2KWKA

Solution structures of the double phd fingers of human transcriptional protein dpf3b bound to a h3 peptide wild type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone peptide
total genus 18
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwkA00
1RMDA 1DVPA 2ECJA 3V43A 1MM3A 2KGIA 3SOWA 2FUUA 2MIQA 4WA6A 4ZQLA 3IHPA 2YURA 2FSAA 3N9MA 4L58A 3LRQA 4R7EA 2EA6A 5D1LB 4QF3A 3M63A 4IC3A 2G45A 2KWJA 3HCUA 4YADA 4GNDA 2LGGA 2YSJA 3SOXA 1WEMA 4FK5A 3I2DA 4YABA 1WGMA 5G0FA 3U5PA 3VK6A 5DINA 2LN0A 2JRJA 2KWNA 1LDJB 3ZPVE 4PPEA 5KH9A 4V3LC 1WENA 2HYED 2K17A 2MT5A 1WEWA 2ECIA 2K16A 1Z60A 4GB0A 2H0DB 2E6RA 4R8PK 1BORA 3N9QA 2M6MA 2YT5A 2EGPA 2EODA 3O70A 4YBTA 2VNFA 3O34A 4A4BA 3NG2A 4WZ2A 2CKLB 4S3OB 4GNGA 5J3XA 3O35A 2CKLA 4GNEA 2ECGA 1WEEA 3C5KA 2YQMA 5LKUA 2KR4A 4BBQA 3PUQA 1WFKA 2C2VS 3PHDA 3U5MA 2H0DA 2JMJA 1WEOA 2E6SA 2MD7B 2RSDA 2OXQC 4PTBA 3M62A 2YHOA 1IYMA 2MNYA 3SHBA 4BHWA 3KV5A 2CT2A 4WZ3B 2ECWA 3HTKC 2KREA 4UP0A 3DPLR 1T1HA 2LQ6A 1X4IA 3RPGB 3ZTGA 3ASLA 5C13A 3LQIA 3MHHA 5D1KB 4IC2A 4AVXA 2F6NA 5B75A 3KQIA 4Q6FA 2KWOA 2FUIA 5H1TA 4ZUXU 4N3WA 2YHNA 3RTRB 3DQVR 5FERA 1WEPA 2LGLA 3MHSA 5I3LA 2LXHC 2VJFB 2L43A 2LGKA 1F62A 4W4UA 1LDKC 3HCSA 2Y1NA 1JM7A 3QZVA 3N9PA 3T6RA 2M85A 3LQHA 3ZNIA 5FB0A 3O7AA 3ZPV1 2LRIC 2F42A 2M1RA 1HYIA 2C2LA 1G25A 2MD8C 4R2YA 3GV4A 2PUYA 1ZBDB 5TDWA 4YBMA 5B76A 2YUCA 4I7DA 4A0CD 4LKAA 5B79A 5D1MB 2M3HA 1E4UA 2LGVA 2YQLA 3HCTA 1Z2QA 4GNFA 5H9MA 5LKZA 2MA6A 3SOUA 1WEVA 1WEQA 1K2FA 5AITA 4YATA 1Z6UA 4YC9A 1WILA 4CA1A 1CHCA 2KE1A 4L7XA 4O64A 2NAAA 5FB1A 3KV6A 2JMIA 2MUMA 2XEUA 1VD4A 1XWHA 3C6WA 3O36A 2VPDA 5C11A 2KWKA 4AP4A 3O37A 2Y1MA 2KGGA 5TRBA 4ZDTA 5JG6A 2VJFA 5LKTA 3L1XA 3KNVA 1FP0A 5B8DA 3EB6A 3U5NA 4LADB 4YAXA 4AYCA 2K1JA 2VJEA 2ZETC 3M99A 4XI1A 1V87A 2YYRA 2RI7A 4A49A 3FL2A 1VYXA 4N4FA 2F6JA 4UI9B 1WE9A 4I7CA 3N9LA 5TBNA 5H1UA 4TKPB 2G43A 2PNXA 4CCGX 5LCWB 3GL6A 4FO9A 5EYAF 3N9OA 3L11A 2LXPC 4V3KC 1VFYA 3ZYQA 2MNZA 2LDRA 2VPBA 2YU4A 3ZVYA 4LJNA 5G05B 2ECNA 4AUQB 1JM7B 5FEYA 2KFTA 2ECTA 2YSMA 2QJ0A 4AYCB 4B7YC 1WEUA 4FJCA 2KU3A 1N87A 2QICA 5DKAA 4I7BA 5KH3A 1MM2A 4F52B 2DX8A 2KIZA 5TDRA 2D8SA 2UZGA 4WZ0A 5LKXA 2LV9A 1WIMA 2BAYA 3ZVZB 4UP5A 2G6QA 4S3OC 2VPGA 2L5UA 4MSXA 2JMDA 5B77A 4X3GA 1FBVA 2YW8A 2Y43A 1X4UA 1WESA 5G04B 4LLBA 2MA5A 5AIUA 3LQJA 2AN6A 2VPEA 5KH7A 2L75A 4LK9A 2HDPA 5TABA 2KYUA 2VP7A 1U6GB 2K4DA 5B78A 4B86C 2QIZA 3L1ZB 2YREA 4FIPA 5H1VA 1X4JA 2I50A 4P5OB 3EB5A 2L80A 2CSZA 2VJEB 2L0BA 3PURA 1JOCA 4QF2A 3RPGC 4MVTA 4A4CA 3U5OA 4YBSA 4C9ZA 2ECVA 2CSYA 2IDAA 3O33A 4NN2A 3N9NA 1HYJA 2XB1A 3T7LA
