3ASLA

Structure of uhrf1 in complex with histone tail
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 10
structure length 68
sequence length 68
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3aslA00
3ZTGA 4IC2A 2YHOA 2CKLB 5H1TA 3N9OA 4N4FA 3N9NA 4MVTA 4WA6A 4YBMA 5B76A 2Y1NA 2M1RA 2M85A 1WEEA 2LXPC 2IDAA 5DINA 4L58A 3M99A 2C2VS 2MT5A 5AIUA 2KREA 5D1MB 2UZGA 4BHWA 2L80A 5G0FA 2PUYA 1U6GB 2YHNA 2ECTA 2YURA 3DQVR 1VFYA 5DKAA 1CHCA 2MD8C 4QF2A 2E6SA 3V43A 1Z2QA 1HYIA 4FJCA 1WEVA 5C11A 4V3KC 2MNZA 1N87A 2LRIC 4B7YC 5FB0A 4P5OB 3HCTA 4LK9A 2JRJA 2F6JA 2F6NA 2BAYA 4A49A 5B75A 3VK6A 4GNGA 5H9MA 2VPGA 5G05B 4GNFA 4YBTA 3O34A 3O35A 4ZUXU 4X3GA 2LQ6A 2C2LA 4FO9A 3O36A 5B78A 2XEUA 2M6MA 3MHHA 4PPEA 1V87A 2CSZA 1XWHA 1BORA 2L5UA 2LV9A 3HCSA 2VP7A 2F42A 2MD7B 2VJFA 3O70A 2KGGA 1FP0A 5FB1A 2EGPA 2LGLA 5KH7A 1WIMA 2K17A 2CT2A 3KNVA 3U5MA 1WESA 1JOCA 1WE9A 2YW8A 1WEPA 5FERA 2RSDA 2KYUA 2Y1MA 2DX8A 3RPGC 4AVXA 4FK5A 1G25A 2MA6A 4IC3A 4A4BA 3SOWA 2Y43A 2YU4A 4R7EA 3SOXA 2YSJA 3O33A 2ECIA 4LLBA 1IYMA 3EB5A 2HDPA 3MHSA 5B79A 4I7CA 3IHPA 2ZETC 4CCGX 1HYJA 1MM2A 4C9ZA 5D1KB 3L1ZB 2VPDA 3L11A 4N3WA 2FSAA 1JM7A 2HYED 4GB0A 2ECJA 1LDKC 3T7LA 4YADA 2NAAA 3SHBA 2LDRA 4A4CA 3ZVYA 3O37A 2E6RA 2YQMA 4YABA 4S3OB 2KWNA 4A0CD 4GNDA 5C13A 2MA5A 2ECGA 2ECVA 2G6QA 4R2YA 1X4JA 5FEYA 3ZNIA 4WZ2A 4O64A 2FUIA 4BBQA 2QJ0A 4AUQB 2CSYA 3KV5A 2JMIA 1FBVA 2AN6A 3LRQA 5J3XA 2KWKA 4LJNA 3ASLA 2JMJA 3LQHA 5I3LA 3I2DA 3RPGB 3GV4A 3C5KA 3ZVZB 2RI7A 3NG2A 3DPLR 2K16A 2K1JA 4AYCA 3N9LA 2H0DA 2L75A 5AITA 3ZPVE 3KQIA 3ZPV1 1WGMA 2G45A 1K2FA 1WEOA 1LDJB 2XB1A 4WZ0A 4F52B 3ZYQA 5B77A 2L0BA 2ECNA 4R8PK 1RMDA 4I7DA 4L7XA 2YQLA 2FUUA 3GL6A 4TKPB 4LADB 1DVPA 3N9PA 2CKLA 3U5PA 1VYXA 2LGKA 3T6RA 2M3HA 3O7AA 4AP4A 3FL2A 2VNFA 4ZDTA 1WEQA 2H0DB 4YC9A 2D8SA 2VJEA 5G04B 5LKTA 4B86C 3U5OA 4I7BA 5KH3A 2KR4A 1F62A 2EA6A 2VJFB 4PTBA 4CA1A 5EYAF 2KWJA 2KE1A 4UP0A 4GNEA 2MNYA 2MUMA 2YSMA 2VPEA 5H1VA 4QF3A 2LXHC 4MSXA 2KGIA 2I50A 3PUQA 4W4UA 2KFTA 3C6WA 3L1XA 2K4DA 2KWOA 2VJEB 3U5NA 2YYRA 1T1HA 2YUCA 3HTKC 5TRBA 2LGGA 4V3LC 2L43A 3LQJA 2G43A 3SOUA 3HCUA 2JMDA 2LN0A 1WEWA 1JM7B 1WEUA 3RTRB 4UI9B 4ZQLA 1WENA 3PHDA 4YAXA 1Z60A 2LGVA 3KV6A 5TABA 1VD4A 2PNXA 2YT5A 3N9QA 4UP5A 4FIPA 1MM3A 1WILA 3M62A 4LKAA 5LCWB 3N9MA 5LKUA 2QICA 5D1LB 4YBSA 1X4IA 4XI1A 4YATA 4S3OC 1X4UA 4Q6FA 2YREA 5B8DA 3LQIA 5TDRA 2EODA 5LKZA 1E4UA 5JG6A 4AYCB 2KU3A 2MIQA 5KH9A 2OXQC 3QZVA 5TDWA 1ZBDB 5LKXA 1WFKA 2VPBA 2KIZA 3EB6A 3M63A 5H1UA 5TBNA 1WEMA 2QIZA 1Z6UA 4WZ3B 2ECWA 4NN2A 3PURA
