4PTBA

Crystal structure of human sp100 phd-bromodomain in the free state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
NSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human SP100 PHD-Bromodomain in the free state
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear autoantigen Sp-100
total genus 59
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ptbA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ptbA01
5F1HA 5EWWA 5E73A 4QUTA 2M1RA 5E9YA 1WEWA 5FFWA 2CKLA 2WP1A 5E9IA 1X4IA 2LRIC 4NRAA 4CUSA 4O7CA 3LQHA 4TTEA 4B86C 2F6NA 2M6MA 4HBWA 5FB1A 3JVLA 5EVAA 4I7BA 5E7DA 3O33A 4L58A 3AQAA 5A85A 5IGLA 3PHDA 1WEQA 2WP2A 5CQ5A 5HFRA 2LGGA 2DATA 4NYXA 5CY9A 3UVXA 5K29A 4ALGA 2MJVB 2DX8A 2LGVA 4WA6A 4C9ZA 4MVTA 2OXQC 2RNXA 3ASLA 4W4UA 5D3RA 5CQ6A 2DVVA 5FEYA 4OGIA 4UYFB 2K17A 3FL2A 5B76A 4X2IA 5L8UA 5LKZA 4QEWA 4YBMA 4Q6FA 5L99A 4YY4A 2YQDA 4QC1A 5JWMA 3KV5A 2R0YA 3T7LA 4S3OB 5ENIA 4LZ2A 5CQ4A 5F3AA 5C85A 3ZPVE 4MR5A 4N4FA 5D3SA 1ZS5A 5FBXA 2KE1A 3M62A 4AYCB 3HMHA 4NQMA 5CRMA 4WIVA 3N9PA 4XY9A 4NYVA 2I7KA 5G05B 3IU6A 2DVRA 4O7BA 5D3TA 5FE1A 4ALHA 4QB3A 1BORA 2KR4A 2Y43A 5HQ5A 4AUQB 1WEMA 4HXLA 1E6IA 5F5ZA 5A5RA 5II1A 2ECTA 2QICA 3ZPV1 5C13A 5FE0A 5CP5A 4R8PK 1WIMA 4YYJA 3HCTA 5FE7A 1G25A 5EICA 3MXFA 5D25A 5A5PA 2LDRA 5KHMA 5DW1A 5IG6A 2G45A 5KH9A 5ENHA 2VNFA 3O36A 2M3HA 2YT5A 1WUGA 5C11A 4UYFA 4LZSA 5DFDA 4GNDA 5I7YA 4A4BA 2CSZA 5KH7A 5H85A 3K2JA 5HCLA 4BW3A 5LJ0A 5CS8A 5D3HA 3SVHA 1VYXA 2I50A 2KGIA 2XEUA 4V3LC 4A9KA 2MD8C 3EB5A 3O70A 4YAXA 4S3OC 1XWHA 5CRZA 3ZNIA 4UIXA 1N72A 5C8GA 3SVFA 4ZQLA 3UW9A 4AYCA 3P1CA 5D0CA 5EWHA 2D8SA 2MA5A 4WHWA 3RCWA 2OUOA 4MR6A 4Z6HA 3SVGA 5B8DA 4LYIA 3MULA 5ETDA 3QZSA 4PS5A 4O64A 5EISA 5I88A 3GG3A 5CQ3A 4N3WA 4NYWA 4LZRA 5F61A 4BBQA 1WE9A 2R10A 4ZUXU 5DYAA 4PCIA 3L1XA 4A9NA 1T1HA 4YYIA 5CQTA 3KQIA 1MM3A 5L8TA 2YW8A 2KWNA 5CUEA 2L5EA 4YH4A 5COIA 4O78A 2G6QA 2YQMA 3U5KA 4O7EA 4YYMA 5ENBA 4HXOA 3U5LA 2YYNA 5TCMA 5LVRA 5D1MB 2L5UA 5CFWA 3TLPA 5AMEA 4NUDA 5KTXA 4A9HA 5F60A 4CFKA 1FBVA 1K2FA 4MENA 3S92A 1V87A 5C7NA 5ENJA 4QSXA 2DVSA 2PNXA 2YYRA 4AP4A 5I3LA 4IOQA 2EGPA 5FE4A 2VJEB 2VP7A 4R2YA 1JSPB 4PTBA 4O7FA 4QR4A 3NG2A 2FUIA 4O76A 3O7AA 2E6RA 5I83A 4BJXA 3JVKA 4HBVA 4E96A 1F68A 5FG5A 4QC3A 3ZYUA 4FIPA 1Z2QA 3HTKC 2ZETC 4MEQA 4NR6A 4NRCA 4XUBA 2GRCA 2L75A 4TKPB 3O34A 5LJ1A 1Z6UA 2RO1A 5I80A 1WILA 3DQVR 5ENCA 3KNVA 4LYWA 5CUGA 2EA6A 4QYDA 4CUPA 4ZDTA 3ZTGA 5BT4A 4XI1A 5AIUA 5A7CA 5HRWA 5JG6A 4YY6A 3G0JA 1E4UA 4TU4A 5F36A 4QR5A 1DVPA 2YW5A 5A5SA 5LJ2A 4YYDA 5FG4A 2QIZA 4KCXA 2MUMA 1F62A 2LGKA 2VJEA 4WZ0A 5I86A 4IC2A 5TRBA 2ECIA 2NAAA 3N9MA 4LYSA 5CUCA 2KWOA 2YEKA 5DINA 5LCWB 5DYXA 5EI4A 4LDFA 4Z1QA 5FE5A 5J3XA 4TT4A 1WEUA 4MEPA 3PUQA 5EWCA 5EYAF 3U5JA 4CFLA 2LV9A 3ZVYA 4C67A 4A9FA 4NUCA 2CT2A 2YUCA 5ENEA 2YREA 3M99A 4O70A 4QYLA 2YEMA 4YYNA 4A9MA 2KTBB 4DONA 5EQ1A 3MB3A 5EK9A 5CUAA 5HM0A 2E6SA 3EB6A 4UIYA 5A5QA 3DAIA 2RS9B 3JVJA 5ACYA 4Y03A 5BT3A 4NR8A 2VJFB 2MD7B 4A9EA 5CQ8A 5D24A 5KO4A 2XB1A 4A0CD 2HYED 4NUEA 2UZGA 4LJNA 5EWDA 5EU1A 5HRXA 2LN0A 4A9JA 5I1QA 4MR3A 5G4RA 2K1JA 4QEUA 5CPEA 4ZW1A 3HCSA 4LKAA 4R7EA 5A82A 2FUUA 5D3PA 5LKUA 4CUUA 5FE8A 4QSSA 2E3KA 5TDWA 4J0SA 2F42A 2YSMA 5CQAA 2CKLB 4PPEA 4TT6A 4MSXA 1RMDA 4CL9A 2YELA 3N9OA 3LRQA 4TT2A 1IYMA 4LRGA 2LXPC 5DFBA 2L85A 3C6WA 4IR6A 5CUDA 2F6JA 5HFQA 4B7YC 4UYGA 4FO9A 4YK0A 4YABA 4Q0OA 1FP0A 4N4IA 4PCEA 2PUYA 4NXJA 4A9IA 4O72A 3NXBA 5CU8A 4CUTA 2H0DA 4WZ2A 2VJFA 5KTUA 5LKTA 3SOWA 4XUAA 5EPRA 5TABA 5A83A 4CUQA 3ZYQA 3PURA 4QZSA 2R0VA 3P1EA 4ZC9A 4YADA 4QEVA 3UVDA 5LKXA 4CCGX 3N9NA 1VFYA 1U6GB 4BW1A 5L96A 5EV9A 5IGKA 4NS5A 2KFTA 5EWVA 4UIVA 5F62A 2MA6A 2JMJA 5D1LB 5B77A 4GPJA 1JM7A 2Y1MA 1Z60A 2RNWA 5TDRA 4YBSA 5J0DA 2DKWA 4WHUA 3N9LA 2OSSA 5DYUA 4XY8A 5F25A 5C89A 1LDKC 5F2PA 3GV4A 3P1DA 2KREA 2ECVA 5A5OA 5DKDA 5JI8A 2H0DB 2YDWA 3LXJA 4NR7A 4NR9A 3U5PA 4F52B 3HMEA 4O77A 1LDJB 5AD2A 2DVQA 5B79A 1X4JA 4GNGA 5D1KB 4CA1A 2G43A 4F3IA 1HYIA 3P5OA 5LVQA 5D26A 3LQIA 4PY6A 5IBNA 3IU5A 3KV6A 2MT5A 4LC2A 5G04B 4OUFA 1WEEA 3VK6A 3UV5A 1MM2A 3O37A 5D3LA 5EPSA 2LGLA 3RPGC 5C87A 3QZTA 4IR4A 3QZVA 5EA1A 2KWKA 3RPGB 5FB0A 4QSRA 3M63A 1JM7B 5IGNA 5L98A 5CUBA 2OO1A 4HBYA 5D3NA 4NR5A 3C5KA 5B75A 5KH3A 2YQLA 5TB6A 2VPBA 2YHOA 4QR3A 5EP7A 5EM3A 4QUUA 4IORA 1X0JA 4N4HA 3SOUA 5G4SA 5CZGA 3AADA 5IGMA 2ECJA 5E0RA 2VPGA 5CQ7A 4UYDA 4LADB 2MIQA 3DWYA 2I8NA 2ECGA 3P1FA 4QSPA 4QNSA 3GL6A 4QSUA 5KTWA 2YU4A 1WEPA 5CGPA 2QJ0A 4X3GA 4HXPA 4A9OA 4O71A 3T6RA 4BHWA 4HXKA 5FFYA 1WENA 4QF2A 4GNEA 2JRJA 3ZVZB 5E9LA 4TS8A 4IOOA 4FLPA 5H9MA 5G0FA 2L84A 5A5NA 2G4AA 2LSPB 4YYHA 2MNZA 4V3KC 5HQ6A 4YYGA 2LQ6A 4N4GA 3MUKA 5A81A 5FDZA 5DKHA 5DX4A 2FSAA 4QSTA 4YBTA 4LR6A 5L97A 5AMFA 4TQNA 5FE9A 3MHHA 5E9MA 4L7XA 4WZ3B 5D3JA 5HQ7A 2K16A 3MHSA 4XYAA 4FJCA 1WESA 4A49A 4UIUA 4NR4A 5AITA 4YYKA 4UP0A 4J0RA 5C4QA 