chains in the Genus database with same CATH superfamily
1RMDA 1DVPA 2ECJA 3V43A 1MM3A 2XOZA 3O47A 2KGIA 3SOWA 2FUUA 2MIQA 4WA6A 4ZQLA 3IHPA 2YURA 4OGEA 2FSAA 3N9MA 4L58A 3LRQA 4R7EA 3FJUB 2EA6A 5D1LB 4QF3A 3FM8C 3M63A 4IC3A 2G45A 2KWJA 3JUEA 3HCUA 4YADA 4GNDA 2LGGA 2YSJA 3SOXA 2CRRA 1WEMA 4FK5A 3I2DA 2KKXA 4YABA 1WGMA 5G0FA 2DJAA 2E61A 3U5PA 3VK6A 5DINA 2LN0A 3M7KA 2JRJA 2KWNA 1LDJB 3ZPVE 4PPEA 5KH9A 4V3LC 1WENA 2HYED 2IQJA 2K17A 2MT5A 3FANA 1WEWA 2ECIA 2K16A 1Z60A 4GB0A 2H0DB 2E6RA 3LJUX 4R8PK 1BORA 4QQ4A 3N9QA 2M6MA 2YT5A 5K3QA 2EGPA 2EODA 3O70A 4YBTA 2VNFA 3O34A 3LDYA 4A4BA 3NG2A 4WZ2A 2CKLB 3T9KA 4S3OB 4GNGA 5J3XA 3O35A 2CKLA 4GNEA 2ECGA 1WEEA 3C5KA 2M13A 2YQMA 5LKUA 2KR4A 4BBQA 3PUQA 1WFKA 2C2VS 3PHDA 3U5MA 2H0DA 2XOCA 2JMJA 1WEOA 2E6SA 2MD7B 3Q1DA 2RSDA 2OXQC 4PTBA 3M62A 2L7PA 2YHOA 1IYMA 2MNYA 3SHBA 5SVYA 4BHWA 3KV5A 2CT2A 4WZ3B 2ECWA 3HTKC 2P57A 2KREA 4UP0A 2CRWA 3DPLR 1T1HA 5SVIA 2LQ6A 1X4IA 3RPGB 3ZTGA 3ASLA 5C13A 3LQIA 3MHHA 5D1KB 4IC2A 4AVXA 2F6NA 5B75A 3KQIA 4Q6FA 2KWOA 2FUIA 5H1TA 4ZUXU 4N3WA 2YHNA 5SVXA 3E2DA 3RTRB 2EGMA 3DQVR 5FERA 1WEPA 2LGLA 3MHSA 5I3LA 2LXHC 2VJFB 2L43A 2LGKA 4Z0OA 1F62A 4W4UA 1LDKC 2FFWA 3HCSA 2Y1NA 1JM7A 3QZVA 3N9PA 2MKEA 3T6RA 2M85A 3LQHA 3ZNIA 5FB0A 3O7AA 2EXUA 3ZPV1 4H9DA 2LRIC 2F42A 2M1RA 2OWAA 1HYIA 2C2LA 1G25A 1DCQA 2MD8C 4R2YA 3GV4A 2PUYA 1ZBDB 2KKYA 5TDWA 4YBMA 5B76A 2YUCA 4I7DA 4A0CD 4LKAA 5B79A 5D1MB 2B0OE 2M3HA 3SUBA 1E4UA 4OGCA 2LGVA 2YQLA 3HCTA 2CONA 1Z2QA 4GNFA 5H9MA 5LKZA 2XP0A 2MA6A 3SOUA 1WEVA 1WEQA 1K2FA 5AITA 4YATA 3H7HA 1Z6UA 4YC9A 1WILA 4CA1A 2CSVA 1CHCA 2KE1A 4L7XA 4O64A 2NAAA 5FB1A 2YVRA 2XOYA 3KV6A 2JMIA 2MUMA 2XEUA 2RR4A 1VD4A 1XWHA 3C6WA 3O36A 2VPDA 5C11A 2KWKA 4AP4A 3O37A 2Y1MA 2KGGA 5TRBA 4ZDTA 5JG6A 2VJFA 5LKTA 3L1XA 3KNVA 1FP0A 5B8DA 3EB6A 3U5NA 4LADB 3FAOA 4YAXA 4AYCA 2K1JA 3KDEC 2VJEA 2ZETC 3M99A 4XI1A 1V87A 2YYRA 2RI7A 3MDBC 5SVIB 4A49A 3FL2A 1VYXA 4N4FA 2F6JA 4UI9B 1WE9A 4I7CA 3N9LA 5TBNA 5H1UA 4TKPB 2G43A 2PNXA 4CCGX 5LCWB 3GL6A 4FO9A 5EYAF 3N9OA 3L11A 2LXPC 2JUNA 4V3KC 1VFYA 3ZYQA 2LAUA 2MNZA 2LDRA 2VPBA 2YU4A 4O62A 3ZVYA 4LJNA 5G05B 2ECNA 4AUQB 3FEHA 1JM7B 5FEYA 2KFTA 2D8UA 