chains in the Genus database with same CATH superfamily
3ZTGA 4IC2A 2YHOA 2CKLB 5H1TA 3N9OA 4N4FA 3N9NA 4MVTA 4WA6A 4YBMA 5B76A 2Y1NA 2CSVA 2M1RA 2M85A 1WEEA 2LXPC 2IDAA 5DINA 4L58A 2FD4A 3M99A 2IQJA 2C2VS 2MT5A 5AIUA 2KREA 5D1MB 2YVRA 5K3QA 2UZGA 4BHWA 2L80A 5G0FA 2PUYA 2RR4A 1U6GB 2YHNA 2ECTA 2M13A 2YURA 3DQVR 1VFYA 5DKAA 1CHCA 2MD8C 4QF2A 2E6SA 3V43A 1Z2QA 1HYIA 4FJCA 1WEVA 5C11A 4V3KC 2MNZA 1N87A 2LRIC 4O62A 4B7YC 5FB0A 4P5OB 3HCTA 4LK9A 2JRJA 2F6JA 3H7HA 2F6NA 2BAYA 4A49A 5B75A 3VK6A 4GNGA 5H9MA 2VPGA 5G05B 4GNFA 5SVYA 4YBTA 3O34A 3O35A 2XOCA 4ZUXU 2LQ6A 4X3GA 2C2LA 4FO9A 3O36A 5B78A 2XOZA 2XEUA 2M6MA 3MHHA 4PPEA 2E61A 1V87A 2CSZA 1XWHA 1BORA 2L5UA 2LV9A 5SVIA 3DWDA 3HCSA 2XP0A 2VP7A 2F42A 2MD7B 2VJFA 3O70A 2KGGA 1FP0A 5FB1A 2EGPA 2LGLA 5KH7A 1WIMA 2K17A 2CRRA 2CT2A 3KNVA 3U5MA 1WESA 1JOCA 1WE9A 2YW8A 1WEPA 5FERA 2RSDA 2KYUA 3MDBC 2Y1MA 2DX8A 3RPGC 3FAOA 4AVXA 4FK5A 1G25A 2MA6A 4IC3A 4A4BA 3SOWA 2Y43A 2YU4A 4R7EA 3SOXA 2MKEA 2YSJA 2KKYA 3O33A 2ECIA 2L7PA 4LLBA 1IYMA 2XOYA 3EB5A 2HDPA 3MHSA 5B79A 3Q1DA 4I7CA 3IHPA 2ZETC 4CCGX 1HYJA 1MM2A 4C9ZA 2B0OE 5D1KB 3L1ZB 2VPDA 2CRWA 3L11A 4N3WA 2FSAA 3DDTA 1JM7A 2HYED 4GB0A 2ECJA 1LDKC 3T7LA 4YADA 2NAAA 3SHBA 2LDRA 4A4CA 3ZVYA 3O37A 2E6RA 2YQMA 4YABA 4S3OB 2KWNA 4A0CD 4GNDA 5C13A 2MA5A 3FJUB 2ECGA 2ECVA 2G6QA 4R2YA 1X4JA 5FEYA 4Z0RA 3ZNIA 4WZ2A 4Z0OA 4O64A 2FUIA 2DSMA 4BBQA 2QJ0A 4AUQB 2CSYA 3KV5A 2KKXA 2JMIA 2D8UA 1FBVA 2AN6A 3LRQA 5J3XA 2KWKA 4LJNA 3JUEA 2JM3A 3ASLA 2JMJA 3FEHA 3LQHA 5I3LA 3I2DA 4F1PA 3GV4A 3RPGB 3C5KA 3ZVZB 2RI7A 3E2DA 3DPLR 3NG2A 2K16A 2K1JA 4AYCA 3N9LA 3FANA 2H0DA 2L75A 5AITA 3ZPVE 3KQIA 3ZPV1 1WGMA 2G45A 1K2FA 2P57A 1WEOA 1LDJB 2EXUA 2XB1A 4WZ0A 3LVRE 4F52B 3ZYQA 5B77A 2L0BA 2ECNA 4R8PK 2OWAA 1RMDA 4I7DA 3PLWA 4L7XA 5SVXA 2LAUA 2YQLA 4H9DA 2FUUA 3GL6A 4TKPB 4LADB 1DVPA 3N9PA 2CKLA 3KDEC 3U5PA 1VYXA 2LGKA 3T6RA 2M3HA 3O7AA 4AP4A 3FL2A 2VNFA 4ZDTA 1WEQA 2H0DB 2CONA 4YC9A 2D8SA 2VJEA 5G04B 5LKTA 4B86C 3U5OA 4I7BA 5SVIB 5KH3A 2KR4A 1F62A 2EA6A 2VJFB 4PTBA 4CA1A 5EYAF 2KWJA 2KE1A 4UP0A 4GNEA 2MNYA 3M7KA 2MUMA 2YSMA 2VPEA 5H1VA 4QF3A 2LXHC 4MSXA 2KGIA 2I50A 1MBMA 3PUQA 4W4UA 2KFTA 3C6WA 3L1XA 2K4DA 2KWOA 2VJEB 3U5NA 2YYRA 