1X4JA

Solution structure of ring finger in ring finger protein 38
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
75
structure length
75
Chain Sequence
GSSGSSGQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RING finger protein 38
publication title Solution structure of RING finger in RING finger protein 38
rcsb
source organism Homo sapiens
total genus 9
structure length 75
sequence length 75
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1x4jA00
2F6JA 2QICA 4O64A 4I7CA 4Q6FA 1X4IA 3M99A 3O35A 5FEYA 3KV5A 4YATA 3EB6A 1MM3A 3L11A 5KH7A 2KIZA 2FSAA 2LV9A 4TKPB 5TBNA 4LK9A 2ECWA 2M6MA 3M62A 1Z6UA 4A0CD 4CCGX 2LDRA 2H0DB 4AP4A 1FP0A 2VNFA 3KQIA 2EGPA 2JMIA 4YAXA 1WEMA 1X4UA 3QZVA 3LQHA 1VYXA 3MHHA 1LDJB 3IHPA 2KWNA 3HCTA 2VPBA 1MM2A 2VPGA 4WZ3B 5LCWB 4FK5A 4IC2A 2CT2A 4MSXA 1ZBDB 2KU3A 1E4UA 2RSDA 5EYAF 4BHWA 4WZ2A 4AVXA 4PPEA 2YU4A 3O70A 1BORA 4YC9A 4WA6A 1DVPA 5C11A 2LGKA 2C2VS 4YBMA 2QJ0A 2F42A 1K2FA 3RPGB 2LGGA 4A4CA 2LXHC 1U6GB 1CHCA 4LLBA 2YT5A 4V3KC 4GNDA 2CSYA 2VJFB 4QF2A 3PUQA 2ECNA 3ZPV1 1G25A 2IDAA 4I7DA 4A49A 4IC3A 4B86C 2ECIA 2JMDA 2G45A 4AYCB 4S3OC 2JMJA 3N9MA 1WEPA 3ZPVE 5C13A 2YHOA 2Y1MA 2MA6A 4PTBA 5J3XA 2L75A 2YHNA 2K4DA 2VJEA 2YQMA 5TRBA 2PNXA 2MD7B 5D1LB 3I2DA 3N9NA 2MD8C 5B77A 2BAYA 2E6RA 3ZTGA 4WZ0A 3O36A 1JM7B 3FL2A 2AN6A 4FJCA 2YSJA 1WEVA 2UZGA 3L1ZB 5G0FA 3LQIA 2M1RA 2ZETC 4A4BA 3U5MA 2F6NA 2CSZA 2KWOA 4R8PK 1WESA 5B8DA 2L0BA 2VPEA 2K16A 2LGLA 2MT5A 4N3WA 4YADA 1T1HA 1WEQA 1WEUA 2JRJA 3L1XA 3KV6A 4ZUXU 3O37A 5D1KB 5D1MB 1WFKA 5KH9A 2E6SA 3NG2A 4L58A 2I50A 2LXPC 3M63A 2YQLA 5LKXA 1WILA 2L43A 3GL6A 4LADB 2HDPA 4S3OB 4NN2A 5LKZA 4B7YC 4F52B 2OXQC 1IYMA 1VD4A 2CKLA 3SOWA 3SOUA 2RI7A 5DKAA 2KREA 5TABA 2ECTA 2FUUA 3U5PA 3C6WA 2YYRA 3RTRB 5TDRA 2M85A 3PURA 4GNEA 5H1VA 2G43A 2ECVA 1VFYA 1HYJA 5AIUA 5TDWA 4UP0A 5LKUA 3ZYQA 5B78A 3N9OA 3N9QA 2L80A 1WE9A 4MVTA 2KWKA 3PHDA 4YBSA 1FBVA 3VK6A 2MNZA 4L7XA 3ZNIA 1JOCA 3HCSA 3T6RA 3HCUA 2MUMA 3SOXA 3DQVR 3T7LA 2K17A 1X4JA 3RPGC 3ZVYA 4UI9B 3C5KA 2XEUA 3MHSA 5FB0A 1WGMA 2VJEB 2VP7A 3O34A 2QIZA 4BBQA 2H0DA 2EA6A 1LDKC 2KWJA 1WENA 2YURA 4YABA 5H1UA 1V87A 1XWHA 2Y1NA 5FERA 1N87A 2DX8A 2NAAA 2ECJA 5JG6A 3O33A 5G05B 3GV4A 2ECGA 3ASLA 2K1JA 2MIQA 3HTKC 4UP5A 3DPLR 4LKAA 2M3HA 5B76A 3N9PA 4CA1A 1F62A 4FO9A 2PUYA 3LQJA 2L5UA 1WEOA 5DINA 4XI1A 5H9MA 4R7EA 2EODA 5G04B 2KE1A 1WIMA 1Z60A 1WEWA 2YREA 3KNVA 3O7AA 