4AVXA 2IDAA 4OGJA 5DYCA 2KGGA 5E3GA 4MEOA 2C2VS 2EODA 5DLZA 5D7XA 5HELA 5ENGA 2LXHC 5IIDA 5TBNA 4O74A 4AKNA 5HENA 5I29A 5FH6A 2KIZA 4HXNA 1N87A 5FE6A 5ETBA 5H1UA 5F1LA 2KWJA 5E9VA 5E3DA 4QY4A 4HXMA 5DKCA 4TU6A 4NQNA 5HRVA 1EQFA 1WEOA 2ECNA 4LLBA 4HXRA 4TZ2A 5B78A 5H1TA 4QSQA 5DLXA 4QBMA 2VPEA 4PKLA 5II2A 3FKMX 3Q2EA 4CURA 5ENFA 3L1ZB 2ECWA 2RFJA 2YURA 1WUMA 3I2DA 1X4UA 5FFVA 2DWWA 4I7CA 5BT5A 1ZBDB 4NRBA 3L11A 4QF3A 4J1PA 5LUUA 5EGUA 4KV1A 2E7OA 2JMIA 3SHBA 1JOCA 4YC9A 1HYJA 5FE2A 2YHNA 1VD4A 4UYEA 4P5OB 3V43A 4BW4A 5KU3A 4MR4A 3UVWA 4CLBA 4IR3A 5DBMA 5I7XA 5FERA 2RSDA 3HCUA 2JMDA 3HMFA 1WGMA 4Z1SA 3S91A 5FG6A 2H60A 5DKAA 2E7NA 4A9LA 5HLSA 4YATA 2MNYA 4RVRA 3ONIA 3IHPA 4NN2A 2D82A 2HDPA 4BW2A 4HBXA 3MB4A 4IR5A 4A4CA 4O7AA 2CSYA 3U5NA 5F63A 4UITA 5FE3A 3UVYA 5AD3A 3I3JA 2BAYA 2L43A 4TZ8A 4IC3A 4Z93A 3JVMA 1JM4B 4UIWA 5FH7A 4O75A 4C66A 5FH8A 2L0BA 4GNFA 2NXBA 3D7CA 4UYHA 2KU3A 5CTLA 3G0LA 5DY7A 2VPDA 2D9EA 2K4DA 3U5MA 5HEMA 5E9KA 5E74A 4I7DA 3U5OA 1WEVA 3N9QA 3LJWA 4GB0A 5H1VA 3RTRB 4QSWA 1CHCA 2RNYA 4UP5A 1WFKA 2RI7A 4UIZA 4J3IA 5I40A 2R0SA 3DPLR 5DFCA 3UV4A 2AN6A 4Z6IA 5DW2A 3MQMA 4KV4A 5HJCA 2KYUA 2M85A 2Y1NA 4UI9B 5EPBA 4HXSA 5I89A 4QSVA 3SOXA 3O35A 3LQJA 3Q2FA 2L80A 4LK9A 3UV2A 4Q0NA 2C2LA 2YSJA 4TYLA 2N9GA 4YH3A 4FK5A
chains in the Genus database with same CATH superfamily
5F1HA 5EWWA 5E73A 4QUTA 2M1RA 5E9YA 1WEWA 2KKYA 5SVXA 5FFWA 2CKLA 2WP1A 5E9IA 1X4IA 2LRIC 3FEHA 4NRAA 4CUSA 4O7CA 3LQHA 4TTEA 4B86C 2F6NA 2M6MA 4HBWA 5FB1A 3JVLA 5EVAA 4I7BA 5E7DA 3O33A 4L58A 3AQAA 5A85A 5IGLA 3PHDA 1WEQA 2WP2A 5CQ5A 5HFRA 2LGGA 2DATA 4NYXA 5CY9A 3UVXA 5K29A 4ALGA 2MJVB 2DX8A 2LGVA 4WA6A 4C9ZA 4QQ4A 4MVTA 3VKHA 2RNXA 2OXQC 3ASLA 4W4UA 5D3RA 5CQ6A 4AKIA 2DVVA 5FEYA 2YVRA 4OGIA 4UYFB 2K17A 3FL2A 5B76A 4X2IA 5L8UA 5LKZA 4QEWA 4YBMA 4Q6FA 5L99A 4YY4A 2YQDA 4QC1A 2RR4A 5JWMA 3KV5A 2R0YA 4H9DA 3DWDA 4S3OB 3T7LA 5ENIA 4LZ2A 5CQ4A 5F3AA 5C85A 3ZPVE 4MR5A 4N4FA 5D3SA 1ZS5A 5FBXA 2KE1A 3M62A 4AYCB 3HMHA 4NQMA 5CRMA 4WIVA 3N9PA 4XY9A 4NYVA 2I7KA 5G05B 3IU6A 2DVRA 4O7BA 5D3TA 5FE1A 4ALHA 4QB3A 1BORA 2KR4A 2Y43A 5HQ5A 4AUQB 1WEMA 4HXLA 1E6IA 5F5ZA 5A5RA 5II1A 2ECTA 2QICA 3ZPV1 5C13A 5FE0A 5CP5A 4R8PK 1WIMA 4YYJA 3HCTA 5FE7A 1G25A 5EICA 3MXFA 5D25A 5A5PA 2LDRA 5KHMA 5DW1A 5IG6A 4O62A 2G45A 5KH9A 5ENHA 2JM3A 2VNFA 3O36A 2M3HA 2YT5A 1WUGA 5C11A 4UYFA 4LZSA 5DFDA 4GNDA 5I7YA 4A4BA 2CSZA 5KH7A 5H85A 3K2JA 5HCLA 4BW3A 5LJ0A 5CS8A 5D3HA 3SVHA 1VYXA 2EGMA 2I50A 2KGIA 2XEUA 4A9KA 4V3LC 2MD8C 3EB5A 3O70A 4YAXA 4S3OC 5K3QA 1XWHA 5CRZA 3ZNIA 4UIXA 5SVYA 1N72A 5C8GA 3SVFA 4ZQLA 3UW9A 4AYCA 3P1CA 5D0CA 3ERRA 5EWHA 2D8SA 2MA5A 4WHWA 3RCWA 2OUOA 4MR6A 4Z6HA 3SVGA 5B8DA 4LYIA 4AI6A 3MULA 5ETDA 2FD4A 3QZSA 4PS5A 4O64A 5EISA 5I88A 2XP0A 3GG3A 5CQ3A 4N3WA 4NYWA 4LZRA 5F61A 4BBQA 1WE9A 2R10A 4ZUXU 5DYAA 2FFWA 4PCIA 3L1XA 4A9NA 1T1HA 4YYIA 5CQTA 3KQIA 1MM3A 5L8TA 2YW8A 2KWNA 5CUEA 2L5EA 4YH4A 5COIA 4O78A 2DJAA 4OGCA 2G6QA 3KDEC 3SUBA 2YQMA 2IQJA 3U5KA 4O7EA 4YYMA 5ENBA 2EXUA 4HXOA 3DDTA 3U5LA 2YYNA 5TCMA 5LVRA 5D1MB 2L5UA 5CFWA 3TLPA 5AMEA 4NUDA 5KTXA 4A9HA 5F60A 4CFKA 1FBVA 1K2FA 4MENA 3S92A 1V87A 5C7NA 3JUEA 5ENJA 4QSXA 2DVSA 2PNXA 2YYRA 4AP4A 5I3LA 4IOQA 2EGPA 5FE4A 3Q1DA 2VJEB 2VP7A 4R2YA 1JSPB 3O47A 4PTBA 4O7FA 4QR4A 3NG2A 2FUIA 4O76A 2M13A 3O7AA 2E6RA 5I83A 4BJXA 3JVKA 4HBVA 4E96A 1F68A 5FG5A 4QC3A 3ZYUA 4FIPA 1Z2QA 2B0OE 3HTKC 2ZETC 4MEQA 4NR6A 4NRCA 4XUBA 2GRCA 2L75A 4TKPB 3O34A 5LJ1A 1Z6UA 2RO1A 5I80A 1WILA 3DQVR 5ENCA 3KNVA 4LYWA 5CUGA 3D1DA 2EA6A 4QYDA 4CUPA 4ZDTA 3ZTGA 5BT4A 4XI1A 5AIUA 2EJNA 5A7CA 5HRWA 5JG6A 4YY6A 3G0JA 1E4UA 4TU4A 5F36A 4QR5A 1DVPA 2YW5A 5A5SA 5LJ2A 4YYDA 5FG4A 2QIZA 4KCXA 2MUMA 1F62A 2LGKA 2VJEA 4WZ0A 5I86A 1MBMA 4IC2A 5TRBA 2ECIA 2NAAA 3N9MA 4LYSA 5CUCA 2KWOA 2YEKA 5DINA 5LCWB 5DYXA 5EI4A 4LDFA 4Z1QA 5FE5A 5J3XA 4TT4A 3FANA 1WEUA 4MEPA 3PUQA 5EWCA 5EYAF 3U5JA 4CFLA 2LV9A 3ZVYA 4C67A 4A9FA 3LVQE 4NUCA 2CT2A 2YUCA 5ENEA 2YREA 3M99A 4O70A 4QYLA 2YEMA 4YYNA 4A9MA 2KTBB 4DONA 5EQ1A 3MB3A 5EK9A 5CUAA 5HM0A 2E6SA 3EB6A 4UIYA 5A5QA 3DAIA 2RS9B 3JVJA 5ACYA 4Y03A 5BT3A 4NR8A 2VJFB 2MD7B 4A9EA 5CQ8A 5D24A 5KO4A 2XB1A 4F1PA 4A0CD 2HYED 4NUEA 2UZGA 4LJNA 5EWDA 5EU1A 5HRXA 2LN0A 4A9JA 5I1QA 4MR3A 5G4RA 2K1JA 4QEUA 5CPEA 4ZW1A 3HCSA 4LKAA 4R7EA 5A82A 2FUUA 5D3PA 5LKUA 4CUUA 5FE8A 4QSSA 2E3KA 5TDWA 4J0SA 2F42A 2OWAA 5CQAA 2CKLB 2D8UA 2YSMA 4PPEA 4TT6A 4MSXA 1RMDA 4CL9A 3LDYA 3MDBC 2YELA 3N9OA 3LRQA 2JUNA 4TT2A 1IYMA 4LRGA 2LXPC 5DFBA 2L85A 3C6WA 4IR6A 5CUDA 2F6JA 5HFQA 3E2DA 4UYGA 4B7YC 4FO9A 4YK0A 4YABA 4Q0OA 1FP0A 4N4IA 4PCEA 2PUYA 4NXJA 4A9IA 4O72A 3NXBA 5CU8A 4CUTA 2H0DA 2P57A 4WZ2A 2VJFA 5KTUA 5LKTA 3SOWA 4XUAA 5EPRA 5TABA 5A83A 3PLWA 4CUQA 3ZYQA 3PURA 4QZSA 2R0VA 3P1EA 4ZC9A 4YADA 4QEVA 3UVDA 5LKXA 2DSMA 4CCGX 3N9NA 1VFYA 1U6GB 4BW1A 5L96A 5EV9A 5IGKA 4NS5A 2KFTA 5EWVA 