2KWKA

Solution structures of the double phd fingers of human transcriptional protein dpf3b bound to a h3 peptide wild type
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Histone peptide
total genus 18
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 2kwkA00
1CHCA 1LDKC 5FERA 2F6NA 4AP4A 3PHDA 4NN2A 5TDRA 2KGGA 3N9PA 3O36A 2LXHC 4YABA 2YW8A 4AUQB 1K2FA 5D1KB 3N9NA 2E6SA 4R2YA 2KGIA 1Z6UA 4GNDA 3ZVYA 5B75A 3I2DA 3SOUA 2IDAA 5B76A 2LN0A 1FBVA 2VJFB 4Q6FA 3ZVZB 2MNZA 5D1LB 3MHHA 1WFKA 3O7AA 4N4FA 2PNXA 1WILA 2HDPA 5AITA 1WEUA 5B79A 5LCWB 5TABA 2NAAA 2FSAA 2DX8A 2RSDA 5G05B 4GB0A 2YUCA 3N9LA 5H1TA 4O64A 2LQ6A 4YATA 1DVPA 4P5OB 2LGLA 2VPEA 4A0CD 4LJNA 2VJEA 4YBTA 1VD4A 2LXPC 2C2LA 1XWHA 5KH7A 2L43A 2QJ0A 2KWJA 1VYXA 4AYCA 2PUYA 1JOCA 4C9ZA 5LKTA 2L0BA 4IC2A 2FUIA 5I3LA 4S3OC 2EA6A 3ZPVE 1V87A 2ECJA 4ZDTA 2VPBA 2G45A 2VJFA 3C6WA 5TRBA 1JM7B 3SHBA 4ZUXU 3DQVR 1RMDA 3EB5A 3V43A 3ZNIA 2CKLB 2YSMA 5J3XA 1WESA 4YBMA 1HYIA 4WZ3B 2AN6A 1BORA 2ECTA 1F62A 5TBNA 3N9OA 2YHOA 5FEYA 3SOXA 5D1MB 4FJCA 1VFYA 2XEUA 2ECGA 5KH9A 3T7LA 2KREA 2KWNA 2KU3A 4UI9B 2VP7A 4WZ2A 1X4JA 4I7BA 2HYED 4L7XA 3U5PA 1WEOA 2MIQA 2YT5A 1T1HA 2VPGA 3KV6A 5FB0A 5LKUA 4AVXA 4YC9A 4PTBA 2M1RA 2M3HA 2YHNA 5LKZA 1N87A 3KV5A 3EB6A 4B86C 1MM2A 5JG6A 3L11A 2F6JA 3LRQA 3N9MA 2I50A 4V3KC 2BAYA 1WEVA 5C11A 4YAXA 2YU4A 4CA1A 3C5KA 1ZBDB 4UP5A 2E6RA 2C2VS 5DINA 4A4BA 2G43A 2MA5A 5B77A 3HTKC 2ZETC 3GV4A 4WZ0A 2MA6A 3PURA 2ECWA 4MSXA 2MD8C 2CSYA 2VNFA 2K1JA 5B78A 2VPDA 2FUUA 3U5NA 2UZGA 5FB1A 2YREA 4LADB 2XB1A 4A49A 4N3WA 3RPGB 4X3GA 4GNFA 4BBQA 3M62A 2YQMA 4A4CA 5C13A 3QZVA 3IHPA 3PUQA 2CKLA 3LQHA 2ECVA 4YADA 4I7DA 2ECNA 2H0DB 5DKAA 1WEQA 2K4DA 5LKXA 4I7CA 3O70A 3O33A 2MUMA 3RPGC 1LDJB 4IC3A 1E4UA 4BHWA 4LLBA 4LKAA 4F52B 1X4IA 3M99A 4UP0A 3ZYQA 3HCUA 4MVTA 4W4UA 2RI7A 3ZTGA 3LQJA 4QF3A 3O37A 1WGMA 1IYMA 2KWKA 5H1VA 4FIPA 2YURA 1WIMA 2JMJA 2MNYA 4B7YC 3L1ZB 2JMIA 4FO9A 2EGPA 4LK9A 5EYAF 1WEWA 2M6MA 3ZPV1 2LGGA 4GNGA 2D8SA 1WEPA 5B8DA 2JMDA 3GL6A 4GNEA 2H0DA 1WE9A 3FL2A 2JRJA 4TKPB 2KFTA 2Y1NA 3KQIA 4CCGX 2Y43A 3U5MA 1JM7A 3HCTA 3M63A 4WA6A 5H1UA 4QF2A 2M85A 1Z60A 3MHSA 3DPLR 1HYJA 3T6RA 2LRIC 2L5UA 2LDRA 2YYRA 4FK5A 2QICA 3ASLA 1U6GB 2LV9A 2ECIA 4R8PK 2QIZA 2LGVA 2MD7B 3U5OA 2LGKA 2L80A 5AIUA 2Y1MA 5H9MA 4R7EA 3KNVA 3L1XA 3O34A 2VJEB 2K16A 2MT5A 3VK6A 5KH3A 3NG2A 1FP0A 2KR4A 2G6QA 1Z2QA 2OXQC 2F42A 3HCSA 1WEEA 2CT2A 1WEMA 2KYUA 5TDWA 1MM3A 3SOWA 2K17A 5G04B 4YBSA 3N9QA 2YSJA 4V3LC 1X4UA 4XI1A 4AYCB 2KWOA 4S3OB 5G0FA 1G25A 2KE1A 3O35A 4PPEA 4ZQLA 2KIZA 2YQLA 4L58A 2L75A 3LQIA 2CSZA 2EODA 3RTRB 1WENA