1T1HA 2YUCA 2FFWA 1DCQA 3HTKC 5TRBA 2LGGA 4V3LC 2L43A 3FM8C 3LQJA 2G43A 3SOUA 3HCUA 2JMDA 2LN0A 1WEWA 1JM7B 1WEUA 4OGCA 3RTRB 4UI9B 4ZQLA 1WENA 3PHDA 4YAXA 1Z60A 2LGVA 3KV6A 5TABA 1VD4A 2PNXA 2YT5A 3N9QA 4UP5A 4FIPA 3T9KA 1MM3A 1WILA 3M62A 4LKAA 5LCWB 3N9MA 5LKUA 2QICA 5D1LB 4YBSA 1X4IA 4XI1A 4YATA 4S3OC 3O47A 3LJUX 1X4UA 2JUNA 4Q6FA 2YREA 5B8DA 3LQIA 5TDRA 2EODA 5LKZA 1E4UA 5JG6A 3LVQE 4AYCB 2KU3A 2MIQA 5KH9A 2OXQC 3QZVA 4QQ4A 2DJAA 5TDWA 2EGMA 1ZBDB 5LKXA 3LDYA 1WFKA 2VPBA 2KIZA 3EB6A 3M63A 5H1UA 4OGEA 5TBNA 1WEMA 3SUBA 2QIZA 1Z6UA 4WZ3B 2ECWA 4NN2A 3PURA
chains in the Genus database with same CATH topology
3ZTGA 4IC2A 2YHOA 2CKLB 5H1TA 3N9OA 4N4FA 3N9NA 4MVTA 4WA6A 4YBMA 5B76A 2Y1NA 2M1RA 2M85A 1WEEA 2LXPC 2IDAA 5DINA 4L58A 3M99A 2C2VS 2MT5A 5AIUA 2KREA 5D1MB 2UZGA 4BHWA 2L80A 5G0FA 2PUYA 1U6GB 2YHNA 2ECTA 2YURA 3DQVR 1VFYA 5DKAA 1CHCA 2MD8C 4QF2A 2E6SA 3V43A 1Z2QA 1HYIA 4FJCA 1WEVA 5C11A 4V3KC 2MNZA 1N87A 2LRIC 4B7YC 5FB0A 4P5OB 3HCTA 4LK9A 2JRJA 2F6JA 2F6NA 2BAYA 4A49A 5B75A 3VK6A 4GNGA 5H9MA 2VPGA 5G05B 4GNFA 4YBTA 3O34A 3O35A 4ZUXU 4X3GA 2LQ6A 2C2LA 4FO9A 3O36A 5B78A 2XEUA 2M6MA 3MHHA 4PPEA 1V87A 2CSZA 1XWHA 1BORA 2L5UA 2LV9A 3HCSA 2VP7A 2F42A 2MD7B 2VJFA 3O70A 2KGGA 1FP0A 5FB1A 2EGPA 2LGLA 5KH7A 1WIMA 2K17A 2CT2A 3KNVA 3U5MA 1WESA 1JOCA 1WE9A 2YW8A 1WEPA 5FERA 2RSDA 2KYUA 2Y1MA 2DX8A 3RPGC 4AVXA 4FK5A 1G25A 2MA6A 4IC3A 4A4BA 3SOWA 2Y43A 2YU4A 4R7EA 3SOXA 2YSJA 3O33A 2ECIA 4LLBA 1IYMA 3EB5A 2HDPA 3MHSA 5B79A 4I7CA 3IHPA 2ZETC 4CCGX 1HYJA 1MM2A 4C9ZA 5D1KB 3L1ZB 2VPDA 3L11A 4N3WA 2FSAA 1JM7A 2HYED 4GB0A 2ECJA 1LDKC 3T7LA 4YADA 2NAAA 3SHBA 2LDRA 4A4CA 3ZVYA 3O37A 2E6RA 2YQMA 4YABA 4S3OB 2KWNA 4A0CD 4GNDA 5C13A 2MA5A 2ECGA 2ECVA 2G6QA 4R2YA 1X4JA 5FEYA 3ZNIA 4WZ2A 4O64A 2FUIA 4BBQA 2QJ0A 4AUQB 2CSYA 3KV5A 2JMIA 1FBVA 2AN6A 3LRQA 5J3XA 2KWKA 4LJNA 3ASLA 2JMJA 3LQHA 5I3LA 3I2DA 3RPGB 3GV4A 3C5KA 3ZVZB 2RI7A 3NG2A 3DPLR 2K16A 2K1JA 4AYCA 3N9LA 2H0DA 2L75A 5AITA 3ZPVE 3KQIA 3ZPV1 1WGMA 2G45A 1K2FA 1WEOA 1LDJB 2XB1A 4WZ0A 4F52B 3ZYQA 5B77A 2L0BA 2ECNA 4R8PK 1RMDA 4I7DA 4L7XA 2YQLA 2FUUA 3GL6A 4TKPB 4LADB 1DVPA 3N9PA 2CKLA 3U5PA 1VYXA 2LGKA 3T6RA 2M3HA 3O7AA 4AP4A 3FL2A 2VNFA 4ZDTA 1WEQA 2H0DB 4YC9A 2D8SA 2VJEA 5G04B 5LKTA 4B86C 3U5OA 4I7BA 5KH3A 2KR4A 1F62A 2EA6A 2VJFB 4PTBA 4CA1A 5EYAF 2KWJA 2KE1A 4UP0A 4GNEA 2MNYA 2MUMA 2YSMA 2VPEA 5H1VA 