4UIVA 5F62A 2MA6A 2JMJA 5D1LB 5B77A 4GPJA 1JM7A 2Y1MA 1Z60A 2RNWA 5TDRA 4YBSA 5J0DA 2DKWA 4WHUA 3N9LA 1DCQA 2OSSA 5DYUA 3LVRE 4XY8A 5F25A 5C89A 1LDKC 5F2PA 3GV4A 3P1DA 2KREA 2ECVA 5A5OA 5DKDA 5JI8A 2H0DB 2YDWA 3LXJA 4NR7A 4NR9A 3U5PA 4Z0RA 3HMEA 4O77A 1LDJB 4F52B 5AD2A 2DVQA 5B79A 1X4JA 4GNGA 5D1KB 4CA1A 2G43A 4F3IA 1HYIA 3P5OA 5LVQA 5D26A 3LQIA 4PY6A 5IBNA 3IU5A 3KV6A 2MT5A 4LC2A 5G04B 4OUFA 1WEEA 3D1BA 3VK6A 3UV5A 1MM2A 3O37A 5D3LA 5EPSA 2LGLA 3RPGC 5C87A 3QZTA 4IR4A 3QZVA 5EA1A 2KWKA 2MKEA 5FB0A 4QSRA 3M63A 2CRWA 3RPGB 5IGNA 1JM7B 5L98A 5CUBA 2CONA 2OO1A 4HBYA 5D3NA 4NR5A 3C5KA 5B75A 5KH3A 2YQLA 5TB6A 3H7HA 2VPBA 2YHOA 4QR3A 5EP7A 5EM3A 2XOZA 4QUUA 4IORA 1X0JA 4N4HA 3SOUA 5G4SA 5SVIB 5CZGA 3AADA 5IGMA 2ECJA 3VKGA 5E0RA 3FM8C 2VPGA 5CQ7A 4UYDA 4LADB 2MIQA 3DWYA 2I8NA 2ECGA 3P1FA 4QSPA 4QNSA 3GL6A 4QSUA 5KTWA 2YU4A 1WEPA 5CGPA 2QJ0A 2LAUA 4X3GA 4HXPA 4A9OA 1PUOA 4O71A 3T6RA 4BHWA 4HXKA 5FFYA 1WENA 4QF2A 4GNEA 2JRJA 3ZVZB 5E9LA 4TS8A 4IOOA 4FLPA 5H9MA 5G0FA 2L84A 5A5NA 2G4AA 2LSPB 4YYHA 2MNZA 4V3KC 5HQ6A 4YYGA 2LQ6A 4N4GA 3MUKA 5A81A 5FDZA 5DKHA 5DX4A 2FSAA 4QSTA 4YBTA 4LR6A 5L97A 5AMFA 4TQNA 5FE9A 3MHHA 5E9MA 4L7XA 4WZ3B 5SVIA 5D3JA 5HQ7A 2K16A 3MHSA 4XYAA 4FJCA 1WESA 4A49A 4UIUA 4NR4A 5AITA 4YYKA 4UP0A 4J0RA 5C4QA 2CRRA 2IDAA 4OGJA 5DYCA 2KGGA 2L7PA 4AVXA 5E3GA 4MEOA 2C2VS 2EODA 5DLZA 5D7XA 5HELA 2CSVA 5ENGA 2LXHC 5IIDA 5TBNA 4O74A 4AKNA 5HENA 5I29A 5FH6A 2KIZA 4HXNA 1N87A 5FE6A 1ZKRA 5ETBA 5H1UA 5F1LA 2KWJA 5E9VA 5E3DA 4QY4A 4HXMA 5DKCA 4TU6A 4NQNA 5HRVA 1EQFA 1WEOA 2ECNA 4LLBA 4HXRA 4TZ2A 5B78A 5H1TA 4QSQA 5DLXA 4QBMA 2VPEA 4PKLA 5II2A 3FKMX 3Q2EA 4CURA 5ENFA 3L1ZB 2ECWA 2RFJA 2YURA 1WUMA 3I2DA 1X4UA 5FFVA 2DWWA 3LJUX 4I7CA 5BT5A 1ZBDB 4NRBA 3L11A 4QF3A 4J1PA 5LUUA 5EGUA 4KV1A 2E7OA 2JMIA 3SHBA 3M7KA 1JOCA 4YC9A 1HYJA 5FE2A 2YHNA 1VD4A 4UYEA 4P5OB 3V43A 4BW4A 5KU3A 4MR4A 3UVWA 4CLBA 4IR3A 5DBMA 5I7XA 5FERA 2RSDA 3HCUA 2JMDA 3HMFA 1WGMA 4Z1SA 3S91A 5FG6A 3T9KA 2H60A 5DKAA 2E7NA 4A9LA 5HLSA 4YATA 2MNYA 4RVRA 3ONIA 3IHPA 4AKHA 4NN2A 2D82A 2HDPA 4BW2A 3FAOA 4HBXA 3MB4A 4IR5A 4A4CA 4O7AA 2CSYA 3U5NA 5F63A 4UITA 5FE3A 3UVYA 5AD3A 3I3JA 2BAYA 2L43A 4TZ8A 4IC3A 4Z93A 3JVMA 1JM4B 4UIWA 5FH7A 4O75A 4C66A 5FH8A 2L0BA 4GNFA 4Z0OA 4AKGA 2NXBA 3D7CA 4UYHA 2KU3A 5CTLA 3G0LA 5DY7A 2VPDA 2D9EA 2XOYA 2K4DA 3U5MA 5HEMA 5E9KA 5E74A 4I7DA 2KKXA 3U5OA 1WEVA 3N9QA 3LJWA 4GB0A 5H1VA 3RTRB 4QSWA 1CHCA 2RNYA 4UP5A 1WFKA 2RI7A 4UIZA 4J3IA 3FJUB 5I40A 2R0SA 3DPLR 5DFCA 3UV4A 2AN6A 4Z6IA 5DW2A 3MQMA 4KV4A 5HJCA 2KYUA 2M85A 2E61A 2Y1NA 5EPBA 4HXSA 5I89A 4QSVA 4UI9B 3O35A 4OGEA 3LQJA 3SOXA 3Q2FA 2L80A 2XOCA 4LK9A 3UV2A 4Q0NA 2C2LA 2YSJA 4TYLA 2N9GA 4YH3A 4FK5A
chains in the Genus database with same CATH topology
5F1HA 5EWWA 5E73A 4QUTA 2M1RA 5E9YA 1WEWA 5FFWA 2CKLA 2WP1A 5E9IA 1X4IA 2LRIC 4NRAA 4CUSA 4O7CA 3LQHA 4TTEA 4B86C 2F6NA 2M6MA 4HBWA 5FB1A 3JVLA 5EVAA 4I7BA 5E7DA 3O33A 4L58A 3AQAA 5A85A 5IGLA 3PHDA 1WEQA 2WP2A 5CQ5A 5HFRA 2LGGA 2DATA 4NYXA 5CY9A 3UVXA 5K29A 4ALGA 2MJVB 2DX8A 2LGVA 4WA6A 4C9ZA 4MVTA 2OXQC 2RNXA 3ASLA 4W4UA 5D3RA 5CQ6A 2DVVA 5FEYA 4OGIA 4UYFB 2K17A 3FL2A 5B76A 4X2IA 5L8UA 5LKZA 4QEWA 4YBMA 4Q6FA 5L99A 4YY4A 2YQDA 4QC1A 5JWMA 3KV5A 2R0YA 3T7LA 4S3OB 5ENIA 4LZ2A 5CQ4A 5F3AA 5C85A 3ZPVE 4MR5A 4N4FA 5D3SA 1ZS5A 5FBXA 2KE1A 3M62A 4AYCB 3HMHA 4NQMA 5CRMA 4WIVA 3N9PA 4XY9A 4NYVA 2I7KA 5G05B 3IU6A 2DVRA 4O7BA 5D3TA 5FE1A 4ALHA 4QB3A 1BORA 2KR4A 2Y43A 5HQ5A 4AUQB 1WEMA 4HXLA 1E6IA 5F5ZA 5A5RA 5II1A 2ECTA 2QICA 3ZPV1 5C13A 5FE0A 5CP5A 4R8PK 1WIMA 4YYJA 3HCTA 5FE7A 1G25A 5EICA 3MXFA 5D25A 5A5PA 2LDRA 5KHMA 5DW1A 5IG6A 2G45A 5KH9A 5ENHA 2VNFA 3O36A 2M3HA 2YT5A 1WUGA 5C11A 4UYFA 4LZSA 5DFDA 4GNDA 5I7YA 4A4BA 2CSZA 5KH7A 5H85A 3K2JA 5HCLA 4BW3A 5LJ0A 5CS8A 5D3HA 3SVHA 1VYXA 2I50A 2KGIA 2XEUA 4V3LC 4A9KA 2MD8C 3EB5A 3O70A 4YAXA 4S3OC 1XWHA 5CRZA 3ZNIA 4UIXA 1N72A 5C8GA 3SVFA 4ZQLA 3UW9A 4AYCA 3P1CA 5D0CA 5EWHA 2D8SA 2MA5A 4WHWA 3RCWA 2OUOA 4MR6A 4Z6HA 3SVGA 5B8DA 4LYIA 3MULA 5ETDA 3QZSA 4PS5A 4O64A 5EISA 5I88A 3GG3A 5CQ3A 4N3WA 4NYWA 4LZRA 5F61A 4BBQA 1WE9A 2R10A 4ZUXU 5DYAA 4PCIA 3L1XA 4A9NA 1T1HA 4YYIA 5CQTA 3KQIA 1MM3A 5L8TA 2YW8A 2KWNA 5CUEA 2L5EA 4YH4A 5COIA 4O78A 2G6QA 2YQMA 3U5KA 4O7EA 4YYMA 5ENBA 4HXOA 3U5LA 2YYNA 5TCMA 5LVRA 5D1MB 2L5UA 5CFWA 3TLPA 5AMEA 4NUDA 5KTXA 4A9HA 5F60A 4CFKA 1FBVA 1K2FA 4MENA 3S92A 1V87A 5C7NA 5ENJA 4QSXA 2DVSA 2PNXA 2YYRA 4AP4A 5I3LA 4IOQA 2EGPA 5FE4A 2VJEB 2VP7A 4R2YA 1JSPB 4PTBA 4O7FA 4QR4A 3NG2A 2FUIA 4O76A 3O7AA 2E6RA 5I83A 4BJXA 3JVKA 4HBVA 4E96A 1F68A 5FG5A 4QC3A 3ZYUA 4FIPA 1Z2QA 3HTKC 2ZETC 4MEQA 4NR6A 4NRCA 4XUBA 2GRCA 2L75A 4TKPB 3O34A 5LJ1A 1Z6UA 2RO1A 5I80A 1WILA 3DQVR 5ENCA 3KNVA 4LYWA 5CUGA 2EA6A 4QYDA 4CUPA 4ZDTA 3ZTGA 5BT4A 4XI1A 5AIUA 5A7CA 5HRWA 5JG6A 4YY6A 3G0JA 1E4UA 4TU4A 5F36A 4QR5A 1DVPA 2YW5A 5A5SA 5LJ2A 4YYDA 