;  3M7K A;  2XEU A;  2CSZ A;  3KV5 A;  2YSJ A;  5J3X A;  4WA6 A;  2M13 A;  3MHS A;  4A0C D;  3JUE A;  1DVP A;  1K2F A;  2LGK A;  3ZVY A;  2XOZ A;  3L1Z B;  4F1P A;  4AUQ B;  4XI1 A;  2Y43 A;  3T7L A;  2KE1 A;  2CRW A;  5AIT A;  4BHW A;  4B7Y C;  2MKE A;  4AYC B;  4LJN A;  3O37 A;  2RR4 A;  2F42 A;  1WGM A;  1X4J A;  1VFY A;  2L5U A;  3O47 A;  5I3L A;  2F6N A;  2MD8 C;  2M3H A;  5DIN A;  2L7P A;  4LKA A;  4ZUX U;  3PUR A;  5SVY A;  1WIM A;  3LVR E;  2YQL A;  2KYU A;  3NG2 A;  5LKZ A;  1V87 A;  2EXU A;  3M63 A;  1X4I A;  3V43 A;  2C2L A;  2P57 A;  2ECG A;  4AYC A;  2CSV A;  2ECT A;  4I7B A;  2LN0 A;  3N9L A;  3GV4 A;  2KU3 A;  3L11 A;  5FER A;  1WES A;  2UZG A;  1HYI A;  3U5M A;  4PPE A;  4O62 A;  2MT5 A;  4UP5 A;  3FL2 A;  4I7D A;  2XOY A;  2ECW A;  4WZ3 B;  4B86 C;  5KH9 A;  5C13 A;  5G0F A;  2H0D B;  5K3Q A;  3SOU A;  2FFW A;  1CHC A;  5FB0 A;  1WEE A;  1LDK C;  4L7X A;  1MM2 A;  1WEW A;  2KFT A;  2VJF B;  2M85 A;  3U5O A;  1FP0 A;  2L43 A;  5D1K B;  2C2V S;  4IC2 A;  3ZVZ B;  4Z0O A;  1X4U A;  3FEH A;  4H9D A;  1WIL A;  2M1R A;  2ECN A;  2LV9 A;  4R2Y A;  2K4D A;  4FK5 A;  1HYJ A;  1JM7 A;  3LQH A;  2JMI A;  4YAT A;  2XP0 A;  3HCS A;  3MDB C;  1WEN A;  3ZPV 1;  1WFK A;  2E6S A;  2KGG A;  2NAA A;  2ECI A;  2VJF A;  5KH7 A;  4V3K C;  4YAD A;  3N9N A;  3KDE C;  1WEP A;  5KH3 A;  3LQI A;  3T6R A;  2KGI A;  3PUQ A;  3SOX A;  5SVI A;  4C9Z A;  3LVQ E;  3C6W A;  2QJ0 A;  2MA5 A;  1WEO A;  2EOD A;  5B76 A;  3O35 A;  3MHH A;  1DCQ A;  3N9M A;  2FUU A;  2VJE B;  1Z2Q A;  2QIC A;  3M62 A;  2CON A;  3U5N A;  2KKX A;  2D8S A;  2KRE A;  3FJU B;  1WEU A;  3ZNI A;  4WZ0 A;  2FD4 A;  2FUI A;  4OGC A;  5D1L B;  3C5K A;  1BOR A;  4UI9 B;  3DPL R;  2DX8 A;  3DQV R;  2BAY A;  1WE9 A;  4QF3 A;  4L58 A;  2CRR A;  4X3G A;  2EGP A;  4BBQ A;  2G45 A;  2EGM A;  2YW8 A;  4A4C A;  2VPD A;  1U6G B;  4R8P K;  2HDP A;  3O33 A;  3DWD A;  2HYE D;  2MUM A;  2K17 A;  2AN6 A;  2VJE A;  2KWK A;  2PNX A;  2FSA A;  5TRB A;  4S3O B;  1MM3 A;  3KV6 A;  3VK6 A;  4A4B A;  2F6J A;  5LKT A;  4YC9 A;  3HTK C;  2RI7 A;  2VPG A;  3KQI A;  3ZYQ A;  4I7C A;  2CT2 A;  3N9O A;  2M6M A;  1JM7 B;  2OWA A;  4FIP A;  3Q1D A;  1JOC A;  5B79 A;  5G05 B;  3LRQ A;  2LXH C;  2YVR A;  2QIZ A;  2XB1 A;  4LLB A;  5JG6 A;  5TAB A;  3N9P A;  2OXQ C;  4V3L C;  2LGG A;  2XOC A;  1XWH A;  4LK9 A;  2G43 A;  2JMD A;  4PTB A;  5SVI B;  2YQM A;  4AP4 A;  3I2D A;  2YHN A;  4QF2 A;  4IC3 A;  3EB5 A;  2ECJ A;  1G25 A;  