chains in the Genus database with same CATH superfamily
1CHCA 1LDKC 5FERA 2XOZA 2F6NA 4AP4A 3PHDA 4NN2A 5TDRA 2KGGA 3N9PA 3O36A 2LXHC 3T9KA 4YABA 2YW8A 4AUQB 1K2FA 5D1KB 3N9NA 2E6SA 2IQJA 3LVQE 4R2YA 2KGIA 1Z6UA 4GNDA 3ZVYA 5B75A 2YVRA 3I2DA 3SOUA 2IDAA 5B76A 2LN0A 2CONA 1FBVA 2VJFB 4Q6FA 3ZVZB 3H7HA 2MNZA 5D1LB 3MHHA 2B0OE 1WFKA 3O7AA 4N4FA 2PNXA 1WILA 2HDPA 5AITA 1WEUA 5SVXA 5B79A 5LCWB 5K3QA 5TABA 2NAAA 2FSAA 2DX8A 2CRRA 2RSDA 5G05B 4GB0A 2YUCA 3DWDA 3LDYA 3N9LA 5H1TA 4O64A 2LQ6A 2JM3A 4YATA 2DSMA 3FEHA 1DVPA 4P5OB 2LGLA 3FJUB 2VPEA 4A0CD 4LJNA 2VJEA 4YBTA 1VD4A 2LXPC 2C2LA 1XWHA 5KH7A 2L7PA 2L43A 2QJ0A 2KWJA 1VYXA 2P57A 4AYCA 2PUYA 1JOCA 2D8UA 4C9ZA 5LKTA 2L0BA 4IC2A 2FUIA 5I3LA 2RR4A 2KKYA 4S3OC 2EA6A 3ZPVE 1V87A 2FFWA 2ECJA 3E2DA 3FANA 4ZDTA 2VPBA 2G45A 2VJFA 3C6WA 5TRBA 1JM7B 4QQ4A 3SHBA 3DQVR 1RMDA 4ZUXU 2EXUA 3EB5A 3V43A 3ZNIA 2CKLB 2YSMA 5J3XA 1WESA 4YBMA 2DJAA 1HYIA 4WZ3B 2AN6A 1BORA 2ECTA 1F62A 5TBNA 3N9OA 2YHOA 5FEYA 3SOXA 5D1MB 3SUBA 4FJCA 1VFYA 3LVRE 1DCQA 2XEUA 2ECGA 5KH9A 3T7LA 2KREA 2KWNA 2KU3A 4UI9B 2VP7A 4WZ2A 1X4JA 4I7BA 2HYED 4L7XA 3U5PA 1WEOA 2MIQA 3DDTA 2YT5A 1T1HA 2VPGA 3KV6A 5FB0A 5LKUA 4AVXA 4YC9A 4PTBA 2M1RA 2M3HA 2YHNA 2CSVA 5LKZA 1N87A 3KV5A 3EB6A 4B86C 1MM2A 5JG6A 3L11A 2F6JA 3LRQA 3N9MA 2I50A 1MBMA 4V3KC 2BAYA 1WEVA 5C11A 4YAXA 2YU4A 4CA1A 3C5KA 1ZBDB 4UP5A 2E6RA 2C2VS 5DINA 4A4BA 2G43A 2XP0A 2MA5A 5B77A 4OGCA 3HTKC 2ZETC 3GV4A 2JUNA 4WZ0A 2MA6A 5SVIA 3PURA 2ECWA 4MSXA 4H9DA 2MD8C 2CSYA 2VNFA 2K1JA 2XOYA 5B78A 2VPDA 2FUUA 3U5NA 2UZGA 5FB1A 2YREA 4LADB 2XB1A 4A49A 4N3WA 3RPGB 4X3GA 4GNFA 4BBQA 3M62A 2YQMA 4A4CA 5C13A 3QZVA 3IHPA 3PUQA 2CKLA 3LQHA 2ECVA 4YADA 3FAOA 4I7DA 2ECNA 3M7KA 2H0DB 5DKAA 1WEQA 2K4DA 5LKXA 3KDEC 2OWAA 2FD4A 4I7CA 3O70A 3O33A 2MUMA 3RPGC 1LDJB 4IC3A 1E4UA 4BHWA 4LLBA 4LKAA 4F52B 1X4IA 3M99A 4UP0A 3ZYQA 3Q1DA 3HCUA 4MVTA 4W4UA 2RI7A 3ZTGA 3LQJA 4QF3A 3O37A 1WGMA 4Z0OA 1IYMA 2KWKA 5H1VA 2LAUA 2M13A 4FIPA 2YURA 1WIMA 2JMJA 2MNYA 4B7YC 3L1ZB 2JMIA 4FO9A 2EGPA 4LK9A 5EYAF 1WEWA 2M6MA 3ZPV1 2MKEA 2LGGA 4GNGA 2D8SA 1WEPA 5B8DA 2JMDA 4O62A 3GL6A 4GNEA 2H0DA 1WE9A 3FL2A 2JRJA 4TKPB 2KFTA 2Y1NA 3KQIA 