5FG4A 2QIZA 4KCXA 2MUMA 1F62A 2LGKA 2VJEA 4WZ0A 5I86A 4IC2A 5TRBA 2ECIA 2NAAA 3N9MA 4LYSA 5CUCA 2KWOA 2YEKA 5DINA 5LCWB 5DYXA 5EI4A 4LDFA 4Z1QA 5FE5A 5J3XA 4TT4A 1WEUA 4MEPA 3PUQA 5EWCA 5EYAF 3U5JA 4CFLA 2LV9A 3ZVYA 4C67A 4A9FA 4NUCA 2CT2A 2YUCA 5ENEA 2YREA 3M99A 4O70A 4QYLA 2YEMA 4YYNA 4A9MA 2KTBB 4DONA 5EQ1A 3MB3A 5EK9A 5CUAA 5HM0A 2E6SA 3EB6A 4UIYA 5A5QA 3DAIA 2RS9B 3JVJA 5ACYA 4Y03A 5BT3A 4NR8A 2VJFB 2MD7B 4A9EA 5CQ8A 5D24A 5KO4A 2XB1A 4A0CD 2HYED 4NUEA 2UZGA 4LJNA 5EWDA 5EU1A 5HRXA 2LN0A 4A9JA 5I1QA 4MR3A 5G4RA 2K1JA 4QEUA 5CPEA 4ZW1A 3HCSA 4LKAA 4R7EA 5A82A 2FUUA 5D3PA 5LKUA 4CUUA 5FE8A 4QSSA 2E3KA 5TDWA 4J0SA 2F42A 2YSMA 5CQAA 2CKLB 4PPEA 4TT6A 4MSXA 1RMDA 4CL9A 2YELA 3N9OA 3LRQA 4TT2A 1IYMA 4LRGA 2LXPC 5DFBA 2L85A 3C6WA 4IR6A 5CUDA 2F6JA 5HFQA 4B7YC 4UYGA 4FO9A 4YK0A 4YABA 4Q0OA 1FP0A 4N4IA 4PCEA 2PUYA 4NXJA 4A9IA 4O72A 3NXBA 5CU8A 4CUTA 2H0DA 4WZ2A 2VJFA 5KTUA 5LKTA 3SOWA 4XUAA 5EPRA 5TABA 5A83A 4CUQA 3ZYQA 3PURA 4QZSA 2R0VA 3P1EA 4ZC9A 4YADA 4QEVA 3UVDA 5LKXA 4CCGX 3N9NA 1VFYA 1U6GB 4BW1A 5L96A 5EV9A 5IGKA 4NS5A 2KFTA 5EWVA 4UIVA 5F62A 2MA6A 2JMJA 5D1LB 5B77A 4GPJA 1JM7A 2Y1MA 1Z60A 2RNWA 5TDRA 4YBSA 5J0DA 2DKWA 4WHUA 3N9LA 2OSSA 5DYUA 4XY8A 5F25A 5C89A 1LDKC 5F2PA 3GV4A 3P1DA 2KREA 2ECVA 5A5OA 5DKDA 5JI8A 2H0DB 2YDWA 3LXJA 4NR7A 4NR9A 3U5PA 4F52B 3HMEA 4O77A 1LDJB 5AD2A 2DVQA 5B79A 1X4JA 4GNGA 5D1KB 4CA1A 2G43A 4F3IA 1HYIA 3P5OA 5LVQA 5D26A 3LQIA 4PY6A 5IBNA 3IU5A 3KV6A 2MT5A 4LC2A 5G04B 4OUFA 1WEEA 3VK6A 3UV5A 1MM2A 3O37A 5D3LA 5EPSA 2LGLA 3RPGC 5C87A 3QZTA 4IR4A 3QZVA 5EA1A 2KWKA 3RPGB 5FB0A 4QSRA 3M63A 1JM7B 5IGNA 5L98A 5CUBA 2OO1A 4HBYA 5D3NA 4NR5A 3C5KA 5B75A 5KH3A 2YQLA 5TB6A 2VPBA 2YHOA 4QR3A 5EP7A 5EM3A 4QUUA 4IORA 1X0JA 4N4HA 3SOUA 5G4SA 5CZGA 3AADA 5IGMA 2ECJA 5E0RA 2VPGA 5CQ7A 4UYDA 4LADB 2MIQA 3DWYA 2I8NA 2ECGA 3P1FA 4QSPA 4QNSA 3GL6A 4QSUA 5KTWA 2YU4A 1WEPA 5CGPA 2QJ0A 4X3GA 4HXPA 4A9OA 4O71A 3T6RA 4BHWA 4HXKA 5FFYA 1WENA 4QF2A 4GNEA 2JRJA 3ZVZB 5E9LA 4TS8A 4IOOA 4FLPA 5H9MA 5G0FA 2L84A 5A5NA 2G4AA 2LSPB 4YYHA 2MNZA 4V3KC 5HQ6A 4YYGA 2LQ6A 4N4GA 3MUKA 5A81A 5FDZA 5DKHA 5DX4A 2FSAA 4QSTA 4YBTA 4LR6A 5L97A 5AMFA 4TQNA 5FE9A 3MHHA 5E9MA 4L7XA 4WZ3B 5D3JA 5HQ7A 2K16A 3MHSA 4XYAA 4FJCA 1WESA 4A49A 4UIUA 4NR4A 5AITA 4YYKA 4UP0A 4J0RA 5C4QA 4AVXA 2IDAA 4OGJA 5DYCA 2KGGA 5E3GA 4MEOA 2C2VS 2EODA 5DLZA 5D7XA 5HELA 5ENGA 2LXHC 5IIDA 5TBNA 4O74A 4AKNA 5HENA 5I29A 5FH6A 2KIZA 4HXNA 1N87A 5FE6A 5ETBA 5H1UA 5F1LA 2KWJA 5E9VA 5E3DA 4QY4A 4HXMA 5DKCA 4TU6A 4NQNA 5HRVA 1EQFA 1WEOA 2ECNA 4LLBA 4HXRA 4TZ2A 5B78A 5H1TA 4QSQA 5DLXA 4QBMA 2VPEA 4PKLA 5II2A 3FKMX 3Q2EA 4CURA 5ENFA 3L1ZB 2ECWA 2RFJA 2YURA 1WUMA 3I2DA 1X4UA 5FFVA 2DWWA 4I7CA 5BT5A 1ZBDB 4NRBA 3L11A 4QF3A 4J1PA 5LUUA 5EGUA 4KV1A 2E7OA 2JMIA 3SHBA 1JOCA 4YC9A 1HYJA 5FE2A 2YHNA 1VD4A 4UYEA 4P5OB 3V43A 4BW4A 5KU3A 4MR4A 3UVWA 4CLBA 4IR3A 5DBMA 5I7XA 5FERA 2RSDA 3HCUA 2JMDA 3HMFA 1WGMA 4Z1SA 3S91A 5FG6A 2H60A 5DKAA 2E7NA 4A9LA 5HLSA 4YATA 2MNYA 4RVRA 3ONIA 3IHPA 4NN2A 2D82A 2HDPA 4BW2A 4HBXA 3MB4A 4IR5A 4A4CA 4O7AA 2CSYA 3U5NA 5F63A 4UITA 5FE3A 3UVYA 5AD3A 3I3JA 2BAYA 2L43A 4TZ8A 4IC3A 4Z93A 3JVMA 1JM4B 4UIWA 5FH7A 4O75A 4C66A 5FH8A 2L0BA 4GNFA 2NXBA 3D7CA 4UYHA 2KU3A 5CTLA 3G0LA 5DY7A 2VPDA 2D9EA 2K4DA 3U5MA 5HEMA 5E9KA 5E74A 4I7DA 3U5OA 1WEVA 3N9QA 3LJWA 4GB0A 5H1VA 3RTRB 4QSWA 1CHCA 2RNYA 4UP5A 1WFKA 2RI7A 4UIZA 4J3IA 5I40A 2R0SA 3DPLR 5DFCA 3UV4A 2AN6A 4Z6IA 5DW2A 3MQMA 4KV4A 5HJCA 2KYUA 2M85A 2Y1NA 4UI9B 5EPBA 4HXSA 5I89A 4QSVA 3SOXA 3O35A 3LQJA 3Q2FA 2L80A 4LK9A 3UV2A 4Q0NA 2C2LA 2YSJA 4TYLA 2N9GA 4YH3A 4FK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1H A;  5EWW A;  5E73 A;  4QUT A;  2M1R A;  5E9Y A;  1WEW A;  5FFW A;  2CKL A;  2WP1 A;  5E9I A;  1X4I A;  2LRI C;  4NRA A;  4CUS A;  4O7C A;  3LQH A;  4TTE A;  4B86 C;  2F6N A;  2M6M A;  4HBW A;  5FB1 A;  3JVL A;  5EVA A;  4I7B A;  5E7D A;  3O33 A;  4L58 A;  3AQA A;  5A85 A;  5IGL A;  3PHD A;  1WEQ A;  2WP2 A;  5CQ5 A;  5HFR A;  2LGG A;  2DAT A;  4NYX A;  5CY9 A;  3UVX A;  5K29 A;  4ALG A;  2MJV B;  2DX8 A;  2LGV A;  4WA6 A;  4C9Z A;  4MVT A;  2OXQ C;  2RNX A;  3ASL A;  4W4U A;  5D3R A;  5CQ6 A;  2DVV A;  5FEY A;  4OGI A;  4UYF B;  2K17 A;  3FL2 A;  5B76 A;  4X2I A;  5L8U A;  5LKZ A;  4QEW A;  4YBM A;  4Q6F A;  5L99 A;  4YY4 A;  2YQD A;  4QC1 A;  5JWM A;  3KV5 A;  2R0Y A;  3T7L A;  4S3O B;  5ENI A;  4LZ2 A;  5CQ4 A;  5F3A A;  5C85 A;  3ZPV E;  4MR5 A;  4N4F A;  5D3S A;  1ZS5 A;  5FBX A;  2KE1 A;  3M62 A;  4AYC B;  3HMH A;  4NQM A;  5CRM A;  4WIV A;  3N9P A;  4XY9 A;  4NYV A;  2I7K A;  5G05 B;  3IU6 A;  2DVR A;  4O7B A;  5D3T A;  5FE1 A;  4ALH A;  4QB3 A;  1BOR A;  2KR4 A;  2Y43 A;  5HQ5 A;  4AUQ B;  1WEM A;  4HXL A;  1E6I A;  5F5Z A;  5A5R A;  5II1 A;  2ECT A;  2QIC A;  3ZPV 1;  5C13 A;  5FE0 A;  5CP5 A;  4R8P K;  1WIM A;  4YYJ A;  3HCT A;  5FE7 A;  1G25 A;  5EIC A;  3MXF A;  5D25 A;  5A5P A;  2LDR A;  5KHM A;  5DW1 A;  5IG6 A;  2G45 A;  5KH9 A;  5ENH A;  2VNF A;  3O36 A;  2M3H A;  2YT5 A;  1WUG A;  5C11 A;  4UYF A;  4LZS A;  5DFD A;  4GND A;  5I7Y A;  4A4B A;  2CSZ A;  5KH7 A;  5H85 A;  3K2J A;  5HCL A;  4BW3 A;  5LJ0 A;  5CS8 A;  5D3H A;  3SVH A;  1VYX A;  2I50 A;  2KGI A;  2XEU A;  4V3L C;  4A9K A;  2MD8 C;  3EB5 A;  3O70 A;  4YAX A;  4S3O C;  1XWH A;  5CRZ A;  3ZNI A;  4UIX A;  1N72 A;  5C8G A;  3SVF A;  4ZQL A;  3UW9 A;  4AYC A;  3P1C A;  5D0C A;  5EWH A;  2D8S A;  2MA5 A;  4WHW A;  3RCW A;  2OUO A;  4MR6 A;  4Z6H A;  3SVG A;  5B8D A;  4LYI A;  3MUL A;  5ETD A;  3QZS A;  4PS5 A;  4O64 A;  5EIS A;  5I88 A;  3GG3 A;  5CQ3 A;  4N3W A;  4NYW A;  4LZR A;  5F61 A;  4BBQ A;  1WE9 A;  2R10 A;  4ZUX U;  5DYA A;  4PCI A;  3L1X A;  4A9N A;  1T1H A;  4YYI A;  5CQT A;  3KQI A;  1MM3 A;  5L8T A;  2YW8 A;  2KWN A;  5CUE A;  2L5E A;  4YH4 A;  5COI A;  4O78 A;  2G6Q A;  2YQM A;  3U5K A;  4O7E A;  4YYM A;  5ENB A;  4HXO A;  3U5L A;  2YYN A;  5TCM A;  5LVR A;  5D1M B;  2L5U A;  5CFW A;  3TLP A;  5AME A;  4NUD A;  5KTX A;  4A9H A;  5F60 A;  4CFK A;  1FBV A;  1K2F A;  4MEN A;  3S92 A;  1V87 A;  5C7N A;  5ENJ A;  4QSX A;  2DVS A;  2PNX A;  2YYR A;  4AP4 A;  5I3L A;  4IOQ A;  2EGP A;  5FE4 A;  2VJE B;  2VP7 A;  4R2Y A;  1JSP B;  4PTB A;  4O7F A;  4QR4 A;  3NG2 A;  2FUI A;  4O76 A;  3O7A A;  2E6R A;  5I83 A;  4BJX A;  3JVK A;  4HBV A;  4E96 A;  1F68 A;  5FG5 A;  4QC3 A;  3ZYU A;  4FIP A;  1Z2Q A;  3HTK C;  2ZET C;  4MEQ A;  4NR6 A;  4NRC A;  4XUB A;  2GRC A;  2L75 A;  4TKP B;  3O34 A;  5LJ1 A;  1Z6U A;  2RO1 A;  5I80 A;  1WIL A;  3DQV R;  5ENC A;  3KNV A;  4LYW A;  5CUG A;  2EA6 A;  4QYD A;  4CUP A;  4ZDT A;  3ZTG A;  5BT4 A;  4XI1 A;  5AIU A;  5A7C A;  5HRW A;  5JG6 A;  4YY6 A;  3G0J A;  1E4U A;  4TU4 A;  5F36 A;  4QR5 A;  1DVP A;  2YW5 A;  5A5S A;  5LJ2 A;  4YYD A;  5FG4 A;  2QIZ A;  4KCX A;  2MUM A;  1F62 A;  2LGK A;  2VJE A;  4WZ0 A;  5I86 A;  4IC2 A;  5TRB A;  2ECI A;  2NAA A;  3N9M A;  4LYS A;  5CUC A;  2KWO A;  2YEK A;  5DIN A;  5LCW B;  5DYX A;  5EI4 A;  4LDF A;  4Z1Q A;  5FE5 A;  5J3X A;  4TT4 A;  1WEU A;  4MEP A;  3PUQ A;  5EWC A;  5EYA F;  3U5J A;  4CFL A;  2LV9 A;  3ZVY A;  4C67 A;  4A9F A;  4NUC A;  2CT2 A;  2YUC A;  5ENE A;  2YRE A;  3M99 A;  4O70 A;  4QYL A;  2YEM A;  4YYN A;  4A9M A;  2KTB B;  4DON A;  5EQ1 A;  3MB3 A;  5EK9 A;  5CUA A;  5HM0 A;  2E6S A;  3EB6 A;  4UIY A;  5A5Q A;  3DAI A;  2RS9 B;  3JVJ A;  5ACY A;  4Y03 A;  5BT3 A;  4NR8 A;  2VJF B;  2MD7 B;  4A9E A;  5CQ8 A;  5D24 A;  5KO4 A;  2XB1 A;  4A0C D;  2HYE D;  4NUE A;  2UZG A;  4LJN A;  5EWD A;  5EU1 A;  5HRX A;  2LN0 A;  4A9J A;  5I1Q A;  4MR3 A;  5G4R A;  2K1J A;  4QEU A;  5CPE A;  4ZW1 A;  3HCS A;  4LKA A;  4R7E A;  5A82 A;  2FUU A;  5D3P A;  5LKU A;  4CUU A;  5FE8 A;  4QSS A;  2E3K A;  5TDW A;  4J0S A;  2F42 A;  2YSM A;  5CQA A;  2CKL B;  4PPE A;  4TT6 A;  4MSX A;  1RMD A;  4CL9 A;  2YEL A;  3N9O A;  3LRQ A;  4TT2 A;  1IYM A;  4LRG A;  2LXP C;  5DFB A;  2L85 A;  3C6W A;  4IR6 A;  5CUD A;  2F6J A;  5HFQ A;  4B7Y C;  4UYG A;  4FO9 A;  4YK0 A;  4YAB A;  4Q0O A;  1FP0 A;  4N4I A;  4PCE A;  2PUY A;  4NXJ A;  4A9I A;  4O72 A;  3NXB A;  5CU8 A;  4CUT A;  2H0D A;  4WZ2 A;  2VJF A;  5KTU A;  5LKT A;  3SOW A;  4XUA A;  5EPR A;  5TAB A;  5A83 A;  4CUQ A;  3ZYQ A;  3PUR A;  4QZS A;  2R0V A;  3P1E A;  4ZC9 A;  4YAD A;  4QEV A;  3UVD A;  5LKX A;  4CCG X;  3N9N A;  1VFY A;  1U6G B;  4BW1 A;  5L96 A;  5EV9 A;  5IGK A;  4NS5 A;  2KFT A;  5EWV A;  4UIV A;  5F62 A;  2MA6 A;  2JMJ A;  5D1L B;  5B77 A;  4GPJ A;  1JM7 A;  2Y1M A;  1Z60 A;  2RNW A;  5TDR A;  4YBS A;  5J0D A;  2DKW A;  4WHU A;  3N9L A;  2OSS A;  5DYU A;  4XY8 A;  5F25 A;  5C89 A;  1LDK C;  5F2P A;  3GV4 A;  3P1D A;  2KRE A;  2ECV A;  5A5O A;  5DKD A;  5JI8 A;  2H0D B;  2YDW A;  3LXJ A;  4NR7 A;  4NR9 A;  3U5P A;  4F52 B;  3HME A;  4O77 A;  1LDJ B;  5AD2 A;  2DVQ A;  5B79 A;  1X4J A;  4GNG A;  5D1K B;  4CA1 A;  2G43 A;  4F3I A;  1HYI A;  3P5O A;  5LVQ A;  5D26 A;  3LQI A;  4PY6 A;  5IBN A;  3IU5 A;  3KV6 A;  2MT5 A;  4LC2 A;  5G04 B;  4OUF A;  1WEE A;  3VK6 A;  3UV5 A;  1MM2 A;  3O37 A;  5D3L A;  5EPS A;  2LGL A;  3RPG C;  5C87 A;  3QZT A;  4IR4 A;  3QZV A;  5EA1 A;  2KWK A;  3RPG B;  5FB0 A;  4QSR A;  3M63 A;  1JM7 B;  5IGN A;  5L98 A;  5CUB A;  2OO1 A;  4HBY A;  5D3N A;  4NR5 A;  3C5K A;  5B75 A;  5KH3 A;  2YQL A;  5TB6 A;  2VPB A;  2YHO A;  4QR3 A;  5EP7 A;  5EM3 A;  4QUU A;  4IOR A;  1X0J A;  4N4H A;  3SOU A;  5G4S A;  5CZG A;  3AAD A;  5IGM A;  2ECJ A;  5E0R A;  2VPG A;  5CQ7 A;  4UYD A;  4LAD B;  2MIQ A;  3DWY A;  2I8N A;  2ECG A;  3P1F A;  4QSP A;  4QNS A;  3GL6 A;  4QSU A;  5KTW A;  2YU4 A;  1WEP A;  5CGP A;  2QJ0 A;  4X3G A;  4HXP A;  4A9O A;  4O71 A;  3T6R