2FUIA 2G6QA 2VJFA 4I7BA 2KFTA 4ZDTA 2C2LA 2LGVA 5KH3A 4N4FA 2CKLB 5AITA 3SHBA 5B79A 5B75A 4YBTA 3V43A 4AYCA 2MA5A 2KGGA 4GB0A 2YUCA 3U5OA 2LN0A 1Z2QA 2LQ6A 2VPDA 2KYUA 1RMDA 4R2YA 4X3GA 3EB5A 2KGIA 5LKTA 4GNGA 2YW8A 2Y43A 2YSMA 4V3LC 4W4UA 3LRQA 5H1TA 4C9ZA 2HYED 5I3LA 2LRIC 3U5NA 2XB1A 5FB1A 3ZVZB 4LJNA 1JM7A 4P5OB 2MNYA 1HYIA 2KR4A 4FIPA 4GNFA 3N9LA 4ZQLA 2D8SA 4QF3A 1WEEA 4AUQB
chains in the Genus database with same CATH superfamily
2F6JA 2QICA 4O64A 4I7CA 4Q6FA 1X4IA 3M99A 3O35A 5FEYA 3KV5A 4YATA 3EB6A 3M7KA 1MM3A 3L11A 5KH7A 2KIZA 2FSAA 2LV9A 4TKPB 2D8UA 5TBNA 4LK9A 2B0OE 2ECWA 2M6MA 3M62A 1Z6UA 3LJUX 3SUBA 4A0CD 4CCGX 2LDRA 2H0DB 4AP4A 1FP0A 5SVXA 2VNFA 3KQIA 4OGEA 2EGPA 2JMIA 4YAXA 1WEMA 3FAOA 1X4UA 3QZVA 3LQHA 3O47A 4OGCA 2OWAA 1VYXA 3MHHA 1LDJB 3IHPA 2EXUA 2KWNA 3KDEC 3HCTA 2VPBA 1MM2A 2VPGA 4WZ3B 5LCWB 4FK5A 4IC2A 2CT2A 4MSXA 1ZBDB 3PLWA 2CRRA 2KU3A 1E4UA 2RSDA 5EYAF 4BHWA 4WZ2A 4AVXA 4PPEA 2YU4A 3O70A 1BORA 4YC9A 4WA6A 1DVPA 5C11A 2LGKA 2C2VS 4YBMA 2QJ0A 3FANA 2F42A 1K2FA 3RPGB 2LGGA 4A4CA 4F1PA 2KKXA 2LXHC 1U6GB 1CHCA 4LLBA 2YT5A 3LVQE 4V3KC 4GNDA 2CSYA 2L7PA 2VJFB 4QF2A 3PUQA 2ECNA 3ZPV1 1G25A 3LVRE 2IDAA 4I7DA 4A49A 2FD4A 4IC3A 4O62A 4B86C 2ECIA 2JMDA 2DJAA 2G45A 4AYCB 4S3OC 2JMJA 3N9MA 1WEPA 3ZPVE 5C13A 2YHOA 2CRWA 2MA6A 2Y1MA 4PTBA 5J3XA 2L75A 2IQJA 2YHNA 2K4DA 2XP0A 3T9KA 4Z0RA 2VJEA 2YQMA 5TRBA 2PNXA 2MD7B 5K3QA 5D1LB 3I2DA 3N9NA 2MD8C 5B77A 2BAYA 2XOCA 2E6RA 3ZTGA 4WZ0A 3O36A 1JM7B 3FL2A 2AN6A 4FJCA 2YSJA 1WEVA 2UZGA 3L1ZB 5G0FA 2RR4A 3LQIA 3Q1DA 2M1RA 2ZETC 4A4BA 3U5MA 2F6NA 1DCQA 2CSZA 2KWOA 4R8PK 1WESA 5B8DA 2L0BA 2VPEA 2K16A 2LGLA 2MT5A 4N3WA 4YADA 2DSMA 1T1HA 1WEQA 1WEUA 2JRJA 3L1XA 3KV6A 4ZUXU 3O37A 2CONA 5D1KB 2XOYA 5D1MB 1WFKA 5KH9A 2E6SA 3NG2A 4L58A 3LDYA 2I50A 2LXPC 3M63A 2YQLA 5LKXA 1WILA 2L43A 3GL6A 4LADB 2HDPA 4S3OB 4NN2A 5LKZA 2M13A 4B7YC 4F52B 2OXQC 5SVIA 1IYMA 1VD4A 2CKLA 3SOWA 3SOUA 3FEHA 2RI7A 5DKAA 2KREA 5TABA 2ECTA 2FUUA 3U5PA 3C6WA 2YYRA 3RTRB 5TDRA 3E2DA 2M85A 2YVRA 3PURA 4GNEA 5H1VA 2G43A 2ECVA 1VFYA 1HYJA 5AIUA 5TDWA 4UP0A 5LKUA 3ZYQA 5B78A 3N9OA 3N9QA 4QQ4A 4Z0OA 2L80A 2XOZA 1WE9A 4MVTA 2KWKA 3PHDA 4YBSA 1FBVA 3VK6A 2MNZA 4L7XA 3ZNIA 1JOCA 3HCSA 3T6RA 3HCUA 2MUMA 3SOXA 3DQVR 3T7LA 2K17A 1X4JA 3RPGC 3DWDA 3ZVYA 4UI9B 3C5KA 2XEUA 3MHSA 5FB0A 1WGMA 2VJEB 2VP7A 3O34A 2QIZA 3H7HA 4BBQA 2H0DA 2EA6A 1LDKC 2LAUA 2KWJA 1WENA 2YURA 4YABA 