4GNG A;  4YBS A;  4Q6F A;  3GL6 A;  2K1J A;  5B8D A;  4FO9 A;  2DJA A;  2MNY A;  2E6R A;  2VPE A;  4NN2 A;  1WEV A;  3ASL A;  3HCT A;  4LAD B;  2JM3 A;  3H7H A;  4WZ2 A;  2Y1M A;  3FM8 C;  4GB0 A;  3O34 A;  2KKY A;  3HCU A;  4O64 A;  1Z60 A;  4CCG X;  4YAX A;  2PUY A;  3L1X A;  1Z6U A;  3IHP A;  2RSD A;  2LAU A;  3RPG B;  5D1M B;  4ZQL A;  5LCW B;  2YSM A;  3T9K A;  2KWN A;  2KR4 A;  4TKP B;  2LDR A;  2E61 A;  2LGV A;  3LDY A;  3LJU X;  2CKL B;  4AVX A;  2L80 A;  1F62 A;  2ZET C;  4ZDT A;  4MVT A;  3RTR B;  2JUN A;  2IDA A;  3U5P A;  1WEM A;  2LRI C;  5B78 A;  5H1V A;  2EA6 A;  4QQ4 A;  5TDR A;  2YT5 A;  4UP0 A;  4Z0R A;  2LQ6 A;  5G04 B;  3O36 A;  3ZPV E;  1MBM A;  2YHO A;  2I50 A;  5B77 A;  5AIU A;  4YAB A;  1FBV A;  4N4F A;  3SOW A;  4YBM A;  4OGE A;  2KIZ A;  3QZV A;  2MNZ A;  1LDJ B;  2YU4 A;  2CKL A;  1T1H A;  4FJC A;  2KWO A;  3O70 A;  3RPG C;  5B75 A;  2VPB A;  3E2D A;  4F52 B;  2Y1N A;  1E4U A;  1N87 A;  3O7A A;  2IQJ A;  1ZBD B;  3KNV A;  4R7E A;  3PLW A;  2G6Q A;  5EYA F;  5H9M A;  2YUR A;  3N9Q A;  3M99 A;  3FAN A;  3SUB A;  4GNF A;  1WEQ A;  1RMD A;  2MD7 B;  4P5O B;  1IYM A;  2L75 A;  2D8U A;  2KWJ A;  3PHD A;  4YBT A;  5H1T A;  4W4U A;  2YRE A;  4GNE A;  5LKX A;  5DKA A;  5FB1 A;  2L0B A;  1VYX A;  2CSY A;  5TDW A;  2JMJ A;  4GND A;  4S3O C;  3EB6 A;  4A49 A;  2K16 A;  3ZTG A;  2YUC A;  2JRJ A; 
#chains in the Genus database with same CATH homology
 1VD4 A;  2MA6 A;  2VP7 A;  3SHB A;  3LQJ A;  2VNF A;  4MSX A;  5FEY A;  2YYR A;  5LKU A;  5H1U A;  2H0D A;  5C11 A;  2LXP C;  4N3W A;  2LGL A;  4CA1 A;  5TBN A;  2ECV A;  2MIQ A;  2XEU A;  2CSZ A;  3KV5 A;  2YSJ A;  5J3X A;  4WA6 A;  3MHS A;  4A0C D;  1DVP A;  1K2F A;  2LGK A;  3ZVY A;  3L1Z B;  4AUQ B;  4XI1 A;  2Y43 A;  3T7L A;  2KE1 A;  5AIT A;  4BHW A;  4B7Y C;  4AYC B;  4LJN A;  3O37 A;  2F42 A;  1WGM A;  1X4J A;  1VFY A;  2L5U A;  5I3L A;  2F6N A;  2MD8 C;  2M3H A;  5DIN A;  4LKA A;  4ZUX U;  3PUR A;  1WIM A;  2YQL A;  2KYU A;  3NG2 A;  5LKZ A;  1V87 A;  3M63 A;  1X4I A;  3V43 A;  2C2L A;  2ECG A;  4AYC A;  2ECT A;  4I7B A;  2LN0 A;  3N9L A;  3GV4 A;  2KU3 A;  3L11 A;  5FER A;  1WES A;  2UZG A;  1HYI A;  3U5M A;  4PPE A;  2MT5 A;  4UP5 A;  3FL2 A;  4I7D A;  2ECW A;  4WZ3 B;  4B86 C;  5KH9 A;  5C13 A;  5G0F A;  2H0D B;  3SOU A;  1CHC A;  5FB0 A;  1WEE A;  1LDK C;  4L7X A;  1MM2 A;  1WEW A;  2KFT A;  2VJF B;  2M85 A;  3U5O A;  1FP0 A;  2L43 A;  5D1K B;  2C2V S;  4IC2 A;  3ZVZ B;  