4CCGX 2Y43A 3U5MA 1JM7A 3HCTA 3M63A 4WA6A 5H1UA 4QF2A 2M85A 1Z60A 3MHSA 3DPLR 1HYJA 3T6RA 2LRIC 2L5UA 2LDRA 2YYRA 4FK5A 2QICA 3ASLA 1U6GB 2LV9A 4F1PA 2ECIA 4R8PK 2QIZA 2LGVA 2MD7B 3U5OA 2LGKA 3MDBC 2XOCA 2L80A 5AIUA 2Y1MA 4OGEA 4R7EA 5H9MA 3KNVA 3L1XA 3O34A 2VJEB 3PLWA 2K16A 2MT5A 3VK6A 5KH3A 3NG2A 1FP0A 2KR4A 2G6QA 5SVYA 1Z2QA 2OXQC 2F42A 3HCSA 1WEEA 3O47A 2CT2A 1WEMA 2KYUA 5TDWA 1MM3A 3SOWA 2K17A 5G04B 3LJUX 2E61A 3JUEA 4YBSA 3N9QA 2YSJA 4V3LC 1X4UA 4XI1A 4Z0RA 4AYCB 2KWOA 4S3OB 5G0FA 5SVIB 1G25A 2KKXA 2KE1A 3O35A 3FM8C 4PPEA 4ZQLA 2KIZA 2YQLA 4L58A 2L75A 2EGMA 3LQIA 2CRWA 2CSZA 2EODA 3RTRB 1WENA
chains in the Genus database with same CATH topology
1CHCA 1LDKC 5FERA 2F6NA 4AP4A 3PHDA 4NN2A 5TDRA 2KGGA 3N9PA 3O36A 2LXHC 4YABA 2YW8A 4AUQB 1K2FA 5D1KB 3N9NA 2E6SA 4R2YA 2KGIA 1Z6UA 4GNDA 3ZVYA 5B75A 3I2DA 3SOUA 2IDAA 5B76A 2LN0A 1FBVA 2VJFB 4Q6FA 3ZVZB 2MNZA 5D1LB 3MHHA 1WFKA 3O7AA 4N4FA 2PNXA 1WILA 2HDPA 5AITA 1WEUA 5B79A 5LCWB 5TABA 2NAAA 2FSAA 2DX8A 2RSDA 5G05B 4GB0A 2YUCA 3N9LA 5H1TA 4O64A 2LQ6A 4YATA 1DVPA 4P5OB 2LGLA 2VPEA 4A0CD 4LJNA 2VJEA 4YBTA 1VD4A 2LXPC 2C2LA 1XWHA 5KH7A 2L43A 2QJ0A 2KWJA 1VYXA 4AYCA 2PUYA 1JOCA 4C9ZA 5LKTA 2L0BA 4IC2A 2FUIA 5I3LA 4S3OC 2EA6A 3ZPVE 1V87A 2ECJA 4ZDTA 2VPBA 2G45A 2VJFA 3C6WA 5TRBA 1JM7B 3SHBA 4ZUXU 3DQVR 1RMDA 3EB5A 3V43A 3ZNIA 2CKLB 2YSMA 5J3XA 1WESA 4YBMA 1HYIA 4WZ3B 2AN6A 1BORA 2ECTA 1F62A 5TBNA 3N9OA 2YHOA 5FEYA 3SOXA 5D1MB 4FJCA 1VFYA 2XEUA 2ECGA 5KH9A 3T7LA 2KREA 2KWNA 2KU3A 4UI9B 2VP7A 4WZ2A 1X4JA 4I7BA 2HYED 4L7XA 3U5PA 1WEOA 2MIQA 2YT5A 1T1HA 2VPGA 3KV6A 5FB0A 5LKUA 4AVXA 4YC9A 4PTBA 2M1RA 2M3HA 2YHNA 5LKZA 1N87A 3KV5A 3EB6A 4B86C 1MM2A 5JG6A 3L11A 2F6JA 3LRQA 3N9MA 2I50A 4V3KC 2BAYA 1WEVA 5C11A 4YAXA 2YU4A 4CA1A 3C5KA 1ZBDB 4UP5A 2E6RA 2C2VS 5DINA 4A4BA 2G43A 2MA5A 5B77A 3HTKC 2ZETC 3GV4A 4WZ0A 2MA6A 3PURA 2ECWA 4MSXA 2MD8C 2CSYA 2VNFA 2K1JA 5B78A 2VPDA 2FUUA 3U5NA 2UZGA 5FB1A 2YREA 4LADB 2XB1A 4A49A 4N3WA 3RPGB 4X3GA 4GNFA 4BBQA 3M62A 2YQMA 4A4CA 5C13A 3QZVA 3IHPA 3PUQA 2CKLA 3LQHA 2ECVA 4YADA 4I7DA 2ECNA 2H0DB 5DKAA 1WEQA 2K4DA 5LKXA 4I7CA 3O70A 3O33A 2MUMA 3RPGC 1LDJB 4IC3A 1E4UA 4BHWA 4LLBA 4LKAA 4F52B 1X4IA 3M99A 4UP0A 3ZYQA 3HCUA 4MVTA 4W4UA 2RI7A 3ZTGA 3LQJA 4QF3A 3O37A 1WGMA 1IYMA 2KWKA 5H1VA 4FIPA 2YURA 1WIMA 2JMJA 2MNYA 4B7YC 3L1ZB 2JMIA 4FO9A 2EGPA 4LK9A 5EYAF 1WEWA 2M6MA 3ZPV1 2LGGA 