5H1UA 1V87A 1XWHA 2Y1NA 5FERA 1N87A 2DX8A 2NAAA 2ECJA 5JG6A 3O33A 3GV4A 5G05B 2ECGA 3ASLA 2K1JA 2MIQA 2KKYA 3HTKC 2CSVA 4UP5A 3DPLR 5SVYA 4LKAA 2M3HA 5B76A 3N9PA 4CA1A 1F62A 4FO9A 2JUNA 3FM8C 2PUYA 3LQJA 2L5UA 1WEOA 5DINA 4XI1A 3MDBC 5H9MA 4R7EA 2EODA 5G04B 2KE1A 2JM3A 1WIMA 1Z60A 1WEWA 2YREA 3KNVA 3O7AA 2FUIA 2G6QA 2VJFA 4I7BA 2KFTA 4H9DA 4ZDTA 2E61A 2C2LA 2LGVA 5KH3A 5SVIB 4N4FA 2P57A 2CKLB 5AITA 3SHBA 5B79A 5B75A 3JUEA 4YBTA 3FJUB 3V43A 1MBMA 4AYCA 2EGMA 2MA5A 2KGGA 4GB0A 2YUCA 3U5OA 2LN0A 1Z2QA 3DDTA 2LQ6A 2VPDA 2KYUA 1RMDA 4R2YA 4X3GA 3EB5A 2KGIA 2MKEA 5LKTA 4GNGA 2YW8A 2Y43A 2YSMA 4V3LC 4W4UA 3LRQA 5H1TA 4C9ZA 2HYED 5I3LA 2FFWA 2LRIC 3U5NA 2XB1A 5FB1A 3ZVZB 4LJNA 1JM7A 4P5OB 2MNYA 1HYIA 2KR4A 4FIPA 4GNFA 3N9LA 4ZQLA 2D8SA 4QF3A 1WEEA 4AUQB
chains in the Genus database with same CATH topology
2F6JA 2QICA 4O64A 4I7CA 4Q6FA 1X4IA 3M99A 3O35A 5FEYA 3KV5A 4YATA 3EB6A 1MM3A 3L11A 5KH7A 2KIZA 2FSAA 2LV9A 4TKPB 5TBNA 4LK9A 2ECWA 2M6MA 3M62A 1Z6UA 4A0CD 4CCGX 2LDRA 2H0DB 4AP4A 1FP0A 2VNFA 3KQIA 2EGPA 2JMIA 4YAXA 1WEMA 1X4UA 3QZVA 3LQHA 1VYXA 3MHHA 1LDJB 3IHPA 2KWNA 3HCTA 2VPBA 1MM2A 2VPGA 4WZ3B 5LCWB 4FK5A 4IC2A 2CT2A 4MSXA 1ZBDB 2KU3A 1E4UA 2RSDA 5EYAF 4BHWA 4WZ2A 4AVXA 4PPEA 2YU4A 3O70A 1BORA 4YC9A 4WA6A 1DVPA 5C11A 2LGKA 2C2VS 4YBMA 2QJ0A 2F42A 1K2FA 3RPGB 2LGGA 4A4CA 2LXHC 1U6GB 1CHCA 4LLBA 2YT5A 4V3KC 4GNDA 2CSYA 2VJFB 4QF2A 3PUQA 2ECNA 3ZPV1 1G25A 2IDAA 4I7DA 4A49A 4IC3A 4B86C 2ECIA 2JMDA 2G45A 4AYCB 4S3OC 2JMJA 3N9MA 1WEPA 3ZPVE 5C13A 2YHOA 2Y1MA 2MA6A 4PTBA 5J3XA 2L75A 2YHNA 2K4DA 2VJEA 2YQMA 5TRBA 2PNXA 2MD7B 5D1LB 3I2DA 3N9NA 2MD8C 5B77A 2BAYA 2E6RA 3ZTGA 4WZ0A 3O36A 1JM7B 3FL2A 2AN6A 4FJCA 2YSJA 1WEVA 2UZGA 3L1ZB 5G0FA 3LQIA 2M1RA 2ZETC 4A4BA 3U5MA 2F6NA 2CSZA 2KWOA 4R8PK 1WESA 5B8DA 2L0BA 2VPEA 2K16A 2LGLA 2MT5A 4N3WA 4YADA 1T1HA 1WEQA 1WEUA 2JRJA 3L1XA 3KV6A 4ZUXU 3O37A 5D1KB 5D1MB 1WFKA 5KH9A 2E6SA 3NG2A 4L58A 2I50A 2LXPC 3M63A 2YQLA 5LKXA 1WILA 2L43A 3GL6A 4LADB 2HDPA 4S3OB 4NN2A 5LKZA 4B7YC 4F52B 2OXQC 1IYMA 1VD4A 2CKLA 3SOWA 3SOUA 2RI7A 5DKAA 2KREA 5TABA 2ECTA 2FUUA 3U5PA 3C6WA 2YYRA 3RTRB 5TDRA 2M85A 3PURA 4GNEA 5H1VA 2G43A 2ECVA 1VFYA 1HYJA 5AIUA 5TDWA 4UP0A 5LKUA 3ZYQA 5B78A 3N9OA 3N9QA 2L80A 1WE9A 4MVTA 2KWKA 3PHDA 4YBSA 1FBVA 3VK6A 2MNZA 4L7XA 3ZNIA 1JOCA 3HCSA 3T6RA 3HCUA 2MUMA 3SOXA 3DQVR 3T7LA 2K17A 1X4JA 3RPGC 3ZVYA 4UI9B 3C5KA 2XEUA 3MHSA 5FB0A 