2ECTA 2YSMA 2QJ0A 4AYCB 4B7YC 1WEUA 4FJCA 2KU3A 1N87A 2QICA 5DKAA 4I7BA 5KH3A 1MM2A 4F52B 2DX8A 2KIZA 5TDRA 2D8SA 2UZGA 4WZ0A 5LKXA 2LV9A 1WIMA 2BAYA 3ZVZB 4UP5A 2G6QA 4S3OC 2VPGA 2L5UA 3PLWA 4MSXA 2JMDA 5B77A 4X3GA 1FBVA 2YW8A 2Y43A 1X4UA 1WESA 4F1PA 5G04B 3DDTA 4LLBA 2MA5A 5AIUA 3LQJA 2AN6A 2VPEA 5KH7A 2L75A 4LK9A 2HDPA 5TABA 4Z0RA 2KYUA 3DWDA 2VP7A 1U6GB 2K4DA 5B78A 4B86C 2QIZA 2DSMA 3L1ZB 2YREA 3LVQE 4FIPA 5H1VA 1X4JA 2I50A 4P5OB 3EB5A 2L80A 2CSZA 3LVRE 2VJEB 2L0BA 3PURA 1JOCA 4QF2A 3RPGC 4MVTA 4A4CA 2FD4A 3U5OA 4YBSA 4C9ZA 2ECVA 2CSYA 2IDAA 3O33A 4NN2A 1MBMA 3N9NA 1HYJA 2XB1A 2JM3A 3T7LA
chains in the Genus database with same CATH topology
1RMDA 1DVPA 2ECJA 3V43A 1MM3A 2KGIA 3SOWA 2FUUA 2MIQA 4WA6A 4ZQLA 3IHPA 2YURA 2FSAA 3N9MA 4L58A 3LRQA 4R7EA 2EA6A 5D1LB 4QF3A 3M63A 4IC3A 2G45A 2KWJA 3HCUA 4YADA 4GNDA 2LGGA 2YSJA 3SOXA 1WEMA 4FK5A 3I2DA 4YABA 1WGMA 5G0FA 3U5PA 3VK6A 5DINA 2LN0A 2JRJA 2KWNA 1LDJB 3ZPVE 4PPEA 5KH9A 4V3LC 1WENA 2HYED 2K17A 2MT5A 1WEWA 2ECIA 2K16A 1Z60A 4GB0A 2H0DB 2E6RA 4R8PK 1BORA 3N9QA 2M6MA 2YT5A 2EGPA 2EODA 3O70A 4YBTA 2VNFA 3O34A 4A4BA 3NG2A 4WZ2A 2CKLB 4S3OB 4GNGA 5J3XA 3O35A 2CKLA 4GNEA 2ECGA 1WEEA 3C5KA 2YQMA 5LKUA 2KR4A 4BBQA 3PUQA 1WFKA 2C2VS 3PHDA 3U5MA 2H0DA 2JMJA 1WEOA 2E6SA 2MD7B 2RSDA 2OXQC 4PTBA 3M62A 2YHOA 1IYMA 2MNYA 3SHBA 4BHWA 3KV5A 2CT2A 4WZ3B 2ECWA 3HTKC 2KREA 4UP0A 3DPLR 1T1HA 2LQ6A 1X4IA 3RPGB 3ZTGA 3ASLA 5C13A 3LQIA 3MHHA 5D1KB 4IC2A 4AVXA 2F6NA 5B75A 3KQIA 4Q6FA 2KWOA 2FUIA 5H1TA 4ZUXU 4N3WA 2YHNA 3RTRB 3DQVR 5FERA 1WEPA 2LGLA 3MHSA 5I3LA 2LXHC 2VJFB 2L43A 2LGKA 1F62A 4W4UA 1LDKC 3HCSA 2Y1NA 1JM7A 3QZVA 3N9PA 3T6RA 2M85A 3LQHA 3ZNIA 5FB0A 3O7AA 3ZPV1 2LRIC 2F42A 2M1RA 1HYIA 2C2LA 1G25A 2MD8C 4R2YA 3GV4A 2PUYA 1ZBDB 5TDWA 4YBMA 5B76A 2YUCA 4I7DA 4A0CD 4LKAA 5B79A 5D1MB 2M3HA 1E4UA 2LGVA 2YQLA 3HCTA 1Z2QA 4GNFA 5H9MA 5LKZA 2MA6A 3SOUA 1WEVA 1WEQA 1K2FA 5AITA 4YATA 1Z6UA 4YC9A 1WILA 4CA1A 1CHCA 2KE1A 4L7XA 4O64A 2NAAA 5FB1A 3KV6A 2JMIA 2MUMA 2XEUA 1VD4A 1XWHA 3C6WA 3O36A 2VPDA 5C11A 2KWKA 4AP4A 3O37A 2Y1MA 2KGGA 5TRBA 4ZDTA 5JG6A 2VJFA 5LKTA 3L1XA 3KNVA 1FP0A 5B8DA 3EB6A 3U5NA 4LADB 4YAXA 4AYCA 2K1JA 2VJEA 2ZETC 3M99A 4XI1A 1V87A 2YYRA 2RI7A 4A49A 3FL2A 1VYXA 4N4FA 2F6JA 4UI9B 1WE9A 4I7CA 3N9LA 5TBNA 5H1UA 4TKPB 2G43A 2PNXA 4CCGX 5LCWB 3GL6A 4FO9A 5EYAF 3N9OA 3L11A 2LXPC 4V3KC 1VFYA 3ZYQA 2MNZA 2LDRA 