4QF3A 2LXHC 4MSXA 2KGIA 2I50A 3PUQA 4W4UA 2KFTA 3C6WA 3L1XA 2K4DA 2KWOA 2VJEB 3U5NA 2YYRA 1T1HA 2YUCA 3HTKC 5TRBA 2LGGA 4V3LC 2L43A 3LQJA 2G43A 3SOUA 3HCUA 2JMDA 2LN0A 1WEWA 1JM7B 1WEUA 3RTRB 4UI9B 4ZQLA 1WENA 3PHDA 4YAXA 1Z60A 2LGVA 3KV6A 5TABA 1VD4A 2PNXA 2YT5A 3N9QA 4UP5A 4FIPA 1MM3A 1WILA 3M62A 4LKAA 5LCWB 3N9MA 5LKUA 2QICA 5D1LB 4YBSA 1X4IA 4XI1A 4YATA 4S3OC 1X4UA 4Q6FA 2YREA 5B8DA 3LQIA 5TDRA 2EODA 5LKZA 1E4UA 5JG6A 4AYCB 2KU3A 2MIQA 5KH9A 2OXQC 3QZVA 5TDWA 1ZBDB 5LKXA 1WFKA 2VPBA 2KIZA 3EB6A 3M63A 5H1UA 5TBNA 1WEMA 2QIZA 1Z6UA 4WZ3B 2ECWA 4NN2A 3PURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTG A;  4IC2 A;  2YHO A;  2CKL B;  5H1T A;  3N9O A;  4N4F A;  3N9N A;  4MVT A;  4WA6 A;  4YBM A;  5B76 A;  2Y1N A;  2M1R A;  2M85 A;  1WEE A;  2LXP C;  2IDA A;  5DIN A;  4L58 A;  3M99 A;  2C2V S;  2MT5 A;  5AIU A;  2KRE A;  5D1M B;  2UZG A;  4BHW A;  2L80 A;  5G0F A;  2PUY A;  1U6G B;  2YHN A;  2ECT A;  2YUR A;  3DQV R;  1VFY A;  5DKA A;  1CHC A;  2MD8 C;  4QF2 A;  2E6S A;  3V43 A;  1Z2Q A;  1HYI A;  4FJC A;  1WEV A;  5C11 A;  4V3K C;  2MNZ A;  1N87 A;  2LRI C;  4B7Y C;  5FB0 A;  4P5O B;  3HCT A;  4LK9 A;  2JRJ A;  2F6J A;  2F6N A;  2BAY A;  4A49 A;  5B75 A;  3VK6 A;  4GNG A;  5H9M A;  2VPG A;  5G05 B;  4GNF A;  4YBT A;  3O34 A;  3O35 A;  4ZUX U;  4X3G A;  2LQ6 A;  2C2L A;  4FO9 A;  3O36 A;  5B78 A;  2XEU A;  2M6M A;  3MHH A;  4PPE A;  1V87 A;  2CSZ A;  1XWH A;  1BOR A;  2L5U A;  2LV9 A;  3HCS A;  2VP7 A;  2F42 A;  2MD7 B;  2VJF A;  3O70 A;  2KGG A;  1FP0 A;  5FB1 A;  2EGP A;  2LGL A;  5KH7 A;  1WIM A;  2K17 A;  2CT2 A;  3KNV A;  3U5M A;  1WES A;  1JOC A;  1WE9 A;  2YW8 A;  1WEP A;  5FER A;  2RSD A;  2KYU A;  2Y1M A;  2DX8 A;  3RPG C;  4AVX A;  4FK5 A;  1G25 A;  2MA6 A;  4IC3 A;  4A4B A;  3SOW A;  2Y43 A;  2YU4 A;  4R7E A;  3SOX A;  2YSJ A;  3O33 A;  2ECI A;  4LLB A;  1IYM A;  3EB5 A;  2HDP A;  3MHS A;  5B79 A;  4I7C A;  3IHP A;  2ZET C;  4CCG X;  1HYJ A;  1MM2 A;  4C9Z A;  5D1K B;  3L1Z B;  2VPD A;  3L11 A;  4N3W A;  2FSA A;  1JM7 A;  2HYE D;  4GB0 A;  2ECJ A;  1LDK C;  3T7L A;  4YAD A;  2NAA A;  3SHB A;  2LDR A;  4A4C A;  3ZVY A;  3O37 A;  2E6R A;  2YQM A;  4YAB A;  4S3O B;  2KWN A;  4A0C D;  4GND A;  5C13 A;  2MA5 A;  2ECG A;  2ECV A;  2G6Q A;  4R2Y A;  1X4J A;  5FEY A;  3ZNI A;  4WZ2 A;  4O64 A;  2FUI A;  4BBQ A;  2QJ0 A;  4AUQ B;  2CSY A;  3KV5 A;  2JMI A;  1FBV A;  2AN6 A;  3LRQ A;  5J3X A;  2KWK A;  4LJN A;  3ASL A;  2JMJ A;  3LQH A;  5I3L A;  3I2D A;  3RPG B;  3GV4 A;  3C5K A;  3ZVZ B;  2RI7 A;  3NG2 A;  3DPL R;  2K16 A;  2K1J A;  4AYC A;  3N9L A;  2H0D A;  2L75 A;  5AIT A;  3ZPV E;  3KQI A;  3ZPV 1;  1WGM A;  2G45 A;  1K2F A;  1WEO A;  1LDJ B;  2XB1 A;  4WZ0 A;  4F52 B;  3ZYQ A;  5B77 A;  2L0B A;  2ECN A;  4R8P K;  1RMD A;  4I7D A;  4L7X A;  2YQL A;  2FUU A;  3GL6 A;  4TKP B;  4LAD B;  1DVP A;  3N9P A;  2CKL A;  3U5P A;  1VYX A;  2LGK A;  3T6R A;  2M3H A;  3O7A A;  4AP4 A;  3FL2 A;  2VNF A;  4ZDT A;  1WEQ A;  2H0D B;  4YC9 A;  2D8S A;  2VJE A;  5G04 B;  5LKT A;  4B86 C;  3U5O A;  4I7B A;  5KH3 A;  2KR4 A;  1F62 A;  2EA6 A;  2VJF B;  4PTB A;  4CA1 A;  5EYA F;  2KWJ A;  2KE1 A;  4UP0 A;  4GNE A;  2MNY A;  2MUM A;  2YSM A;  2VPE A;  5H1V A;  4QF3 A;  2LXH C;  4MSX A;  2KGI A;  2I50 A;  3PUQ A;  4W4U A;  2KFT A;  3C6W A;  3L1X A;  2K4D A;  2KWO A;  2VJE B;  3U5N A;  2YYR A;  1T1H A;  2YUC A;  3HTK C;  5TRB A;  2LGG A;  4V3L C;  2L43 A;  3LQJ A;  2G43 A;  3SOU A;  3HCU A;  2JMD A;  2LN0 A;  1WEW A;  1JM7 B;  1WEU A;  3RTR B;  4UI9 B;  4ZQL A;  1WEN A;  3PHD A;  4YAX A;  1Z60 A;  2LGV A;  3KV6 A;  5TAB A;  1VD4 A;  2PNX A;  2YT5 A;  3N9Q A;  4UP5 A;  4FIP A;  1MM3 A;  1WIL A;  3M62 A;  4LKA A;  5LCW B;  3N9M A;  5LKU A;  2QIC A;  5D1L B;  4YBS A;  1X4I A;  4XI1 A;  4YAT A;  4S3O C;  1X4U A;  4Q6F A;  2YRE A;  5B8D A;  3LQI A;  5TDR A;  2EOD A;  5LKZ A;  1E4U A;  5JG6 A;  4AYC B;  2KU3 A;  2MIQ A;  5KH9 A;  2OXQ C;  3QZV A;  5TDW A;  1ZBD B;  5LKX A;  1WFK A;  2VPB A;  2KIZ A;  3EB6 A;  3M63 A;  5H1U A;  5TBN A;  1WEM A;  2QIZ A;  1Z6U A;  4WZ3 B;  2ECW A;  4NN2 A;  3PUR A; 
#chains in the Genus database with same CATH topology
 3ZTG A;  4IC2 A;  2YHO A;  2CKL B;  5H1T A;  3N9O A;  4N4F A;  3N9N A;  4MVT A;  4WA6 A;  4YBM A;  5B76 A;  2Y1N A;  2CSV A;  2M1R A;  2M85 A;  1WEE A;  2LXP C;  2IDA A;  5DIN A;  4L58 A;  2FD4 A;  3M99 A;  2IQJ A;  2C2V S;  2MT5 A;  5AIU A;  2KRE A;  5D1M B;  2YVR A;  5K3Q A;  2UZG A;  4BHW A;  2L80 A;  5G0F A;  2PUY A;  2RR4 A;  1U6G B;  2YHN A;  2ECT A;  2M13 A;  2YUR A;  3DQV R;  1VFY A;  5DKA A;  1CHC A;  2MD8 C;  4QF2 A;  2E6S A;  3V43 A;  1Z2Q A;  1HYI A;  4FJC A;  1WEV A;  5C11 A;  4V3K C;  2MNZ A;  1N87 A;  2LRI C;  4O62 A;  4B7Y C;  