1WGMA 2VJEB 2VP7A 3O34A 2QIZA 4BBQA 2H0DA 2EA6A 1LDKC 2KWJA 1WENA 2YURA 4YABA 5H1UA 1V87A 1XWHA 2Y1NA 5FERA 1N87A 2DX8A 2NAAA 2ECJA 5JG6A 3O33A 5G05B 3GV4A 2ECGA 3ASLA 2K1JA 2MIQA 3HTKC 4UP5A 3DPLR 4LKAA 2M3HA 5B76A 3N9PA 4CA1A 1F62A 4FO9A 2PUYA 3LQJA 2L5UA 1WEOA 5DINA 4XI1A 5H9MA 4R7EA 2EODA 5G04B 2KE1A 1WIMA 1Z60A 1WEWA 2YREA 3KNVA 3O7AA 2FUIA 2G6QA 2VJFA 4I7BA 2KFTA 4ZDTA 2C2LA 2LGVA 5KH3A 4N4FA 2CKLB 5AITA 3SHBA 5B79A 5B75A 4YBTA 3V43A 4AYCA 2MA5A 2KGGA 4GB0A 2YUCA 3U5OA 2LN0A 1Z2QA 2LQ6A 2VPDA 2KYUA 1RMDA 4R2YA 4X3GA 3EB5A 2KGIA 5LKTA 4GNGA 2YW8A 2Y43A 2YSMA 4V3LC 4W4UA 3LRQA 5H1TA 4C9ZA 2HYED 5I3LA 2LRIC 3U5NA 2XB1A 5FB1A 3ZVZB 4LJNA 1JM7A 4P5OB 2MNYA 1HYIA 2KR4A 4FIPA 4GNFA 3N9LA 4ZQLA 2D8SA 4QF3A 1WEEA 4AUQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F6J A;  2QIC A;  4O64 A;  4I7C A;  4Q6F A;  1X4I A;  3M99 A;  3O35 A;  5FEY A;  3KV5 A;  4YAT A;  3EB6 A;  1MM3 A;  3L11 A;  5KH7 A;  2KIZ A;  2FSA A;  2LV9 A;  4TKP B;  5TBN A;  4LK9 A;  2ECW A;  2M6M A;  3M62 A;  1Z6U A;  4A0C D;  4CCG X;  2LDR A;  2H0D B;  4AP4 A;  1FP0 A;  2VNF A;  3KQI A;  2EGP A;  2JMI A;  4YAX A;  1WEM A;  1X4U A;  3QZV A;  3LQH A;  1VYX A;  3MHH A;  1LDJ B;  3IHP A;  2KWN A;  3HCT A;  2VPB A;  1MM2 A;  2VPG A;  4WZ3 B;  5LCW B;  4FK5 A;  4IC2 A;  2CT2 A;  4MSX A;  1ZBD B;  2KU3 A;  1E4U A;  2RSD A;  5EYA F;  4BHW A;  4WZ2 A;  4AVX A;  4PPE A;  2YU4 A;  3O70 A;  1BOR A;  4YC9 A;  4WA6 A;  1DVP A;  5C11 A;  2LGK A;  2C2V S;  4YBM A;  2QJ0 A;  2F42 A;  1K2F A;  3RPG B;  2LGG A;  4A4C A;  2LXH C;  1U6G B;  1CHC A;  4LLB A;  2YT5 A;  4V3K C;  4GND A;  2CSY A;  2VJF B;  4QF2 A;  3PUQ A;  2ECN A;  3ZPV 1;  1G25 A;  2IDA A;  4I7D A;  4A49 A;  4IC3 A;  4B86 C;  2ECI A;  2JMD A;  2G45 A;  4AYC B;  4S3O C;  2JMJ A;  3N9M A;  1WEP A;  3ZPV E;  5C13 A;  2YHO A;  2Y1M A;  2MA6 A;  4PTB A;  5J3X A;  2L75 A;  2YHN A;  2K4D A;  2VJE A;  2YQM A;  5TRB A;  2PNX A;  2MD7 B;  5D1L B;  3I2D A;  3N9N A;  2MD8 C;  5B77 A;  2BAY A;  2E6R A;  3ZTG A;  4WZ0 A;  3O36 A;  1JM7 B;  3FL2 A;  2AN6 A;  4FJC A;  2YSJ A;  1WEV A;  2UZG A;  3L1Z B;  5G0F A;  3LQI A;  2M1R A;  2ZET C;  4A4B A;  3U5M A;  2F6N A;  2CSZ A;  2KWO A;  4R8P K;  1WES A;  5B8D A;  2L0B A;  2VPE A;  2K16 A;  2LGL A;  2MT5 A;  4N3W A;  4YAD A;  1T1H A;  1WEQ A;  1WEU A;  2JRJ A;  3L1X A;  3KV6 A;  4ZUX U;  3O37 A;  5D1K B;  5D1M B;  1WFK A;  5KH9 