2VPBA 2YU4A 3ZVYA 4LJNA 5G05B 2ECNA 4AUQB 1JM7B 5FEYA 2KFTA 2ECTA 2YSMA 2QJ0A 4AYCB 4B7YC 1WEUA 4FJCA 2KU3A 1N87A 2QICA 5DKAA 4I7BA 5KH3A 1MM2A 4F52B 2DX8A 2KIZA 5TDRA 2D8SA 2UZGA 4WZ0A 5LKXA 2LV9A 1WIMA 2BAYA 3ZVZB 4UP5A 2G6QA 4S3OC 2VPGA 2L5UA 4MSXA 2JMDA 5B77A 4X3GA 1FBVA 2YW8A 2Y43A 1X4UA 1WESA 5G04B 4LLBA 2MA5A 5AIUA 3LQJA 2AN6A 2VPEA 5KH7A 2L75A 4LK9A 2HDPA 5TABA 2KYUA 2VP7A 1U6GB 2K4DA 5B78A 4B86C 2QIZA 3L1ZB 2YREA 4FIPA 5H1VA 1X4JA 2I50A 4P5OB 3EB5A 2L80A 2CSZA 2VJEB 2L0BA 3PURA 1JOCA 4QF2A 3RPGC 4MVTA 4A4CA 3U5OA 4YBSA 4C9ZA 2ECVA 2CSYA 2IDAA 3O33A 4NN2A 3N9NA 1HYJA 2XB1A 3T7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMD A;  1DVP A;  2ECJ A;  3V43 A;  1MM3 A;  2KGI A;  3SOW A;  2FUU A;  2MIQ A;  4WA6 A;  4ZQL A;  3IHP A;  2YUR A;  2FSA A;  3N9M A;  4L58 A;  3LRQ A;  4R7E A;  2EA6 A;  5D1L B;  4QF3 A;  3M63 A;  4IC3 A;  2G45 A;  2KWJ A;  3HCU A;  4YAD A;  4GND A;  2LGG A;  2YSJ A;  3SOX A;  1WEM A;  4FK5 A;  3I2D A;  4YAB A;  1WGM A;  5G0F A;  3U5P A;  3VK6 A;  5DIN A;  2LN0 A;  2JRJ A;  2KWN A;  1LDJ B;  3ZPV E;  4PPE A;  5KH9 A;  4V3L C;  1WEN A;  2HYE D;  2K17 A;  2MT5 A;  1WEW A;  2ECI A;  2K16 A;  1Z60 A;  4GB0 A;  2H0D B;  2E6R A;  4R8P K;  1BOR A;  3N9Q A;  2M6M A;  2YT5 A;  2EGP A;  2EOD A;  3O70 A;  4YBT A;  2VNF A;  3O34 A;  4A4B A;  3NG2 A;  4WZ2 A;  2CKL B;  4S3O B;  4GNG A;  5J3X A;  3O35 A;  2CKL A;  4GNE A;  2ECG A;  1WEE A;  3C5K A;  2YQM A;  5LKU A;  2KR4 A;  4BBQ A;  3PUQ A;  1WFK A;  2C2V S;  3PHD A;  3U5M A;  2H0D A;  2JMJ A;  1WEO A;  2E6S A;  2MD7 B;  2RSD A;  2OXQ C;  4PTB A;  3M62 A;  2YHO A;  1IYM A;  2MNY A;  3SHB A;  4BHW A;  3KV5 A;  2CT2 A;  4WZ3 B;  2ECW A;  3HTK C;  2KRE A;  4UP0 A;  3DPL R;  1T1H A;  2LQ6 A;  1X4I A;  3RPG B;  3ZTG A;  3ASL A;  5C13 A;  3LQI A;  3MHH A;  5D1K B;  4IC2 A;  4AVX A;  2F6N A;  5B75 A;  3KQI A;  4Q6F A;  2KWO A;  2FUI A;  5H1T A;  4ZUX U;  4N3W A;  2YHN A;  3RTR B;  3DQV R;  5FER A;  1WEP A;  2LGL A;  3MHS A;  5I3L A;  2LXH C;  2VJF B;  2L43 A;  2LGK A;  1F62 A;  4W4U A;  1LDK C;  3HCS A;  2Y1N A;  1JM7 A;  3QZV A;  3N9P A;  3T6R A;  2M85 A;  3LQH A;  3ZNI A;  5FB0 A;  3O7A A;  3ZPV 1;  2LRI C;  2F42 A;  2M1R A;  1HYI A;  2C2L A;  1G25 A;  2MD8 C;  4R2Y A;  3GV4 A;  2PUY A;  1ZBD B;  5TDW A;  4YBM A;  5B76 A;  2YUC A;  4I7D A;  4A0C D;  4LKA A;  5B79 A;  5D1M B;  