5FB0 A;  4P5O B;  3HCT A;  4LK9 A;  2JRJ A;  2F6J A;  3H7H A;  2F6N A;  2BAY A;  4A49 A;  5B75 A;  3VK6 A;  4GNG A;  5H9M A;  2VPG A;  5G05 B;  4GNF A;  5SVY A;  4YBT A;  3O34 A;  3O35 A;  2XOC A;  4ZUX U;  2LQ6 A;  4X3G A;  2C2L A;  4FO9 A;  3O36 A;  5B78 A;  2XOZ A;  2XEU A;  2M6M A;  3MHH A;  4PPE A;  2E61 A;  1V87 A;  2CSZ A;  1XWH A;  1BOR A;  2L5U A;  2LV9 A;  5SVI A;  3DWD A;  3HCS A;  2XP0 A;  2VP7 A;  2F42 A;  2MD7 B;  2VJF A;  3O70 A;  2KGG A;  1FP0 A;  5FB1 A;  2EGP A;  2LGL A;  5KH7 A;  1WIM A;  2K17 A;  2CRR A;  2CT2 A;  3KNV A;  3U5M A;  1WES A;  1JOC A;  1WE9 A;  2YW8 A;  1WEP A;  5FER A;  2RSD A;  2KYU A;  3MDB C;  2Y1M A;  2DX8 A;  3RPG C;  3FAO A;  4AVX A;  4FK5 A;  1G25 A;  2MA6 A;  4IC3 A;  4A4B A;  3SOW A;  2Y43 A;  2YU4 A;  4R7E A;  3SOX A;  2MKE A;  2YSJ A;  2KKY A;  3O33 A;  2ECI A;  2L7P A;  4LLB A;  1IYM A;  2XOY A;  3EB5 A;  2HDP A;  3MHS A;  5B79 A;  3Q1D A;  4I7C A;  3IHP A;  2ZET C;  4CCG X;  1HYJ A;  1MM2 A;  4C9Z A;  2B0O E;  5D1K B;  3L1Z B;  2VPD A;  2CRW A;  3L11 A;  4N3W A;  2FSA A;  3DDT A;  1JM7 A;  2HYE D;  4GB0 A;  2ECJ A;  1LDK C;  3T7L A;  4YAD A;  2NAA A;  3SHB A;  2LDR A;  4A4C A;  3ZVY A;  3O37 A;  2E6R A;  2YQM A;  4YAB A;  4S3O B;  2KWN A;  4A0C D;  4GND A;  5C13 A;  2MA5 A;  3FJU B;  2ECG A;  2ECV A;  2G6Q A;  4R2Y A;  1X4J A;  5FEY A;  4Z0R A;  3ZNI A;  4WZ2 A;  4Z0O A;  4O64 A;  2FUI A;  2DSM A;  4BBQ A;  2QJ0 A;  4AUQ B;  2CSY A;  3KV5 A;  2KKX A;  2JMI A;  2D8U A;  1FBV A;  2AN6 A;  3LRQ A;  5J3X A;  2KWK A;  4LJN A;  3JUE A;  2JM3 A;  3ASL A;  2JMJ A;  3FEH A;  3LQH A;  5I3L A;  3I2D A;  4F1P A;  3GV4 A;  3RPG B;  3C5K A;  3ZVZ B;  2RI7 A;  3E2D A;  3DPL R;  3NG2 A;  2K16 A;  2K1J A;  4AYC A;  3N9L A;  3FAN A;  2H0D A;  2L75 A;  5AIT A;  3ZPV E;  3KQI A;  3ZPV 1;  1WGM A;  2G45 A;  1K2F A;  2P57 A;  1WEO A;  1LDJ B;  2EXU A;  2XB1 A;  4WZ0 A;  3LVR E;  4F52 B;  3ZYQ A;  5B77 A;  2L0B A;  2ECN A;  4R8P K;  2OWA A;  1RMD A;  4I7D A;  3PLW A;  4L7X A;  5SVX A;  2LAU A;  2YQL A;  4H9D A;  2FUU A;  3GL6 A;  4TKP B;  4LAD B;  1DVP A;  3N9P A;  2CKL A;  3KDE C;  3U5P A;  1VYX A;  2LGK A;  3T6R A;  2M3H A;  3O7A A;  4AP4 A;  3FL2 A;  2VNF A;  4ZDT A;  1WEQ A;  2H0D B;  2CON A;  4YC9 A;  2D8S A;  2VJE A;  5G04 B;  5LKT A;  4B86 C;  3U5O A;  4I7B A;  5SVI B;  5KH3 A;  2KR4 A;  1F62 A;  2EA6 A;  