A;  2E6S A;  3NG2 A;  4L58 A;  2I50 A;  2LXP C;  3M63 A;  2YQL A;  5LKX A;  1WIL A;  2L43 A;  3GL6 A;  4LAD B;  2HDP A;  4S3O B;  4NN2 A;  5LKZ A;  4B7Y C;  4F52 B;  2OXQ C;  1IYM A;  1VD4 A;  2CKL A;  3SOW A;  3SOU A;  2RI7 A;  5DKA A;  2KRE A;  5TAB A;  2ECT A;  2FUU A;  3U5P A;  3C6W A;  2YYR A;  3RTR B;  5TDR A;  2M85 A;  3PUR A;  4GNE A;  5H1V A;  2G43 A;  2ECV A;  1VFY A;  1HYJ A;  5AIU A;  5TDW A;  4UP0 A;  5LKU A;  3ZYQ A;  5B78 A;  3N9O A;  3N9Q A;  2L80 A;  1WE9 A;  4MVT A;  2KWK A;  3PHD A;  4YBS A;  1FBV A;  3VK6 A;  2MNZ A;  4L7X A;  3ZNI A;  1JOC A;  3HCS A;  3T6R A;  3HCU A;  2MUM A;  3SOX A;  3DQV R;  3T7L A;  2K17 A;  1X4J A;  3RPG C;  3ZVY A;  4UI9 B;  3C5K A;  2XEU A;  3MHS A;  5FB0 A;  1WGM A;  2VJE B;  2VP7 A;  3O34 A;  2QIZ A;  4BBQ A;  2H0D A;  2EA6 A;  1LDK C;  2KWJ A;  1WEN A;  2YUR A;  4YAB A;  5H1U A;  1V87 A;  1XWH A;  2Y1N A;  5FER A;  1N87 A;  2DX8 A;  2NAA A;  2ECJ A;  5JG6 A;  3O33 A;  5G05 B;  3GV4 A;  2ECG A;  3ASL A;  2K1J A;  2MIQ A;  3HTK C;  4UP5 A;  3DPL R;  4LKA A;  2M3H A;  5B76 A;  3N9P A;  4CA1 A;  1F62 A;  4FO9 A;  2PUY A;  3LQJ A;  2L5U A;  1WEO A;  5DIN A;  4XI1 A;  5H9M A;  4R7E A;  2EOD A;  5G04 B;  2KE1 A;  1WIM A;  1Z60 A;  1WEW A;  2YRE A;  3KNV A;  3O7A A;  2FUI A;  2G6Q A;  2VJF A;  4I7B A;  2KFT A;  4ZDT A;  2C2L A;  2LGV A;  5KH3 A;  4N4F A;  2CKL B;  5AIT A;  3SHB A;  5B79 A;  5B75 A;  4YBT A;  3V43 A;  4AYC A;  2MA5 A;  2KGG A;  4GB0 A;  2YUC A;  3U5O A;  2LN0 A;  1Z2Q A;  2LQ6 A;  2VPD A;  2KYU A;  1RMD A;  4R2Y A;  4X3G A;  3EB5 A;  2KGI A;  5LKT A;  4GNG A;  2YW8 A;  2Y43 A;  2YSM A;  4V3L C;  4W4U A;  3LRQ A;  5H1T A;  4C9Z A;  2HYE D;  5I3L A;  2LRI C;  3U5N A;  2XB1 A;  5FB1 A;  3ZVZ B;  4LJN A;  1JM7 A;  4P5O B;  2MNY A;  1HYI A;  2KR4 A;  4FIP A;  4GNF A;  3N9L A;  4ZQL A;  2D8S A;  4QF3 A;  1WEE A;  4AUQ B; 
#chains in the Genus database with same CATH topology
 2F6J A;  2QIC A;  4O64 A;  4I7C A;  4Q6F A;  1X4I A;  3M99 A;  3O35 A;  5FEY A;  3KV5 A;  4YAT A;  3EB6 A;  3M7K A;  1MM3 A;  3L11 A;  5KH7 A;  2KIZ A;  2FSA A;  2LV9 A;  4TKP B;  2D8U A;  5TBN A;  4LK9 A;  2B0O E;  2ECW A;  2M6M A;  3M62 A;  1Z6U A;  3LJU X;  3SUB A;  4A0C D;  4CCG X;  2LDR A;  2H0D B;  4AP4 A;  1FP0 A;  5SVX A;  2VNF A;  3KQI A;  4OGE A;  2EGP A;  2JMI A;  4YAX A;  1WEM A;  3FAO A;  1X4U A;  3QZV A;  3LQH A;  3O47 A;  4OGC A;  2OWA