4GNGA 2D8SA 1WEPA 5B8DA 2JMDA 3GL6A 4GNEA 2H0DA 1WE9A 3FL2A 2JRJA 4TKPB 2KFTA 2Y1NA 3KQIA 4CCGX 2Y43A 3U5MA 1JM7A 3HCTA 3M63A 4WA6A 5H1UA 4QF2A 2M85A 1Z60A 3MHSA 3DPLR 1HYJA 3T6RA 2LRIC 2L5UA 2LDRA 2YYRA 4FK5A 2QICA 3ASLA 1U6GB 2LV9A 2ECIA 4R8PK 2QIZA 2LGVA 2MD7B 3U5OA 2LGKA 2L80A 5AIUA 2Y1MA 5H9MA 4R7EA 3KNVA 3L1XA 3O34A 2VJEB 2K16A 2MT5A 3VK6A 5KH3A 3NG2A 1FP0A 2KR4A 2G6QA 1Z2QA 2OXQC 2F42A 3HCSA 1WEEA 2CT2A 1WEMA 2KYUA 5TDWA 1MM3A 3SOWA 2K17A 5G04B 4YBSA 3N9QA 2YSJA 4V3LC 1X4UA 4XI1A 4AYCB 2KWOA 4S3OB 5G0FA 1G25A 2KE1A 3O35A 4PPEA 4ZQLA 2KIZA 2YQLA 4L58A 2L75A 3LQIA 2CSZA 2EODA 3RTRB 1WENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHC A;  1LDK C;  5FER A;  2F6N A;  4AP4 A;  3PHD A;  4NN2 A;  5TDR A;  2KGG A;  3N9P A;  3O36 A;  2LXH C;  4YAB A;  2YW8 A;  4AUQ B;  1K2F A;  5D1K B;  3N9N A;  2E6S A;  4R2Y A;  2KGI A;  1Z6U A;  4GND A;  3ZVY A;  5B75 A;  3I2D A;  3SOU A;  2IDA A;  5B76 A;  2LN0 A;  1FBV A;  2VJF B;  4Q6F A;  3ZVZ B;  2MNZ A;  5D1L B;  3MHH A;  1WFK A;  3O7A A;  4N4F A;  2PNX A;  1WIL A;  2HDP A;  5AIT A;  1WEU A;  5B79 A;  5LCW B;  5TAB A;  2NAA A;  2FSA A;  2DX8 A;  2RSD A;  5G05 B;  4GB0 A;  2YUC A;  3N9L A;  5H1T A;  4O64 A;  2LQ6 A;  4YAT A;  1DVP A;  4P5O B;  2LGL A;  2VPE A;  4A0C D;  4LJN A;  2VJE A;  4YBT A;  1VD4 A;  2LXP C;  2C2L A;  1XWH A;  5KH7 A;  2L43 A;  2QJ0 A;  2KWJ A;  1VYX A;  4AYC A;  2PUY A;  1JOC A;  4C9Z A;  5LKT A;  2L0B A;  4IC2 A;  2FUI A;  5I3L A;  4S3O C;  2EA6 A;  3ZPV E;  1V87 A;  2ECJ A;  4ZDT A;  2VPB A;  2G45 A;  2VJF A;  3C6W A;  5TRB A;  1JM7 B;  3SHB A;  4ZUX U;  3DQV R;  1RMD A;  3EB5 A;  3V43 A;  3ZNI A;  2CKL B;  2YSM A;  5J3X A;  1WES A;  4YBM A;  1HYI A;  4WZ3 B;  2AN6 A;  1BOR A;  2ECT A;  1F62 A;  5TBN A;  3N9O A;  2YHO A;  5FEY A;  3SOX A;  5D1M B;  4FJC A;  1VFY A;  2XEU A;  2ECG A;  5KH9 A;  3T7L A;  2KRE A;  2KWN A;  2KU3 A;  4UI9 B;  2VP7 A;  4WZ2 A;  1X4J A;  4I7B A;  2HYE D;  4L7X A;  3U5P A;  1WEO A;  2MIQ A;  2YT5 A;  1T1H A;  2VPG A;  3KV6 A;  5FB0 A;  5LKU A;  4AVX A;  4YC9 A;  4PTB A;  2M1R A;  2M3H A;  2YHN A;  5LKZ A;  1N87 A;  3KV5 A;  3EB6 A;  4B86 C;  1MM2 A;  5JG6 A;  3L11 A;  2F6J A;  3LRQ A;  3N9M A;  2I50 A;  4V3K C;  2BAY A;  1WEV A;  5C11 A;  4YAX A;  2YU4 A;  4CA1 A;  3C5K A;  1ZBD B;  4UP5 A;  2E6R A;  2C2V S;  5DIN A;  4A4B A;  2G43 A;  2MA5 A;  5B77 