2VJF B;  4PTB A;  4CA1 A;  5EYA F;  2KWJ A;  2KE1 A;  4UP0 A;  4GNE A;  2MNY A;  3M7K A;  2MUM A;  2YSM A;  2VPE A;  5H1V A;  4QF3 A;  2LXH C;  4MSX A;  2KGI A;  2I50 A;  1MBM A;  3PUQ A;  4W4U A;  2KFT A;  3C6W A;  3L1X A;  2K4D A;  2KWO A;  2VJE B;  3U5N A;  2YYR A;  1T1H A;  2YUC A;  2FFW A;  1DCQ A;  3HTK C;  5TRB A;  2LGG A;  4V3L C;  2L43 A;  3FM8 C;  3LQJ A;  2G43 A;  3SOU A;  3HCU A;  2JMD A;  2LN0 A;  1WEW A;  1JM7 B;  1WEU A;  4OGC A;  3RTR B;  4UI9 B;  4ZQL A;  1WEN A;  3PHD A;  4YAX A;  1Z60 A;  2LGV A;  3KV6 A;  5TAB A;  1VD4 A;  2PNX A;  2YT5 A;  3N9Q A;  4UP5 A;  4FIP A;  3T9K A;  1MM3 A;  1WIL A;  3M62 A;  4LKA A;  5LCW B;  3N9M A;  5LKU A;  2QIC A;  5D1L B;  4YBS A;  1X4I A;  4XI1 A;  4YAT A;  4S3O C;  3O47 A;  3LJU X;  1X4U A;  2JUN A;  4Q6F A;  2YRE A;  5B8D A;  3LQI A;  5TDR A;  2EOD A;  5LKZ A;  1E4U A;  5JG6 A;  3LVQ E;  4AYC B;  2KU3 A;  2MIQ A;  5KH9 A;  2OXQ C;  3QZV A;  4QQ4 A;  2DJA A;  5TDW A;  2EGM A;  1ZBD B;  5LKX A;  3LDY A;  1WFK A;  2VPB A;  2KIZ A;  3EB6 A;  3M63 A;  5H1U A;  4OGE A;  5TBN A;  1WEM A;  3SUB A;  2QIZ A;  1Z6U A;  4WZ3 B;  2ECW A;  4NN2 A;  3PUR A; 
#chains in the Genus database with same CATH homology
 3ZTG A;  4IC2 A;  2YHO A;  2CKL B;  5H1T A;  3N9O A;  4N4F A;  3N9N A;  4MVT A;  4WA6 A;  4YBM A;  5B76 A;  2Y1N A;  2M1R A;  2M85 A;  1WEE A;  2LXP C;  2IDA A;  5DIN A;  4L58 A;  3M99 A;  2C2V S;  2MT5 A;  5AIU A;  2KRE A;  5D1M B;  2UZG A;  4BHW A;  2L80 A;  5G0F A;  2PUY A;  1U6G B;  2YHN A;  2ECT A;  2YUR A;  3DQV R;  1VFY A;  5DKA A;  1CHC A;  2MD8 C;  4QF2 A;  2E6S A;  3V43 A;  1Z2Q A;  1HYI A;  4FJC A;  1WEV A;  5C11 A;  4V3K C;  2MNZ A;  1N87 A;  2LRI C;  4B7Y C;  5FB0 A;  4P5O B;  3HCT A;  4LK9 A;  2JRJ A;  2F6J A;  2F6N A;  2BAY A;  4A49 A;  5B75 A;  3VK6 A;  4GNG A;  5H9M A;  2VPG A;  5G05 B;  4GNF A;  4YBT A;  3O34 A;  3O35 A;  4ZUX U;  4X3G A;  2LQ6 A;  2C2L A;  4FO9 A;  3O36 A;  5B78 A;  2XEU A;  2M6M A;  3MHH A;  4PPE A;  1V87 A;  2CSZ A;  1XWH A;  1BOR A;  2L5U A;  2LV9 A;  3HCS A;  2VP7 A;  2F42 A;  2MD7 B;  2VJF A;  3O70 A;  2KGG A;  1FP0 A;  5FB1 A;  2EGP A;  2LGL A;  5KH7 A;  1WIM A;  2K17 A;  2CT2 A;  3KNV A;  3U5M A;  1WES A;  1JOC A;  1WE9 A;  2YW8 A;  1WEP A;  5FER A;  2RSD A;  2KYU A;  2Y1M A;  2DX8 A;  3RPG C;  4AVX A;  4FK5 A;  1G25 A;  2MA6 A;  4IC3 A;  4A4B A;  3SOW