A;  4BHW A;  4HXK A;  5FFY A;  1WEN A;  4QF2 A;  4GNE A;  2JRJ A;  3ZVZ B;  5E9L A;  4TS8 A;  4IOO A;  4FLP A;  5H9M A;  5G0F A;  2L84 A;  5A5N A;  2G4A A;  2LSP B;  4YYH A;  2MNZ A;  4V3K C;  5HQ6 A;  4YYG A;  2LQ6 A;  4N4G A;  3MUK A;  5A81 A;  5FDZ A;  5DKH A;  5DX4 A;  2FSA A;  4QST A;  4YBT A;  4LR6 A;  5L97 A;  5AMF A;  4TQN A;  5FE9 A;  3MHH A;  5E9M A;  4L7X A;  4WZ3 B;  5D3J A;  5HQ7 A;  2K16 A;  3MHS A;  4XYA A;  4FJC A;  1WES A;  4A49 A;  4UIU A;  4NR4 A;  5AIT A;  4YYK A;  4UP0 A;  4J0R A;  5C4Q A;  4AVX A;  2IDA A;  4OGJ A;  5DYC A;  2KGG A;  5E3G A;  4MEO A;  2C2V S;  2EOD A;  5DLZ A;  5D7X A;  5HEL A;  5ENG A;  2LXH C;  5IID A;  5TBN A;  4O74 A;  4AKN A;  5HEN A;  5I29 A;  5FH6 A;  2KIZ A;  4HXN A;  1N87 A;  5FE6 A;  5ETB A;  5H1U A;  5F1L A;  2KWJ A;  5E9V A;  5E3D A;  4QY4 A;  4HXM A;  5DKC A;  4TU6 A;  4NQN A;  5HRV A;  1EQF A;  1WEO A;  2ECN A;  4LLB A;  4HXR A;  4TZ2 A;  5B78 A;  5H1T A;  4QSQ A;  5DLX A;  4QBM A;  2VPE A;  4PKL A;  5II2 A;  3FKM X;  3Q2E A;  4CUR A;  5ENF A;  3L1Z B;  2ECW A;  2RFJ A;  2YUR A;  1WUM A;  3I2D A;  1X4U A;  5FFV A;  2DWW A;  4I7C A;  5BT5 A;  1ZBD B;  4NRB A;  3L11 A;  4QF3 A;  4J1P A;  5LUU A;  5EGU A;  4KV1 A;  2E7O A;  2JMI A;  3SHB A;  1JOC A;  4YC9 A;  1HYJ A;  5FE2 A;  2YHN A;  1VD4 A;  4UYE A;  4P5O B;  3V43 A;  4BW4 A;  5KU3 A;  4MR4 A;  3UVW A;  4CLB A;  4IR3 A;  5DBM A;  5I7X A;  5FER A;  2RSD A;  3HCU A;  2JMD A;  3HMF A;  1WGM A;  4Z1S A;  3S91 A;  5FG6 A;  2H60 A;  5DKA A;  2E7N A;  4A9L A;  5HLS A;  4YAT A;  2MNY A;  4RVR A;  3ONI A;  3IHP A;  4NN2 A;  2D82 A;  2HDP A;  4BW2 A;  4HBX A;  3MB4 A;  4IR5 A;  4A4C A;  4O7A A;  2CSY A;  3U5N A;  5F63 A;  4UIT A;  5FE3 A;  3UVY A;  5AD3 A;  3I3J A;  2BAY A;  2L43 A;  4TZ8 A;  4IC3 A;  4Z93 A;  3JVM A;  1JM4 B;  4UIW A;  5FH7 A;  4O75 A;  4C66 A;  5FH8 A;  2L0B A;  4GNF A;  2NXB A;  3D7C A;  4UYH A;  2KU3 A;  5CTL A;  3G0L A;  5DY7 A;  2VPD A;  2D9E A;  2K4D A;  3U5M A;  5HEM A;  5E9K A;  5E74 A;  4I7D A;  3U5O A;  1WEV A;  3N9Q A;  3LJW A;  4GB0 A;  5H1V A;  3RTR B;  4QSW A;  1CHC A;  2RNY A;  4UP5 A;  1WFK A;  2RI7 A;  4UIZ A;  4J3I A;  5I40 A;  2R0S A;  3DPL R;  5DFC A;  3UV4 A;  2AN6 A;  4Z6I A;  5DW2 A;  3MQM A;  4KV4 A;  5HJC A;  2KYU A;  2M85 A;  2Y1N A;  4UI9 B;  5EPB A;  4HXS A;  5I89 A;  4QSV A;  3SOX A;  3O35 A;  3LQJ A;  3Q2F A;  2L80 A;  4LK9 A;  3UV2 A;  4Q0N A;  2C2L A;  2YSJ A;  4TYL A;  2N9G A;  4YH3 A;  4FK5 A; 
#chains in the Genus database with same CATH topology
 5F1H A;  5EWW A;  5E73 A;  4QUT A;  2M1R A;  5E9Y A;  1WEW A;  2KKY A;  5SVX A;  5FFW A;  2CKL A;  2WP1 A;  5E9I A;  1X4I A;  2LRI C;  3FEH A;  4NRA A;  4CUS A;  4O7C A;  3LQH A;  4TTE A;  4B86 C;  2F6N A;  2M6M A;  4HBW A;  5FB1 A;  3JVL A;  5EVA A;  4I7B A;  5E7D A;  3O33 A;  4L58 A;  3AQA A;  5A85 A;  5IGL A;  3PHD A;  1WEQ A;  2WP2 A;  5CQ5 A;  5HFR A;  2LGG A;  2DAT A;  4NYX A;  5CY9 A;  3UVX A;  5K29 A;  4ALG A;  2MJV B;  2DX8 A;  2LGV A;  4WA6 A;  4C9Z A;  4QQ4 A;  4MVT A;  3VKH A;  2RNX A;  2OXQ C;  3ASL A;  4W4U A;  5D3R A;  5CQ6 A;  4AKI A;  2DVV A;  5FEY A;  2YVR A;  4OGI A;  4UYF B;  2K17 A;  3FL2 A;  5B76 A;  4X2I A;  5L8U A;  5LKZ A;  4QEW A;  4YBM A;  4Q6F A;  5L99 A;  4YY4 A;  2YQD A;  4QC1 A;  2RR4 A;  5JWM A;  3KV5 A;  2R0Y A;  4H9D A;  3DWD A;  4S3O B;  3T7L A;  5ENI A;  4LZ2 A;  5CQ4 A;  5F3A A;  5C85 A;  3ZPV E;  4MR5 A;  4N4F A;  5D3S A;  1ZS5 A;  5FBX A;  2KE1 A;  3M62 A;  4AYC B;  3HMH A;  4NQM A;  5CRM A;  4WIV A;  3N9P A;  4XY9 A;  4NYV A;  2I7K A;  5G05 B;  3IU6 A;  2DVR A;  4O7B A;  5D3T A;  5FE1 A;  4ALH A;  4QB3 A;  1BOR A;  2KR4 A;  2Y43 A;  5HQ5 A;  4AUQ B;  1WEM A;  4HXL A;  1E6I A;  5F5Z A;  5A5R A;  5II1 A;  2ECT A;  2QIC A;  3ZPV 1;  5C13 A;  5FE0 A;  5CP5 A;  4R8P K;  1WIM A;  4YYJ A;  3HCT A;  5FE7 A;  1G25 A;  5EIC A;  3MXF A;  5D25 A;  5A5P A;  2LDR A;  5KHM A;  5DW1 A;  5IG6 A;  4O62 A;  2G45 A;  5KH9 A;  5ENH A;  2JM3 A;  2VNF A;  3O36 A;  2M3H A;  2YT5 A;  1WUG A;  5C11 A;  4UYF A;  4LZS A;  5DFD A;  4GND A;  5I7Y A;  4A4B A;  2CSZ A;  5KH7 A;  5H85 A;  3K2J A;  5HCL A;  4BW3 A;  5LJ0 A;  5CS8 A;  5D3H A;  3SVH A;  1VYX A;  2EGM A;  2I50 A;  2KGI A;  2XEU A;  4A9K A;  4V3L C;  2MD8 C;  3EB5 A;  3O70 A;  4YAX A;  4S3O C;  5K3Q A;  1XWH A;  5CRZ A;  3ZNI A;  4UIX A;  5SVY A;  1N72 A;  5C8G A;  3SVF A;  4ZQL A;  3UW9 A;  4AYC A;  3P1C A;  5D0C A;  3ERR A;  5EWH A;  2D8S A;  2MA5 A;  4WHW A;  3RCW A;  2OUO A;  4MR6 A;  4Z6H A;  3SVG A;  5B8D A;  4LYI A;  4AI6 A;  3MUL A;  5ETD A;  2FD4 A;  3QZS A;  4PS5 A;  4O64 A;  5EIS A;  5I88 A;  2XP0 A;  3GG3 A;  5CQ3 A;  4N3W A;  4NYW A;  4LZR A;  5F61 A;  4BBQ A;  1WE9 A;  2R10 A;  4ZUX U;  5DYA A;  2FFW A;  4PCI A;  3L1X A;  4A9N A;  1T1H A;  4YYI A;  5CQT A;  3KQI A;  1MM3 A;  5L8T