A;  3HTK C;  2ZET C;  3GV4 A;  4WZ0 A;  2MA6 A;  3PUR A;  2ECW A;  4MSX A;  2MD8 C;  2CSY A;  2VNF A;  2K1J A;  5B78 A;  2VPD A;  2FUU A;  3U5N A;  2UZG A;  5FB1 A;  2YRE A;  4LAD B;  2XB1 A;  4A49 A;  4N3W A;  3RPG B;  4X3G A;  4GNF A;  4BBQ A;  3M62 A;  2YQM A;  4A4C A;  5C13 A;  3QZV A;  3IHP A;  3PUQ A;  2CKL A;  3LQH A;  2ECV A;  4YAD A;  4I7D A;  2ECN A;  2H0D B;  5DKA A;  1WEQ A;  2K4D A;  5LKX A;  4I7C A;  3O70 A;  3O33 A;  2MUM A;  3RPG C;  1LDJ B;  4IC3 A;  1E4U A;  4BHW A;  4LLB A;  4LKA A;  4F52 B;  1X4I A;  3M99 A;  4UP0 A;  3ZYQ A;  3HCU A;  4MVT A;  4W4U A;  2RI7 A;  3ZTG A;  3LQJ A;  4QF3 A;  3O37 A;  1WGM A;  1IYM A;  2KWK A;  5H1V A;  4FIP A;  2YUR A;  1WIM A;  2JMJ A;  2MNY A;  4B7Y C;  3L1Z B;  2JMI A;  4FO9 A;  2EGP A;  4LK9 A;  5EYA F;  1WEW A;  2M6M A;  3ZPV 1;  2LGG A;  4GNG A;  2D8S A;  1WEP A;  5B8D A;  2JMD A;  3GL6 A;  4GNE A;  2H0D A;  1WE9 A;  3FL2 A;  2JRJ A;  4TKP B;  2KFT A;  2Y1N A;  3KQI A;  4CCG X;  2Y43 A;  3U5M A;  1JM7 A;  3HCT A;  3M63 A;  4WA6 A;  5H1U A;  4QF2 A;  2M85 A;  1Z60 A;  3MHS A;  3DPL R;  1HYJ A;  3T6R A;  2LRI C;  2L5U A;  2LDR A;  2YYR A;  4FK5 A;  2QIC A;  3ASL A;  1U6G B;  2LV9 A;  2ECI A;  4R8P K;  2QIZ A;  2LGV A;  2MD7 B;  3U5O A;  2LGK A;  2L80 A;  5AIU A;  2Y1M A;  5H9M A;  4R7E A;  3KNV A;  3L1X A;  3O34 A;  2VJE B;  2K16 A;  2MT5 A;  3VK6 A;  5KH3 A;  3NG2 A;  1FP0 A;  2KR4 A;  2G6Q A;  1Z2Q A;  2OXQ C;  2F42 A;  3HCS A;  1WEE A;  2CT2 A;  1WEM A;  2KYU A;  5TDW A;  1MM3 A;  3SOW A;  2K17 A;  5G04 B;  4YBS A;  3N9Q A;  2YSJ A;  4V3L C;  1X4U A;  4XI1 A;  4AYC B;  2KWO A;  4S3O B;  5G0F A;  1G25 A;  2KE1 A;  3O35 A;  4PPE A;  4ZQL A;  2KIZ A;  2YQL A;  4L58 A;  2L75 A;  3LQI A;  2CSZ A;  2EOD A;  3RTR B;  1WEN A; 
#chains in the Genus database with same CATH topology
 1CHC A;  1LDK C;  5FER A;  2XOZ A;  2F6N A;  4AP4 A;  3PHD A;  4NN2 A;  5TDR A;  2KGG A;  3N9P A;  3O36 A;  2LXH C;  3T9K A;  4YAB A;  2YW8 A;  4AUQ B;  1K2F A;  5D1K B;  3N9N A;  2E6S A;  2IQJ A;  3LVQ E;  4R2Y A;  2KGI A;  1Z6U A;  4GND A;  3ZVY A;  5B75 A;  2YVR A;  3I2D A;  3SOU A;  2IDA A;  5B76 A;  2LN0 A;  2CON A;  1FBV A;  2VJF B;  4Q6F A;  3ZVZ B;  3H7H A;  2MNZ A;  5D1L B;  3MHH A;  2B0O E;  1WFK A;  3O7A A;  4N4F A;  2PNX A;  1WIL A;  2HDP A;  5AIT A;  1WEU A;  5SVX A;  5B79 A;  5LCW B;  5K3Q A;  5TAB A;  2NAA