2M3H A;  1E4U A;  2LGV A;  2YQL A;  3HCT A;  1Z2Q A;  4GNF A;  5H9M A;  5LKZ A;  2MA6 A;  3SOU A;  1WEV A;  1WEQ A;  1K2F A;  5AIT A;  4YAT A;  1Z6U A;  4YC9 A;  1WIL A;  4CA1 A;  1CHC A;  2KE1 A;  4L7X A;  4O64 A;  2NAA A;  5FB1 A;  3KV6 A;  2JMI A;  2MUM A;  2XEU A;  1VD4 A;  1XWH A;  3C6W A;  3O36 A;  2VPD A;  5C11 A;  2KWK A;  4AP4 A;  3O37 A;  2Y1M A;  2KGG A;  5TRB A;  4ZDT A;  5JG6 A;  2VJF A;  5LKT A;  3L1X A;  3KNV A;  1FP0 A;  5B8D A;  3EB6 A;  3U5N A;  4LAD B;  4YAX A;  4AYC A;  2K1J A;  2VJE A;  2ZET C;  3M99 A;  4XI1 A;  1V87 A;  2YYR A;  2RI7 A;  4A49 A;  3FL2 A;  1VYX A;  4N4F A;  2F6J A;  4UI9 B;  1WE9 A;  4I7C A;  3N9L A;  5TBN A;  5H1U A;  4TKP B;  2G43 A;  2PNX A;  4CCG X;  5LCW B;  3GL6 A;  4FO9 A;  5EYA F;  3N9O A;  3L11 A;  2LXP C;  4V3K C;  1VFY A;  3ZYQ A;  2MNZ A;  2LDR A;  2VPB A;  2YU4 A;  3ZVY A;  4LJN A;  5G05 B;  2ECN A;  4AUQ B;  1JM7 B;  5FEY A;  2KFT A;  2ECT A;  2YSM A;  2QJ0 A;  4AYC B;  4B7Y C;  1WEU A;  4FJC A;  2KU3 A;  1N87 A;  2QIC A;  5DKA A;  4I7B A;  5KH3 A;  1MM2 A;  4F52 B;  2DX8 A;  2KIZ A;  5TDR A;  2D8S A;  2UZG A;  4WZ0 A;  5LKX A;  2LV9 A;  1WIM A;  2BAY A;  3ZVZ B;  4UP5 A;  2G6Q A;  4S3O C;  2VPG A;  2L5U A;  4MSX A;  2JMD A;  5B77 A;  4X3G A;  1FBV A;  2YW8 A;  2Y43 A;  1X4U A;  1WES A;  5G04 B;  4LLB A;  2MA5 A;  5AIU A;  3LQJ A;  2AN6 A;  2VPE A;  5KH7 A;  2L75 A;  4LK9 A;  2HDP A;  5TAB A;  2KYU A;  2VP7 A;  1U6G B;  2K4D A;  5B78 A;  4B86 C;  2QIZ A;  3L1Z B;  2YRE A;  4FIP A;  5H1V A;  1X4J A;  2I50 A;  4P5O B;  3EB5 A;  2L80 A;  2CSZ A;  2VJE B;  2L0B A;  3PUR A;  1JOC A;  4QF2 A;  3RPG C;  4MVT A;  4A4C A;  3U5O A;  4YBS A;  4C9Z A;  2ECV A;  2CSY A;  2IDA A;  3O33 A;  4NN2 A;  3N9N A;  1HYJ A;  2XB1 A;  3T7L A; 
#chains in the Genus database with same CATH topology
 1RMD A;  1DVP A;  2ECJ A;  3V43 A;  1MM3 A;  2XOZ A;  3O47 A;  2KGI A;  3SOW A;  2FUU A;  2MIQ A;  4WA6 A;  4ZQL A;  3IHP A;  2YUR A;  4OGE A;  2FSA A;  3N9M A;  4L58 A;  3LRQ A;  4R7E A;  3FJU B;  2EA6 A;  5D1L B;  4QF3 A;  3FM8 C;  3M63 A;  4IC3 A;  2G45 A;  2KWJ A;  3JUE A;  3HCU A;  4YAD A;  4GND A;  2LGG A;  2YSJ A;  3SOX A;  2CRR A;  1WEM A;  4FK5 A;  3I2D A;  2KKX A;  4YAB A;  1WGM A;  5G0F A;  2DJA A;  2E61 A;  3U5P A;  3VK6 A;  5DIN A;  2LN0 A;  3M7K A;  2JRJ A;  2KWN A;  1LDJ B;  3ZPV E;  4PPE A;  5KH9 A;  4V3L C;  