A;  2YW8 A;  2KWN A;  5CUE A;  2L5E A;  4YH4 A;  5COI A;  4O78 A;  2DJA A;  4OGC A;  2G6Q A;  3KDE C;  3SUB A;  2YQM A;  2IQJ A;  3U5K A;  4O7E A;  4YYM A;  5ENB A;  2EXU A;  4HXO A;  3DDT A;  3U5L A;  2YYN A;  5TCM A;  5LVR A;  5D1M B;  2L5U A;  5CFW A;  3TLP A;  5AME A;  4NUD A;  5KTX A;  4A9H A;  5F60 A;  4CFK A;  1FBV A;  1K2F A;  4MEN A;  3S92 A;  1V87 A;  5C7N A;  3JUE A;  5ENJ A;  4QSX A;  2DVS A;  2PNX A;  2YYR A;  4AP4 A;  5I3L A;  4IOQ A;  2EGP A;  5FE4 A;  3Q1D A;  2VJE B;  2VP7 A;  4R2Y A;  1JSP B;  3O47 A;  4PTB A;  4O7F A;  4QR4 A;  3NG2 A;  2FUI A;  4O76 A;  2M13 A;  3O7A A;  2E6R A;  5I83 A;  4BJX A;  3JVK A;  4HBV A;  4E96 A;  1F68 A;  5FG5 A;  4QC3 A;  3ZYU A;  4FIP A;  1Z2Q A;  2B0O E;  3HTK C;  2ZET C;  4MEQ A;  4NR6 A;  4NRC A;  4XUB A;  2GRC A;  2L75 A;  4TKP B;  3O34 A;  5LJ1 A;  1Z6U A;  2RO1 A;  5I80 A;  1WIL A;  3DQV R;  5ENC A;  3KNV A;  4LYW A;  5CUG A;  3D1D A;  2EA6 A;  4QYD A;  4CUP A;  4ZDT A;  3ZTG A;  5BT4 A;  4XI1 A;  5AIU A;  2EJN A;  5A7C A;  5HRW A;  5JG6 A;  4YY6 A;  3G0J A;  1E4U A;  4TU4 A;  5F36 A;  4QR5 A;  1DVP A;  2YW5 A;  5A5S A;  5LJ2 A;  4YYD A;  5FG4 A;  2QIZ A;  4KCX A;  2MUM A;  1F62 A;  2LGK A;  2VJE A;  4WZ0 A;  5I86 A;  1MBM A;  4IC2 A;  5TRB A;  2ECI A;  2NAA A;  3N9M A;  4LYS A;  5CUC A;  2KWO A;  2YEK A;  5DIN A;  5LCW B;  5DYX A;  5EI4 A;  4LDF A;  4Z1Q A;  5FE5 A;  5J3X A;  4TT4 A;  3FAN A;  1WEU A;  4MEP A;  3PUQ A;  5EWC A;  5EYA F;  3U5J A;  4CFL A;  2LV9 A;  3ZVY A;  4C67 A;  4A9F A;  3LVQ E;  4NUC A;  2CT2 A;  2YUC A;  5ENE A;  2YRE A;  3M99 A;  4O70 A;  4QYL A;  2YEM A;  4YYN A;  4A9M A;  2KTB B;  4DON A;  5EQ1 A;  3MB3 A;  5EK9 A;  5CUA A;  5HM0 A;  2E6S A;  3EB6 A;  4UIY A;  5A5Q A;  3DAI A;  2RS9 B;  3JVJ A;  5ACY A;  4Y03 A;  5BT3 A;  4NR8 A;  2VJF B;  2MD7 B;  4A9E A;  5CQ8 A;  5D24 A;  5KO4 A;  2XB1 A;  4F1P A;  4A0C D;  2HYE D;  4NUE A;  2UZG A;  4LJN A;  5EWD A;  5EU1 A;  5HRX A;  2LN0 A;  4A9J A;  5I1Q A;  4MR3 A;  5G4R A;  2K1J A;  4QEU A;  5CPE A;  4ZW1 A;  3HCS A;  4LKA A;  4R7E A;  5A82 A;  2FUU A;  5D3P A;  5LKU A;  4CUU A;  5FE8 A;  4QSS A;  2E3K A;  5TDW A;  4J0S A;  2F42 A;  2OWA A;  5CQA A;  2CKL B;  2D8U A;  2YSM A;  4PPE A;  4TT6 A;  4MSX A;  1RMD A;  4CL9 A;  3LDY A;  3MDB C;  2YEL A;  3N9O A;  3LRQ A;  2JUN A;  4TT2 A;  1IYM A;  4LRG A;  2LXP C;  5DFB A;  2L85 A;  3C6W A;  4IR6 A;  5CUD A;  2F6J A;  5HFQ A;  3E2D A;  4UYG A;  4B7Y C;  4FO9 A;  4YK0 A;  4YAB A;  4Q0O A;  1FP0 A;  4N4I A;  4PCE A;  2PUY A;  4NXJ A;  4A9I A;  4O72 A;  3NXB A;  5CU8 A;  4CUT A;  2H0D A;  2P57 A;  4WZ2 A;  2VJF A;  5KTU A;  5LKT A;  3SOW A;  4XUA A;  5EPR A;  5TAB A;  5A83 A;  3PLW A;  4CUQ A;  3ZYQ A;  3PUR A;  4QZS A;  2R0V A;  3P1E A;  4ZC9 A;  4YAD A;  4QEV A;  3UVD A;  5LKX A;  2DSM A;  4CCG X;  3N9N A;  1VFY A;  1U6G B;  4BW1 A;  5L96 A;  5EV9 A;  5IGK A;  4NS5 A;  2KFT A;  5EWV A;  4UIV A;  5F62 A;  2MA6 A;  2JMJ A;  5D1L B;  5B77 A;  4GPJ A;  1JM7 A;  2Y1M A;  1Z60 A;  2RNW A;  5TDR A;  4YBS A;  5J0D A;  2DKW A;  4WHU A;  3N9L A;  1DCQ A;  2OSS A;  5DYU A;  3LVR E;  4XY8 A;  5F25 A;  5C89 A;  1LDK C;  5F2P A;  3GV4 A;  3P1D A;  2KRE A;  2ECV A;  5A5O A;  5DKD A;  5JI8 A;  2H0D B;  2YDW A;  3LXJ A;  4NR7 A;  4NR9 A;  3U5P A;  4Z0R A;  3HME A;  4O77 A;  1LDJ B;  4F52 B;  5AD2 A;  2DVQ A;  5B79 A;  1X4J A;  4GNG A;  5D1K B;  4CA1 A;  2G43 A;  4F3I A;  1HYI A;  3P5O A;  5LVQ A;  5D26 A;  3LQI A;  4PY6 A;  5IBN A;  3IU5 A;  3KV6 A;  2MT5 A;  4LC2 A;  5G04 B;  4OUF A;  1WEE A;  3D1B A;  3VK6 A;  3UV5 A;  1MM2 A;  3O37 A;  5D3L A;  5EPS A;  2LGL A;  3RPG C;  5C87 A;  3QZT A;  4IR4 A;  3QZV A;  5EA1 A;  2KWK A;  2MKE A;  5FB0 A;  4QSR A;  3M63 A;  2CRW A;  3RPG B;  5IGN A;  1JM7 B;  5L98 A;  5CUB A;  2CON A;  2OO1 A;  4HBY A;  5D3N A;  4NR5 A;  3C5K A;  5B75 A;  5KH3 A;  2YQL A;  5TB6 A;  3H7H A;  2VPB A;  2YHO A;  4QR3 A;  5EP7 A;  5EM3 A;  2XOZ A;  4QUU A;  4IOR A;  1X0J A;  4N4H A;  3SOU A;  5G4S A;  5SVI B;  5CZG A;  3AAD A;  5IGM A;  2ECJ A;  3VKG A;  5E0R A;  3FM8 C;  2VPG A;  5CQ7 A;  4UYD A;  4LAD B;  2MIQ A;  3DWY A;  2I8N A;  2ECG A;  3P1F A;  4QSP A;  4QNS A;  3GL6 A;  4QSU A;  5KTW A;  2YU4 A;  1WEP A;  5CGP A;  2QJ0 A;  2LAU A;  4X3G A;  4HXP A;  4A9O A;  1PUO A;  4O71 A;  3T6R A;  4BHW A;  4HXK A;  5FFY A;  1WEN A;  4QF2 A;  4GNE A;  2JRJ A;  3ZVZ B;  5E9L A;  4TS8 A;  4IOO A;  4FLP A;  5H9M A;  5G0F A;  2L84 A;  5A5N A;  2G4A A;  2LSP B;  4YYH A;  2MNZ A;  4V3K C;  5HQ6 A;  4YYG A;  2LQ6 A;  4N4G A;  3MUK A;  5A81 A;  5FDZ A;  5DKH A;  5DX4 A;  2FSA A;  4QST A;  4YBT A;  4LR6 A;  5L97 A;  5AMF A;  4TQN A;  5FE9 A;  3MHH A;  5E9M A;  4L7X A;  4WZ3 B;  5SVI A;  5D3J A;  5HQ7 A;  2K16 A;  3MHS A;  4XYA A;  4FJC A;  1WES A;  4A49 A;  4UIU A;  4NR4 A;  5AIT A;  4YYK A;  4UP0 