A;  2FSA A;  2DX8 A;  2CRR A;  2RSD A;  5G05 B;  4GB0 A;  2YUC A;  3DWD A;  3LDY A;  3N9L A;  5H1T A;  4O64 A;  2LQ6 A;  2JM3 A;  4YAT A;  2DSM A;  3FEH A;  1DVP A;  4P5O B;  2LGL A;  3FJU B;  2VPE A;  4A0C D;  4LJN A;  2VJE A;  4YBT A;  1VD4 A;  2LXP C;  2C2L A;  1XWH A;  5KH7 A;  2L7P A;  2L43 A;  2QJ0 A;  2KWJ A;  1VYX A;  2P57 A;  4AYC A;  2PUY A;  1JOC A;  2D8U A;  4C9Z A;  5LKT A;  2L0B A;  4IC2 A;  2FUI A;  5I3L A;  2RR4 A;  2KKY A;  4S3O C;  2EA6 A;  3ZPV E;  1V87 A;  2FFW A;  2ECJ A;  3E2D A;  3FAN A;  4ZDT A;  2VPB A;  2G45 A;  2VJF A;  3C6W A;  5TRB A;  1JM7 B;  4QQ4 A;  3SHB A;  3DQV R;  1RMD A;  4ZUX U;  2EXU A;  3EB5 A;  3V43 A;  3ZNI A;  2CKL B;  2YSM A;  5J3X A;  1WES A;  4YBM A;  2DJA A;  1HYI A;  4WZ3 B;  2AN6 A;  1BOR A;  2ECT A;  1F62 A;  5TBN A;  3N9O A;  2YHO A;  5FEY A;  3SOX A;  5D1M B;  3SUB A;  4FJC A;  1VFY A;  3LVR E;  1DCQ A;  2XEU A;  2ECG A;  5KH9 A;  3T7L A;  2KRE A;  2KWN A;  2KU3 A;  4UI9 B;  2VP7 A;  4WZ2 A;  1X4J A;  4I7B A;  2HYE D;  4L7X A;  3U5P A;  1WEO A;  2MIQ A;  3DDT A;  2YT5 A;  1T1H A;  2VPG A;  3KV6 A;  5FB0 A;  5LKU A;  4AVX A;  4YC9 A;  4PTB A;  2M1R A;  2M3H A;  2YHN A;  2CSV A;  5LKZ A;  1N87 A;  3KV5 A;  3EB6 A;  4B86 C;  1MM2 A;  5JG6 A;  3L11 A;  2F6J A;  3LRQ A;  3N9M A;  2I50 A;  1MBM A;  4V3K C;  2BAY A;  1WEV A;  5C11 A;  4YAX A;  2YU4 A;  4CA1 A;  3C5K A;  1ZBD B;  4UP5 A;  2E6R A;  2C2V S;  5DIN A;  4A4B A;  2G43 A;  2XP0 A;  2MA5 A;  5B77 A;  4OGC A;  3HTK C;  2ZET C;  3GV4 A;  2JUN A;  4WZ0 A;  2MA6 A;  5SVI A;  3PUR A;  2ECW A;  4MSX A;  4H9D A;  2MD8 C;  2CSY A;  2VNF A;  2K1J A;  2XOY A;  5B78 A;  2VPD A;  2FUU A;  3U5N A;  2UZG A;  5FB1 A;  2YRE A;  4LAD B;  2XB1 A;  4A49 A;  4N3W A;  3RPG B;  4X3G A;  4GNF A;  4BBQ A;  3M62 A;  2YQM A;  4A4C A;  5C13 A;  3QZV A;  3IHP A;  3PUQ A;  2CKL A;  3LQH A;  2ECV A;  4YAD A;  3FAO A;  4I7D A;  2ECN A;  3M7K A;  2H0D B;  5DKA A;  1WEQ A;  2K4D A;  5LKX A;  3KDE C;  2OWA A;  2FD4 A;  4I7C A;  3O70 A;  3O33 A;  2MUM A;  3RPG C;  1LDJ B;  4IC3 A;  1E4U A;  4BHW A;  4LLB A;  4LKA A;  4F52 B;  1X4I A;  3M99 A;  4UP0 A;  3ZYQ A;  3Q1D A;  3HCU A;  4MVT A;  4W4U A;  2RI7 A;  3ZTG A;  3LQJ A;  4QF3 A;  3O37 A;  1WGM A;  4Z0O A;  1IYM A;  2KWK A;  5H1V A;  2LAU A;  2M13 A;  4FIP A;  2YUR A;  1WIM A;  2JMJ A;  2MNY A;  4B7Y C;  3L1Z B;  2JMI A;  4FO9 