1WEN A;  2HYE D;  2IQJ A;  2K17 A;  2MT5 A;  3FAN A;  1WEW A;  2ECI A;  2K16 A;  1Z60 A;  4GB0 A;  2H0D B;  2E6R A;  3LJU X;  4R8P K;  1BOR A;  4QQ4 A;  3N9Q A;  2M6M A;  2YT5 A;  5K3Q A;  2EGP A;  2EOD A;  3O70 A;  4YBT A;  2VNF A;  3O34 A;  3LDY A;  4A4B A;  3NG2 A;  4WZ2 A;  2CKL B;  3T9K A;  4S3O B;  4GNG A;  5J3X A;  3O35 A;  2CKL A;  4GNE A;  2ECG A;  1WEE A;  3C5K A;  2M13 A;  2YQM A;  5LKU A;  2KR4 A;  4BBQ A;  3PUQ A;  1WFK A;  2C2V S;  3PHD A;  3U5M A;  2H0D A;  2XOC A;  2JMJ A;  1WEO A;  2E6S A;  2MD7 B;  3Q1D A;  2RSD A;  2OXQ C;  4PTB A;  3M62 A;  2L7P A;  2YHO A;  1IYM A;  2MNY A;  3SHB A;  5SVY A;  4BHW A;  3KV5 A;  2CT2 A;  4WZ3 B;  2ECW A;  3HTK C;  2P57 A;  2KRE A;  4UP0 A;  2CRW A;  3DPL R;  1T1H A;  5SVI A;  2LQ6 A;  1X4I A;  3RPG B;  3ZTG A;  3ASL A;  5C13 A;  3LQI A;  3MHH A;  5D1K B;  4IC2 A;  4AVX A;  2F6N A;  5B75 A;  3KQI A;  4Q6F A;  2KWO A;  2FUI A;  5H1T A;  4ZUX U;  4N3W A;  2YHN A;  5SVX A;  3E2D A;  3RTR B;  2EGM A;  3DQV R;  5FER A;  1WEP A;  2LGL A;  3MHS A;  5I3L A;  2LXH C;  2VJF B;  2L43 A;  2LGK A;  4Z0O A;  1F62 A;  4W4U A;  1LDK C;  2FFW A;  3HCS A;  2Y1N A;  1JM7 A;  3QZV A;  3N9P A;  2MKE A;  3T6R A;  2M85 A;  3LQH A;  3ZNI A;  5FB0 A;  3O7A A;  2EXU A;  3ZPV 1;  4H9D A;  2LRI C;  2F42 A;  2M1R A;  2OWA A;  1HYI A;  2C2L A;  1G25 A;  1DCQ A;  2MD8 C;  4R2Y A;  3GV4 A;  2PUY A;  1ZBD B;  2KKY A;  5TDW A;  4YBM A;  5B76 A;  2YUC A;  4I7D A;  4A0C D;  4LKA A;  5B79 A;  5D1M B;  2B0O E;  2M3H A;  3SUB A;  1E4U A;  4OGC A;  2LGV A;  2YQL A;  3HCT A;  2CON A;  1Z2Q A;  4GNF A;  5H9M A;  5LKZ A;  2XP0 A;  2MA6 A;  3SOU A;  1WEV A;  1WEQ A;  1K2F A;  5AIT A;  4YAT A;  3H7H A;  1Z6U A;  4YC9 A;  1WIL A;  4CA1 A;  2CSV A;  1CHC A;  2KE1 A;  4L7X A;  4O64 A;  2NAA A;  5FB1 A;  2YVR A;  2XOY A;  3KV6 A;  2JMI A;  2MUM A;  2XEU A;  2RR4 A;  1VD4 A;  1XWH A;  3C6W A;  3O36 A;  2VPD A;  5C11 A;  2KWK A;  4AP4 A;  3O37 A;  2Y1M A;  2KGG A;  5TRB A;  4ZDT A;  5JG6 A;  2VJF A;  5LKT A;  3L1X A;  3KNV A;  1FP0 A;  5B8D A;  3EB6 A;  3U5N A;  4LAD B;  3FAO A;  4YAX A;  4AYC A;  2K1J A;  3KDE C;  2VJE A;  2ZET C;  3M99 A;  4XI1 A;  1V87 A;  2YYR A;  2RI7 A;  3MDB C;  5SVI B;  4A49 A;  3FL2 A;  1VYX A;  4N4F A;  2F6J A;  4UI9 B;  1WE9 A;  4I7C A;  3N9L A;  5TBN A;  5H1U A;  4TKP B;  2G43 A;  2PNX A;  4CCG X;  5LCW B;  3GL6 A;  