A;  1VYX A;  3MHH A;  1LDJ B;  3IHP A;  2EXU A;  2KWN A;  3KDE C;  3HCT A;  2VPB A;  1MM2 A;  2VPG A;  4WZ3 B;  5LCW B;  4FK5 A;  4IC2 A;  2CT2 A;  4MSX A;  1ZBD B;  3PLW A;  2CRR A;  2KU3 A;  1E4U A;  2RSD A;  5EYA F;  4BHW A;  4WZ2 A;  4AVX A;  4PPE A;  2YU4 A;  3O70 A;  1BOR A;  4YC9 A;  4WA6 A;  1DVP A;  5C11 A;  2LGK A;  2C2V S;  4YBM A;  2QJ0 A;  3FAN A;  2F42 A;  1K2F A;  3RPG B;  2LGG A;  4A4C A;  4F1P A;  2KKX A;  2LXH C;  1U6G B;  1CHC A;  4LLB A;  2YT5 A;  3LVQ E;  4V3K C;  4GND A;  2CSY A;  2L7P A;  2VJF B;  4QF2 A;  3PUQ A;  2ECN A;  3ZPV 1;  1G25 A;  3LVR E;  2IDA A;  4I7D A;  4A49 A;  2FD4 A;  4IC3 A;  4O62 A;  4B86 C;  2ECI A;  2JMD A;  2DJA A;  2G45 A;  4AYC B;  4S3O C;  2JMJ A;  3N9M A;  1WEP A;  3ZPV E;  5C13 A;  2YHO A;  2CRW A;  2MA6 A;  2Y1M A;  4PTB A;  5J3X A;  2L75 A;  2IQJ A;  2YHN A;  2K4D A;  2XP0 A;  3T9K A;  4Z0R A;  2VJE A;  2YQM A;  5TRB A;  2PNX A;  2MD7 B;  5K3Q A;  5D1L B;  3I2D A;  3N9N A;  2MD8 C;  5B77 A;  2BAY A;  2XOC A;  2E6R A;  3ZTG A;  4WZ0 A;  3O36 A;  1JM7 B;  3FL2 A;  2AN6 A;  4FJC A;  2YSJ A;  1WEV A;  2UZG A;  3L1Z B;  5G0F A;  2RR4 A;  3LQI A;  3Q1D A;  2M1R A;  2ZET C;  4A4B A;  3U5M A;  2F6N A;  1DCQ A;  2CSZ A;  2KWO A;  4R8P K;  1WES A;  5B8D A;  2L0B A;  2VPE A;  2K16 A;  2LGL A;  2MT5 A;  4N3W A;  4YAD A;  2DSM A;  1T1H A;  1WEQ A;  1WEU A;  2JRJ A;  3L1X A;  3KV6 A;  4ZUX U;  3O37 A;  2CON A;  5D1K B;  2XOY A;  5D1M B;  1WFK A;  5KH9 A;  2E6S A;  3NG2 A;  4L58 A;  3LDY A;  2I50 A;  2LXP C;  3M63 A;  2YQL A;  5LKX A;  1WIL A;  2L43 A;  3GL6 A;  4LAD B;  2HDP A;  4S3O B;  4NN2 A;  5LKZ A;  2M13 A;  4B7Y C;  4F52 B;  2OXQ C;  5SVI A;  1IYM A;  1VD4 A;  2CKL A;  3SOW A;  3SOU A;  3FEH A;  2RI7 A;  5DKA A;  2KRE A;  5TAB A;  2ECT A;  2FUU A;  3U5P A;  3C6W A;  2YYR A;  3RTR B;  5TDR A;  3E2D A;  2M85 A;  2YVR A;  3PUR A;  4GNE A;  5H1V A;  2G43 A;  2ECV A;  1VFY A;  1HYJ A;  5AIU A;  5TDW A;  4UP0 A;  5LKU A;  3ZYQ A;  5B78 A;  3N9O A;  3N9Q A;  4QQ4 A;  4Z0O A;  2L80 A;  2XOZ A;  1WE9 A;  4MVT A;  2KWK A;  3PHD A;  4YBS A;  1FBV A;  3VK6 A;  2MNZ A;  4L7X A;  3ZNI A;  1JOC A;  3HCS A;  3T6R A;  3HCU A;  2MUM A;  3SOX A;  3DQV R;  3T7L A;  2K17 A;  1X4J A;  3RPG C;  3DWD A;  3ZVY A;  4UI9 B;  3C5K A;  2XEU A;  3MHS A;  5FB0 A;  1WGM A;  2VJE B;  2VP7 A;  3O34 A;  2QIZ A;  3H7H A;  4BBQ A;  2H0D A;  2EA6 A;  1LDK C;  