A;  2EGP A;  4LK9 A;  5EYA F;  1WEW A;  2M6M A;  3ZPV 1;  2MKE A;  2LGG A;  4GNG A;  2D8S A;  1WEP A;  5B8D A;  2JMD A;  4O62 A;  3GL6 A;  4GNE A;  2H0D A;  1WE9 A;  3FL2 A;  2JRJ A;  4TKP B;  2KFT A;  2Y1N A;  3KQI A;  4CCG X;  2Y43 A;  3U5M A;  1JM7 A;  3HCT A;  3M63 A;  4WA6 A;  5H1U A;  4QF2 A;  2M85 A;  1Z60 A;  3MHS A;  3DPL R;  1HYJ A;  3T6R A;  2LRI C;  2L5U A;  2LDR A;  2YYR A;  4FK5 A;  2QIC A;  3ASL A;  1U6G B;  2LV9 A;  4F1P A;  2ECI A;  4R8P K;  2QIZ A;  2LGV A;  2MD7 B;  3U5O A;  2LGK A;  3MDB C;  2XOC A;  2L80 A;  5AIU A;  2Y1M A;  4OGE A;  4R7E A;  5H9M A;  3KNV A;  3L1X A;  3O34 A;  2VJE B;  3PLW A;  2K16 A;  2MT5 A;  3VK6 A;  5KH3 A;  3NG2 A;  1FP0 A;  2KR4 A;  2G6Q A;  5SVY A;  1Z2Q A;  2OXQ C;  2F42 A;  3HCS A;  1WEE A;  3O47 A;  2CT2 A;  1WEM A;  2KYU A;  5TDW A;  1MM3 A;  3SOW A;  2K17 A;  5G04 B;  3LJU X;  2E61 A;  3JUE A;  4YBS A;  3N9Q A;  2YSJ A;  4V3L C;  1X4U A;  4XI1 A;  4Z0R A;  4AYC B;  2KWO A;  4S3O B;  5G0F A;  5SVI B;  1G25 A;  2KKX A;  2KE1 A;  3O35 A;  3FM8 C;  4PPE A;  4ZQL A;  2KIZ A;  2YQL A;  4L58 A;  2L75 A;  2EGM A;  3LQI A;  2CRW A;  2CSZ A;  2EOD A;  3RTR B;  1WEN A; 
#chains in the Genus database with same CATH homology
 1CHC A;  1LDK C;  5FER A;  2F6N A;  4AP4 A;  3PHD A;  4NN2 A;  5TDR A;  2KGG A;  3N9P A;  3O36 A;  2LXH C;  4YAB A;  2YW8 A;  4AUQ B;  1K2F A;  5D1K B;  3N9N A;  2E6S A;  4R2Y A;  2KGI A;  1Z6U A;  4GND A;  3ZVY A;  5B75 A;  3I2D A;  3SOU A;  2IDA A;  5B76 A;  2LN0 A;  1FBV A;  2VJF B;  4Q6F A;  3ZVZ B;  2MNZ A;  5D1L B;  3MHH A;  1WFK A;  3O7A A;  4N4F A;  2PNX A;  1WIL A;  2HDP A;  5AIT A;  1WEU A;  5B79 A;  5LCW B;  5TAB A;  2NAA A;  2FSA A;  2DX8 A;  2RSD A;  5G05 B;  4GB0 A;  2YUC A;  3N9L A;  5H1T A;  4O64 A;  2LQ6 A;  4YAT A;  1DVP A;  4P5O B;  2LGL A;  2VPE A;  4A0C D;  4LJN A;  2VJE A;  4YBT A;  1VD4 A;  2LXP C;  2C2L A;  1XWH A;  5KH7 A;  2L43 A;  2QJ0 A;  2KWJ A;  1VYX A;  4AYC A;  2PUY A;  1JOC A;  4C9Z A;  5LKT A;  2L0B A;  4IC2 A;  2FUI A;  5I3L A;  4S3O C;  2EA6 A;  3ZPV E;  1V87 A;  2ECJ A;  4ZDT A;  2VPB A;  2G45 A;  2VJF A;  3C6W A;  5TRB A;  1JM7 B;  3SHB A;  4ZUX U;  3DQV R;  1RMD A;  3EB5 A;  3V43 A;  3ZNI A;  2CKL B;  2YSM A;  5J3X A;  1WES A;  4YBM A;  1HYI A;  4WZ3 B;  2AN6 A;  1BOR A;  2ECT A;  1F62 A;  5TBN A;  3N9O A;  2YHO A;  5FEY A;  3SOX A;  5D1M B;  4FJC