4FO9 A;  5EYA F;  3N9O A;  3L11 A;  2LXP C;  2JUN A;  4V3K C;  1VFY A;  3ZYQ A;  2LAU A;  2MNZ A;  2LDR A;  2VPB A;  2YU4 A;  4O62 A;  3ZVY A;  4LJN A;  5G05 B;  2ECN A;  4AUQ B;  3FEH A;  1JM7 B;  5FEY A;  2KFT A;  2D8U A;  2ECT A;  2YSM A;  2QJ0 A;  4AYC B;  4B7Y C;  1WEU A;  4FJC A;  2KU3 A;  1N87 A;  2QIC A;  5DKA A;  4I7B A;  5KH3 A;  1MM2 A;  4F52 B;  2DX8 A;  2KIZ A;  5TDR A;  2D8S A;  2UZG A;  4WZ0 A;  5LKX A;  2LV9 A;  1WIM A;  2BAY A;  3ZVZ B;  4UP5 A;  2G6Q A;  4S3O C;  2VPG A;  2L5U A;  3PLW A;  4MSX A;  2JMD A;  5B77 A;  4X3G A;  1FBV A;  2YW8 A;  2Y43 A;  1X4U A;  1WES A;  4F1P A;  5G04 B;  3DDT A;  4LLB A;  2MA5 A;  5AIU A;  3LQJ A;  2AN6 A;  2VPE A;  5KH7 A;  2L75 A;  4LK9 A;  2HDP A;  5TAB A;  4Z0R A;  2KYU A;  3DWD A;  2VP7 A;  1U6G B;  2K4D A;  5B78 A;  4B86 C;  2QIZ A;  2DSM A;  3L1Z B;  2YRE A;  3LVQ E;  4FIP A;  5H1V A;  1X4J A;  2I50 A;  4P5O B;  3EB5 A;  2L80 A;  2CSZ A;  3LVR E;  2VJE B;  2L0B A;  3PUR A;  1JOC A;  4QF2 A;  3RPG C;  4MVT A;  4A4C A;  2FD4 A;  3U5O A;  4YBS A;  4C9Z A;  2ECV A;  2CSY A;  2IDA A;  3O33 A;  4NN2 A;  1MBM A;  3N9N A;  1HYJ A;  2XB1 A;  2JM3 A;  3T7L A; 
#chains in the Genus database with same CATH homology
 1RMD A;  1DVP A;  2ECJ A;  3V43 A;  1MM3 A;  2KGI A;  3SOW A;  2FUU A;  2MIQ A;  4WA6 A;  4ZQL A;  3IHP A;  2YUR A;  2FSA A;  3N9M A;  4L58 A;  3LRQ A;  4R7E A;  2EA6 A;  5D1L B;  4QF3 A;  3M63 A;  4IC3 A;  2G45 A;  2KWJ A;  3HCU A;  4YAD A;  4GND A;  2LGG A;  2YSJ A;  3SOX A;  1WEM A;  4FK5 A;  3I2D A;  4YAB A;  1WGM A;  5G0F A;  3U5P A;  3VK6 A;  5DIN A;  2LN0 A;  2JRJ A;  2KWN A;  1LDJ B;  3ZPV E;  4PPE A;  5KH9 A;  4V3L C;  1WEN A;  2HYE D;  2K17 A;  2MT5 A;  1WEW A;  2ECI A;  2K16 A;  1Z60 A;  4GB0 A;  2H0D B;  2E6R A;  4R8P K;  1BOR A;  3N9Q A;  2M6M A;  2YT5 A;  2EGP A;  2EOD A;  3O70 A;  4YBT A;  2VNF A;  3O34 A;  4A4B A;  3NG2 A;  4WZ2 A;  2CKL B;  4S3O B;  4GNG A;  5J3X A;  3O35 A;  2CKL A;  4GNE A;  2ECG A;  1WEE A;  3C5K A;  2YQM A;  5LKU A;  2KR4 A;  4BBQ A;  3PUQ A;  1WFK A;  2C2V S;  3PHD A;  3U5M A;  2H0D A;  2JMJ A;  1WEO A;  2E6S A;  2MD7 B;  2RSD A;  2OXQ C;  4PTB A;  3M62 A;  2YHO A;  1IYM A;  2MNY A;  3SHB A;  4BHW A;  3KV5 A;  2CT2 A;  4WZ3 B;  2ECW A;  3HTK C;  2KRE A;  4UP0 A;  3DPL R;  1T1H A;  2LQ6 A;  1X4I A;  3RPG B;  3ZTG A;  3ASL A;  5C13 A;  3LQI A;  3MHH