2LAU A;  2KWJ A;  1WEN A;  2YUR A;  4YAB A;  5H1U A;  1V87 A;  1XWH A;  2Y1N A;  5FER A;  1N87 A;  2DX8 A;  2NAA A;  2ECJ A;  5JG6 A;  3O33 A;  3GV4 A;  5G05 B;  2ECG A;  3ASL A;  2K1J A;  2MIQ A;  2KKY A;  3HTK C;  2CSV A;  4UP5 A;  3DPL R;  5SVY A;  4LKA A;  2M3H A;  5B76 A;  3N9P A;  4CA1 A;  1F62 A;  4FO9 A;  2JUN A;  3FM8 C;  2PUY A;  3LQJ A;  2L5U A;  1WEO A;  5DIN A;  4XI1 A;  3MDB C;  5H9M A;  4R7E A;  2EOD A;  5G04 B;  2KE1 A;  2JM3 A;  1WIM A;  1Z60 A;  1WEW A;  2YRE A;  3KNV A;  3O7A A;  2FUI A;  2G6Q A;  2VJF A;  4I7B A;  2KFT A;  4H9D A;  4ZDT A;  2E61 A;  2C2L A;  2LGV A;  5KH3 A;  5SVI B;  4N4F A;  2P57 A;  2CKL B;  5AIT A;  3SHB A;  5B79 A;  5B75 A;  3JUE A;  4YBT A;  3FJU B;  3V43 A;  1MBM A;  4AYC A;  2EGM A;  2MA5 A;  2KGG A;  4GB0 A;  2YUC A;  3U5O A;  2LN0 A;  1Z2Q A;  3DDT A;  2LQ6 A;  2VPD A;  2KYU A;  1RMD A;  4R2Y A;  4X3G A;  3EB5 A;  2KGI A;  2MKE A;  5LKT A;  4GNG A;  2YW8 A;  2Y43 A;  2YSM A;  4V3L C;  4W4U A;  3LRQ A;  5H1T A;  4C9Z A;  2HYE D;  5I3L A;  2FFW A;  2LRI C;  3U5N A;  2XB1 A;  5FB1 A;  3ZVZ B;  4LJN A;  1JM7 A;  4P5O B;  2MNY A;  1HYI A;  2KR4 A;  4FIP A;  4GNF A;  3N9L A;  4ZQL A;  2D8S A;  4QF3 A;  1WEE A;  4AUQ B; 
#chains in the Genus database with same CATH homology
 2F6J A;  2QIC A;  4O64 A;  4I7C A;  4Q6F A;  1X4I A;  3M99 A;  3O35 A;  5FEY A;  3KV5 A;  4YAT A;  3EB6 A;  1MM3 A;  3L11 A;  5KH7 A;  2KIZ A;  2FSA A;  2LV9 A;  4TKP B;  5TBN A;  4LK9 A;  2ECW A;  2M6M A;  3M62 A;  1Z6U A;  4A0C D;  4CCG X;  2LDR A;  2H0D B;  4AP4 A;  1FP0 A;  2VNF A;  3KQI A;  2EGP A;  2JMI A;  4YAX A;  1WEM A;  1X4U A;  3QZV A;  3LQH A;  1VYX A;  3MHH A;  1LDJ B;  3IHP A;  2KWN A;  3HCT A;  2VPB A;  1MM2 A;  2VPG A;  4WZ3 B;  5LCW B;  4FK5 A;  4IC2 A;  2CT2 A;  4MSX A;  1ZBD B;  2KU3 A;  1E4U A;  2RSD A;  5EYA F;  4BHW A;  4WZ2 A;  4AVX A;  4PPE A;  2YU4 A;  3O70 A;  1BOR A;  4YC9 A;  4WA6 A;  1DVP A;  5C11 A;  2LGK A;  2C2V S;  4YBM A;  2QJ0 A;  2F42 A;  1K2F A;  3RPG B;  2LGG A;  4A4C A;  2LXH C;  1U6G B;  1CHC A;  4LLB A;  2YT5 A;  4V3K C;  4GND A;  2CSY A;  2VJF B;  4QF2 A;  3PUQ A;  2ECN A;  3ZPV 1;  1G25 A;  2IDA A;  4I7D A;  4A49 A;  4IC3 A;  4B86 C;  2ECI A;  2JMD A;  2G45 A;  4AYC B;  4S3O C;  2JMJ A;  3N9M A;  1WEP A;  3ZPV E;  5C13 A;  2YHO A;  2Y1M A;  2MA6 A;  4PTB A;  5J3X A;  2L75 A;  2YHN A;  2K4D A;  2VJE A;  2YQM A;  5TRB A;  