1X4U A;  1WIL A;  2M1R A;  2ECN A;  2LV9 A;  4R2Y A;  2K4D A;  4FK5 A;  1HYJ A;  1JM7 A;  3LQH A;  2JMI A;  4YAT A;  3HCS A;  1WEN A;  3ZPV 1;  1WFK A;  2E6S A;  2KGG A;  2NAA A;  2ECI A;  2VJF A;  5KH7 A;  4V3K C;  4YAD A;  3N9N A;  1WEP A;  5KH3 A;  3LQI A;  3T6R A;  2KGI A;  3PUQ A;  3SOX A;  4C9Z A;  3C6W A;  2QJ0 A;  2MA5 A;  1WEO A;  2EOD A;  5B76 A;  3O35 A;  3MHH A;  3N9M A;  2FUU A;  2VJE B;  1Z2Q A;  2QIC A;  3M62 A;  3U5N A;  2D8S A;  2KRE A;  1WEU A;  3ZNI A;  4WZ0 A;  2FUI A;  5D1L B;  3C5K A;  1BOR A;  4UI9 B;  3DPL R;  2DX8 A;  3DQV R;  2BAY A;  1WE9 A;  4QF3 A;  4L58 A;  4X3G A;  2EGP A;  4BBQ A;  2G45 A;  2YW8 A;  4A4C A;  2VPD A;  1U6G B;  4R8P K;  2HDP A;  3O33 A;  2HYE D;  2MUM A;  2K17 A;  2AN6 A;  2VJE A;  2KWK A;  2PNX A;  2FSA A;  5TRB A;  4S3O B;  1MM3 A;  3KV6 A;  3VK6 A;  4A4B A;  2F6J A;  5LKT A;  4YC9 A;  3HTK C;  2RI7 A;  2VPG A;  3KQI A;  3ZYQ A;  4I7C A;  2CT2 A;  3N9O A;  2M6M A;  1JM7 B;  4FIP A;  1JOC A;  5B79 A;  5G05 B;  3LRQ A;  2LXH C;  2QIZ A;  2XB1 A;  4LLB A;  5JG6 A;  5TAB A;  3N9P A;  2OXQ C;  4V3L C;  2LGG A;  1XWH A;  4LK9 A;  2G43 A;  2JMD A;  4PTB A;  2YQM A;  4AP4 A;  3I2D A;  2YHN A;  4QF2 A;  4IC3 A;  3EB5 A;  2ECJ A;  1G25 A;  4GNG A;  4YBS A;  4Q6F A;  3GL6 A;  2K1J A;  5B8D A;  4FO9 A;  2MNY A;  2E6R A;  2VPE A;  4NN2 A;  1WEV A;  3ASL A;  3HCT A;  4LAD B;  4WZ2 A;  2Y1M A;  4GB0 A;  3O34 A;  3HCU A;  4O64 A;  1Z60 A;  4CCG X;  4YAX A;  2PUY A;  3L1X A;  1Z6U A;  3IHP A;  2RSD A;  3RPG B;  5D1M B;  4ZQL A;  5LCW B;  2YSM A;  2KWN A;  2KR4 A;  4TKP B;  2LDR A;  2LGV A;  2CKL B;  4AVX A;  2L80 A;  1F62 A;  2ZET C;  4ZDT A;  4MVT A;  3RTR B;  2IDA A;  3U5P A;  1WEM A;  2LRI C;  5B78 A;  5H1V A;  2EA6 A;  5TDR A;  2YT5 A;  4UP0 A;  2LQ6 A;  5G04 B;  3O36 A;  3ZPV E;  2YHO A;  2I50 A;  5B77 A;  5AIU A;  4YAB A;  1FBV A;  4N4F A;  3SOW A;  4YBM A;  2KIZ A;  3QZV A;  2MNZ A;  1LDJ B;  2YU4 A;  2CKL A;  1T1H A;  4FJC A;  2KWO A;  3O70 A;  3RPG C;  5B75 A;  2VPB A;  4F52 B;  2Y1N A;  1E4U A;  1N87 A;  3O7A A;  1ZBD B;  3KNV A;  4R7E A;  2G6Q A;  5EYA F;  5H9M A;  2YUR A;  3N9Q A;  3M99 A;  4GNF A;  1WEQ A;  1RMD A;  2MD7 B;  4P5O B;  1IYM A;  2L75 A;  2KWJ A;  3PHD A;  4YBT A;  5H1T A;  4W4U A;  2YRE A;  4GNE A;  5LKX A;  5DKA A;  5FB1 A;  2L0B A;  1VYX A;  2CSY A;  5TDW A;  2JMJ A;  4GND A;  4S3O C;  3EB6 A;  4A49 A;  2K16 A;  3ZTG A;  2YUC A;  2JRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...