A;  5D1K B;  4IC2 A;  4AVX A;  2F6N A;  5B75 A;  3KQI A;  4Q6F A;  2KWO A;  2FUI A;  5H1T A;  4ZUX U;  4N3W A;  2YHN A;  3RTR B;  3DQV R;  5FER A;  1WEP A;  2LGL A;  3MHS A;  5I3L A;  2LXH C;  2VJF B;  2L43 A;  2LGK A;  1F62 A;  4W4U A;  1LDK C;  3HCS A;  2Y1N A;  1JM7 A;  3QZV A;  3N9P A;  3T6R A;  2M85 A;  3LQH A;  3ZNI A;  5FB0 A;  3O7A A;  3ZPV 1;  2LRI C;  2F42 A;  2M1R A;  1HYI A;  2C2L A;  1G25 A;  2MD8 C;  4R2Y A;  3GV4 A;  2PUY A;  1ZBD B;  5TDW A;  4YBM A;  5B76 A;  2YUC A;  4I7D A;  4A0C D;  4LKA A;  5B79 A;  5D1M B;  2M3H A;  1E4U A;  2LGV A;  2YQL A;  3HCT A;  1Z2Q A;  4GNF A;  5H9M A;  5LKZ A;  2MA6 A;  3SOU A;  1WEV A;  1WEQ A;  1K2F A;  5AIT A;  4YAT A;  1Z6U A;  4YC9 A;  1WIL A;  4CA1 A;  1CHC A;  2KE1 A;  4L7X A;  4O64 A;  2NAA A;  5FB1 A;  3KV6 A;  2JMI A;  2MUM A;  2XEU A;  1VD4 A;  1XWH A;  3C6W A;  3O36 A;  2VPD A;  5C11 A;  2KWK A;  4AP4 A;  3O37 A;  2Y1M A;  2KGG A;  5TRB A;  4ZDT A;  5JG6 A;  2VJF A;  5LKT A;  3L1X A;  3KNV A;  1FP0 A;  5B8D A;  3EB6 A;  3U5N A;  4LAD B;  4YAX A;  4AYC A;  2K1J A;  2VJE A;  2ZET C;  3M99 A;  4XI1 A;  1V87 A;  2YYR A;  2RI7 A;  4A49 A;  3FL2 A;  1VYX A;  4N4F A;  2F6J A;  4UI9 B;  1WE9 A;  4I7C A;  3N9L A;  5TBN A;  5H1U A;  4TKP B;  2G43 A;  2PNX A;  4CCG X;  5LCW B;  3GL6 A;  4FO9 A;  5EYA F;  3N9O A;  3L11 A;  2LXP C;  4V3K C;  1VFY A;  3ZYQ A;  2MNZ A;  2LDR A;  2VPB A;  2YU4 A;  3ZVY A;  4LJN A;  5G05 B;  2ECN A;  4AUQ B;  1JM7 B;  5FEY A;  2KFT A;  2ECT A;  2YSM A;  2QJ0 A;  4AYC B;  4B7Y C;  1WEU A;  4FJC A;  2KU3 A;  1N87 A;  2QIC A;  5DKA A;  4I7B A;  5KH3 A;  1MM2 A;  4F52 B;  2DX8 A;  2KIZ A;  5TDR A;  2D8S A;  2UZG A;  4WZ0 A;  5LKX A;  2LV9 A;  1WIM A;  2BAY A;  3ZVZ B;  4UP5 A;  2G6Q A;  4S3O C;  2VPG A;  2L5U A;  4MSX A;  2JMD A;  5B77 A;  4X3G A;  1FBV A;  2YW8 A;  2Y43 A;  1X4U A;  1WES A;  5G04 B;  4LLB A;  2MA5 A;  5AIU A;  3LQJ A;  2AN6 A;  2VPE A;  5KH7 A;  2L75 A;  4LK9 A;  2HDP A;  5TAB A;  2KYU A;  2VP7 A;  1U6G B;  2K4D A;  5B78 A;  4B86 C;  2QIZ A;  3L1Z B;  2YRE A;  4FIP A;  5H1V A;  1X4J A;  2I50 A;  4P5O B;  3EB5 A;  2L80 A;  2CSZ A;  2VJE B;  2L0B A;  3PUR A;  1JOC A;  4QF2 A;  3RPG C;  4MVT A;  4A4C A;  3U5O A;  4YBS A;  4C9Z A;  2ECV A;  2CSY A;  2IDA A;  3O33 A;  4NN2 A;  3N9N A;  1HYJ A;  2XB1 A;  3T7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...