2PNX A;  2MD7 B;  5D1L B;  3I2D A;  3N9N A;  2MD8 C;  5B77 A;  2BAY A;  2E6R A;  3ZTG A;  4WZ0 A;  3O36 A;  1JM7 B;  3FL2 A;  2AN6 A;  4FJC A;  2YSJ A;  1WEV A;  2UZG A;  3L1Z B;  5G0F A;  3LQI A;  2M1R A;  2ZET C;  4A4B A;  3U5M A;  2F6N A;  2CSZ A;  2KWO A;  4R8P K;  1WES A;  5B8D A;  2L0B A;  2VPE A;  2K16 A;  2LGL A;  2MT5 A;  4N3W A;  4YAD A;  1T1H A;  1WEQ A;  1WEU A;  2JRJ A;  3L1X A;  3KV6 A;  4ZUX U;  3O37 A;  5D1K B;  5D1M B;  1WFK A;  5KH9 A;  2E6S A;  3NG2 A;  4L58 A;  2I50 A;  2LXP C;  3M63 A;  2YQL A;  5LKX A;  1WIL A;  2L43 A;  3GL6 A;  4LAD B;  2HDP A;  4S3O B;  4NN2 A;  5LKZ A;  4B7Y C;  4F52 B;  2OXQ C;  1IYM A;  1VD4 A;  2CKL A;  3SOW A;  3SOU A;  2RI7 A;  5DKA A;  2KRE A;  5TAB A;  2ECT A;  2FUU A;  3U5P A;  3C6W A;  2YYR A;  3RTR B;  5TDR A;  2M85 A;  3PUR A;  4GNE A;  5H1V A;  2G43 A;  2ECV A;  1VFY A;  1HYJ A;  5AIU A;  5TDW A;  4UP0 A;  5LKU A;  3ZYQ A;  5B78 A;  3N9O A;  3N9Q A;  2L80 A;  1WE9 A;  4MVT A;  2KWK A;  3PHD A;  4YBS A;  1FBV A;  3VK6 A;  2MNZ A;  4L7X A;  3ZNI A;  1JOC A;  3HCS A;  3T6R A;  3HCU A;  2MUM A;  3SOX A;  3DQV R;  3T7L A;  2K17 A;  1X4J A;  3RPG C;  3ZVY A;  4UI9 B;  3C5K A;  2XEU A;  3MHS A;  5FB0 A;  1WGM A;  2VJE B;  2VP7 A;  3O34 A;  2QIZ A;  4BBQ A;  2H0D A;  2EA6 A;  1LDK C;  2KWJ A;  1WEN A;  2YUR A;  4YAB A;  5H1U A;  1V87 A;  1XWH A;  2Y1N A;  5FER A;  1N87 A;  2DX8 A;  2NAA A;  2ECJ A;  5JG6 A;  3O33 A;  5G05 B;  3GV4 A;  2ECG A;  3ASL A;  2K1J A;  2MIQ A;  3HTK C;  4UP5 A;  3DPL R;  4LKA A;  2M3H A;  5B76 A;  3N9P A;  4CA1 A;  1F62 A;  4FO9 A;  2PUY A;  3LQJ A;  2L5U A;  1WEO A;  5DIN A;  4XI1 A;  5H9M A;  4R7E A;  2EOD A;  5G04 B;  2KE1 A;  1WIM A;  1Z60 A;  1WEW A;  2YRE A;  3KNV A;  3O7A A;  2FUI A;  2G6Q A;  2VJF A;  4I7B A;  2KFT A;  4ZDT A;  2C2L A;  2LGV A;  5KH3 A;  4N4F A;  2CKL B;  5AIT A;  3SHB A;  5B79 A;  5B75 A;  4YBT A;  3V43 A;  4AYC A;  2MA5 A;  2KGG A;  4GB0 A;  2YUC A;  3U5O A;  2LN0 A;  1Z2Q A;  2LQ6 A;  2VPD A;  2KYU A;  1RMD A;  4R2Y A;  4X3G A;  3EB5 A;  2KGI A;  5LKT A;  4GNG A;  2YW8 A;  2Y43 A;  2YSM A;  4V3L C;  4W4U A;  3LRQ A;  5H1T A;  4C9Z A;  2HYE D;  5I3L A;  2LRI C;  3U5N A;  2XB1 A;  5FB1 A;  3ZVZ B;  4LJN A;  1JM7 A;  4P5O B;  2MNY A;  1HYI A;  2KR4 A;  4FIP A;  4GNF A;  3N9L A;  4ZQL A;  2D8S A;  4QF3 A;  1WEE A;  4AUQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...