A;  1VFY A;  2XEU A;  2ECG A;  5KH9 A;  3T7L A;  2KRE A;  2KWN A;  2KU3 A;  4UI9 B;  2VP7 A;  4WZ2 A;  1X4J A;  4I7B A;  2HYE D;  4L7X A;  3U5P A;  1WEO A;  2MIQ A;  2YT5 A;  1T1H A;  2VPG A;  3KV6 A;  5FB0 A;  5LKU A;  4AVX A;  4YC9 A;  4PTB A;  2M1R A;  2M3H A;  2YHN A;  5LKZ A;  1N87 A;  3KV5 A;  3EB6 A;  4B86 C;  1MM2 A;  5JG6 A;  3L11 A;  2F6J A;  3LRQ A;  3N9M A;  2I50 A;  4V3K C;  2BAY A;  1WEV A;  5C11 A;  4YAX A;  2YU4 A;  4CA1 A;  3C5K A;  1ZBD B;  4UP5 A;  2E6R A;  2C2V S;  5DIN A;  4A4B A;  2G43 A;  2MA5 A;  5B77 A;  3HTK C;  2ZET C;  3GV4 A;  4WZ0 A;  2MA6 A;  3PUR A;  2ECW A;  4MSX A;  2MD8 C;  2CSY A;  2VNF A;  2K1J A;  5B78 A;  2VPD A;  2FUU A;  3U5N A;  2UZG A;  5FB1 A;  2YRE A;  4LAD B;  2XB1 A;  4A49 A;  4N3W A;  3RPG B;  4X3G A;  4GNF A;  4BBQ A;  3M62 A;  2YQM A;  4A4C A;  5C13 A;  3QZV A;  3IHP A;  3PUQ A;  2CKL A;  3LQH A;  2ECV A;  4YAD A;  4I7D A;  2ECN A;  2H0D B;  5DKA A;  1WEQ A;  2K4D A;  5LKX A;  4I7C A;  3O70 A;  3O33 A;  2MUM A;  3RPG C;  1LDJ B;  4IC3 A;  1E4U A;  4BHW A;  4LLB A;  4LKA A;  4F52 B;  1X4I A;  3M99 A;  4UP0 A;  3ZYQ A;  3HCU A;  4MVT A;  4W4U A;  2RI7 A;  3ZTG A;  3LQJ A;  4QF3 A;  3O37 A;  1WGM A;  1IYM A;  2KWK A;  5H1V A;  4FIP A;  2YUR A;  1WIM A;  2JMJ A;  2MNY A;  4B7Y C;  3L1Z B;  2JMI A;  4FO9 A;  2EGP A;  4LK9 A;  5EYA F;  1WEW A;  2M6M A;  3ZPV 1;  2LGG A;  4GNG A;  2D8S A;  1WEP A;  5B8D A;  2JMD A;  3GL6 A;  4GNE A;  2H0D A;  1WE9 A;  3FL2 A;  2JRJ A;  4TKP B;  2KFT A;  2Y1N A;  3KQI A;  4CCG X;  2Y43 A;  3U5M A;  1JM7 A;  3HCT A;  3M63 A;  4WA6 A;  5H1U A;  4QF2 A;  2M85 A;  1Z60 A;  3MHS A;  3DPL R;  1HYJ A;  3T6R A;  2LRI C;  2L5U A;  2LDR A;  2YYR A;  4FK5 A;  2QIC A;  3ASL A;  1U6G B;  2LV9 A;  2ECI A;  4R8P K;  2QIZ A;  2LGV A;  2MD7 B;  3U5O A;  2LGK A;  2L80 A;  5AIU A;  2Y1M A;  5H9M A;  4R7E A;  3KNV A;  3L1X A;  3O34 A;  2VJE B;  2K16 A;  2MT5 A;  3VK6 A;  5KH3 A;  3NG2 A;  1FP0 A;  2KR4 A;  2G6Q A;  1Z2Q A;  2OXQ C;  2F42 A;  3HCS A;  1WEE A;  2CT2 A;  1WEM A;  2KYU A;  5TDW A;  1MM3 A;  3SOW A;  2K17 A;  5G04 B;  4YBS A;  3N9Q A;  2YSJ A;  4V3L C;  1X4U A;  4XI1 A;  4AYC B;  2KWO A;  4S3O B;  5G0F A;  1G25 A;  2KE1 A;  3O35 A;  4PPE A;  4ZQL A;  2KIZ A;  2YQL A;  4L58 A;  2L75 A;  3LQI A;  2CSZ A;  2EOD A;  3RTR B;  1WEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...