A;  2Y43 A;  2YU4 A;  4R7E A;  3SOX A;  2YSJ A;  3O33 A;  2ECI A;  4LLB A;  1IYM A;  3EB5 A;  2HDP A;  3MHS A;  5B79 A;  4I7C A;  3IHP A;  2ZET C;  4CCG X;  1HYJ A;  1MM2 A;  4C9Z A;  5D1K B;  3L1Z B;  2VPD A;  3L11 A;  4N3W A;  2FSA A;  1JM7 A;  2HYE D;  4GB0 A;  2ECJ A;  1LDK C;  3T7L A;  4YAD A;  2NAA A;  3SHB A;  2LDR A;  4A4C A;  3ZVY A;  3O37 A;  2E6R A;  2YQM A;  4YAB A;  4S3O B;  2KWN A;  4A0C D;  4GND A;  5C13 A;  2MA5 A;  2ECG A;  2ECV A;  2G6Q A;  4R2Y A;  1X4J A;  5FEY A;  3ZNI A;  4WZ2 A;  4O64 A;  2FUI A;  4BBQ A;  2QJ0 A;  4AUQ B;  2CSY A;  3KV5 A;  2JMI A;  1FBV A;  2AN6 A;  3LRQ A;  5J3X A;  2KWK A;  4LJN A;  3ASL A;  2JMJ A;  3LQH A;  5I3L A;  3I2D A;  3RPG B;  3GV4 A;  3C5K A;  3ZVZ B;  2RI7 A;  3NG2 A;  3DPL R;  2K16 A;  2K1J A;  4AYC A;  3N9L A;  2H0D A;  2L75 A;  5AIT A;  3ZPV E;  3KQI A;  3ZPV 1;  1WGM A;  2G45 A;  1K2F A;  1WEO A;  1LDJ B;  2XB1 A;  4WZ0 A;  4F52 B;  3ZYQ A;  5B77 A;  2L0B A;  2ECN A;  4R8P K;  1RMD A;  4I7D A;  4L7X A;  2YQL A;  2FUU A;  3GL6 A;  4TKP B;  4LAD B;  1DVP A;  3N9P A;  2CKL A;  3U5P A;  1VYX A;  2LGK A;  3T6R A;  2M3H A;  3O7A A;  4AP4 A;  3FL2 A;  2VNF A;  4ZDT A;  1WEQ A;  2H0D B;  4YC9 A;  2D8S A;  2VJE A;  5G04 B;  5LKT A;  4B86 C;  3U5O A;  4I7B A;  5KH3 A;  2KR4 A;  1F62 A;  2EA6 A;  2VJF B;  4PTB A;  4CA1 A;  5EYA F;  2KWJ A;  2KE1 A;  4UP0 A;  4GNE A;  2MNY A;  2MUM A;  2YSM A;  2VPE A;  5H1V A;  4QF3 A;  2LXH C;  4MSX A;  2KGI A;  2I50 A;  3PUQ A;  4W4U A;  2KFT A;  3C6W A;  3L1X A;  2K4D A;  2KWO A;  2VJE B;  3U5N A;  2YYR A;  1T1H A;  2YUC A;  3HTK C;  5TRB A;  2LGG A;  4V3L C;  2L43 A;  3LQJ A;  2G43 A;  3SOU A;  3HCU A;  2JMD A;  2LN0 A;  1WEW A;  1JM7 B;  1WEU A;  3RTR B;  4UI9 B;  4ZQL A;  1WEN A;  3PHD A;  4YAX A;  1Z60 A;  2LGV A;  3KV6 A;  5TAB A;  1VD4 A;  2PNX A;  2YT5 A;  3N9Q A;  4UP5 A;  4FIP A;  1MM3 A;  1WIL A;  3M62 A;  4LKA A;  5LCW B;  3N9M A;  5LKU A;  2QIC A;  5D1L B;  4YBS A;  1X4I A;  4XI1 A;  4YAT A;  4S3O C;  1X4U A;  4Q6F A;  2YRE A;  5B8D A;  3LQI A;  5TDR A;  2EOD A;  5LKZ A;  1E4U A;  5JG6 A;  4AYC B;  2KU3 A;  2MIQ A;  5KH9 A;  2OXQ C;  3QZV A;  5TDW A;  1ZBD B;  5LKX A;  1WFK A;  2VPB A;  2KIZ A;  3EB6 A;  3M63 A;  5H1U A;  5TBN A;  1WEM A;  2QIZ A;  1Z6U A;  4WZ3 B;  2ECW A;  4NN2 A;  3PUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...