A;  4J0R A;  5C4Q A;  2CRR A;  2IDA A;  4OGJ A;  5DYC A;  2KGG A;  2L7P A;  4AVX A;  5E3G A;  4MEO A;  2C2V S;  2EOD A;  5DLZ A;  5D7X A;  5HEL A;  2CSV A;  5ENG A;  2LXH C;  5IID A;  5TBN A;  4O74 A;  4AKN A;  5HEN A;  5I29 A;  5FH6 A;  2KIZ A;  4HXN A;  1N87 A;  5FE6 A;  1ZKR A;  5ETB A;  5H1U A;  5F1L A;  2KWJ A;  5E9V A;  5E3D A;  4QY4 A;  4HXM A;  5DKC A;  4TU6 A;  4NQN A;  5HRV A;  1EQF A;  1WEO A;  2ECN A;  4LLB A;  4HXR A;  4TZ2 A;  5B78 A;  5H1T A;  4QSQ A;  5DLX A;  4QBM A;  2VPE A;  4PKL A;  5II2 A;  3FKM X;  3Q2E A;  4CUR A;  5ENF A;  3L1Z B;  2ECW A;  2RFJ A;  2YUR A;  1WUM A;  3I2D A;  1X4U A;  5FFV A;  2DWW A;  3LJU X;  4I7C A;  5BT5 A;  1ZBD B;  4NRB A;  3L11 A;  4QF3 A;  4J1P A;  5LUU A;  5EGU A;  4KV1 A;  2E7O A;  2JMI A;  3SHB A;  3M7K A;  1JOC A;  4YC9 A;  1HYJ A;  5FE2 A;  2YHN A;  1VD4 A;  4UYE A;  4P5O B;  3V43 A;  4BW4 A;  5KU3 A;  4MR4 A;  3UVW A;  4CLB A;  4IR3 A;  5DBM A;  5I7X A;  5FER A;  2RSD A;  3HCU A;  2JMD A;  3HMF A;  1WGM A;  4Z1S A;  3S91 A;  5FG6 A;  3T9K A;  2H60 A;  5DKA A;  2E7N A;  4A9L A;  5HLS A;  4YAT A;  2MNY A;  4RVR A;  3ONI A;  3IHP A;  4AKH A;  4NN2 A;  2D82 A;  2HDP A;  4BW2 A;  3FAO A;  4HBX A;  3MB4 A;  4IR5 A;  4A4C A;  4O7A A;  2CSY A;  3U5N A;  5F63 A;  4UIT A;  5FE3 A;  3UVY A;  5AD3 A;  3I3J A;  2BAY A;  2L43 A;  4TZ8 A;  4IC3 A;  4Z93 A;  3JVM A;  1JM4 B;  4UIW A;  5FH7 A;  4O75 A;  4C66 A;  5FH8 A;  2L0B A;  4GNF A;  4Z0O A;  4AKG A;  2NXB A;  3D7C A;  4UYH A;  2KU3 A;  5CTL A;  3G0L A;  5DY7 A;  2VPD A;  2D9E A;  2XOY A;  2K4D A;  3U5M A;  5HEM A;  5E9K A;  5E74 A;  4I7D A;  2KKX A;  3U5O A;  1WEV A;  3N9Q A;  3LJW A;  4GB0 A;  5H1V A;  3RTR B;  4QSW A;  1CHC A;  2RNY A;  4UP5 A;  1WFK A;  2RI7 A;  4UIZ A;  4J3I A;  3FJU B;  5I40 A;  2R0S A;  3DPL R;  5DFC A;  3UV4 A;  2AN6 A;  4Z6I A;  5DW2 A;  3MQM A;  4KV4 A;  5HJC A;  2KYU A;  2M85 A;  2E61 A;  2Y1N A;  5EPB A;  4HXS A;  5I89 A;  4QSV A;  4UI9 B;  3O35 A;  4OGE A;  3LQJ A;  3SOX A;  3Q2F A;  2L80 A;  2XOC A;  4LK9 A;  3UV2 A;  4Q0N A;  2C2L A;  2YSJ A;  4TYL A;  2N9G A;  4YH3 A;  4FK5 A; 
#chains in the Genus database with same CATH homology
 5F1H A;  5EWW A;  5E73 A;  4QUT A;  2M1R A;  5E9Y A;  1WEW A;  5FFW A;  2CKL A;  2WP1 A;  5E9I A;  1X4I A;  2LRI C;  4NRA A;  4CUS A;  4O7C A;  3LQH A;  4TTE A;  4B86 C;  2F6N A;  2M6M A;  4HBW A;  5FB1 A;  3JVL A;  5EVA A;  4I7B A;  5E7D A;  3O33 A;  4L58 A;  3AQA A;  5A85 A;  5IGL A;  3PHD A;  1WEQ A;  2WP2 A;  5CQ5 A;  5HFR A;  2LGG A;  2DAT A;  4NYX A;  5CY9 A;  3UVX A;  5K29 A;  4ALG A;  2MJV B;  2DX8 A;  2LGV A;  4WA6 A;  4C9Z A;  4MVT A;  2OXQ C;  2RNX A;  3ASL A;  4W4U A;  5D3R A;  5CQ6 A;  2DVV A;  5FEY A;  4OGI A;  4UYF B;  2K17 A;  3FL2 A;  5B76 A;  4X2I A;  5L8U A;  5LKZ A;  4QEW A;  4YBM A;  4Q6F A;  5L99 A;  4YY4 A;  2YQD A;  4QC1 A;  5JWM A;  3KV5 A;  2R0Y A;  3T7L A;  4S3O B;  5ENI A;  4LZ2 A;  5CQ4 A;  5F3A A;  5C85 A;  3ZPV E;  4MR5 A;  4N4F A;  5D3S A;  1ZS5 A;  5FBX A;  2KE1 A;  3M62 A;  4AYC B;  3HMH A;  4NQM A;  5CRM A;  4WIV A;  3N9P A;  4XY9 A;  4NYV A;  2I7K A;  5G05 B;  3IU6 A;  2DVR A;  4O7B A;  5D3T A;  5FE1 A;  4ALH A;  4QB3 A;  1BOR A;  2KR4 A;  2Y43 A;  5HQ5 A;  4AUQ B;  1WEM A;  4HXL A;  1E6I A;  5F5Z A;  5A5R A;  5II1 A;  2ECT A;  2QIC A;  3ZPV 1;  5C13 A;  5FE0 A;  5CP5 A;  4R8P K;  1WIM A;  4YYJ A;  3HCT A;  5FE7 A;  1G25 A;  5EIC A;  3MXF A;  5D25 A;  5A5P A;  2LDR A;  5KHM A;  5DW1 A;  5IG6 A;  2G45 A;  5KH9 A;  5ENH A;  2VNF A;  3O36 A;  2M3H A;  2YT5 A;  1WUG A;  5C11 A;  4UYF A;  4LZS A;  5DFD A;  4GND A;  5I7Y A;  4A4B A;  2CSZ A;  5KH7 A;  5H85 A;  3K2J A;  5HCL A;  4BW3 A;  5LJ0 A;  5CS8 A;  5D3H A;  3SVH A;  1VYX A;  2I50 A;  2KGI A;  2XEU A;  4V3L C;  4A9K A;  2MD8 C;  3EB5 A;  3O70 A;  4YAX A;  4S3O C;  1XWH A;  5CRZ A;  3ZNI A;  4UIX A;  1N72 A;  5C8G A;  3SVF A;  4ZQL A;  3UW9 A;  4AYC A;  3P1C A;  5D0C A;  5EWH A;  2D8S A;  2MA5 A;  4WHW A;  3RCW A;  2OUO A;  4MR6 A;  4Z6H A;  3SVG A;  5B8D A;  4LYI A;  3MUL A;  5ETD A;  3QZS A;  4PS5 A;  4O64 A;  5EIS A;  5I88 A;  3GG3 A;  5CQ3 A;  4N3W A;  4NYW A;  4LZR A;  5F61 A;  4BBQ A;  1WE9 A;  2R10 A;  4ZUX U;  5DYA A;  4PCI A;  3L1X A;  4A9N A;  1T1H A;  4YYI A;  5CQT A;  3KQI A;  1MM3 A;  5L8T A;  2YW8 A;  2KWN A;  5CUE A;  2L5E A;  4YH4 A;  5COI A;  4O78 A;  2G6Q A;  2YQM A;  3U5K A;  4O7E A;  4YYM A;  5ENB A;  4HXO A;  3U5L A;  2YYN A;  5TCM A;  5LVR A;  5D1M B;  2L5U A;  5CFW A;  3TLP A;  5AME A;  4NUD A;  5KTX A;  4A9H A;  5F60 A;  4CFK A;  1FBV A;  1K2F A;  4MEN A;  3S92 A;  1V87 A;  5C7N A;  5ENJ A;  4QSX A;  2DVS A;  2PNX A;  2YYR A;  4AP4 A;  5I3L A;  4IOQ A;  2EGP A;  5FE4 A;  2VJE B;  2VP7 A;  4R2Y A;  1JSP B;  4PTB A;  4O7F A;  4QR4 A;  3NG2 A;  2FUI A;  4O76 A;  3O7A A;  2E6R A;  5I83 A;  4BJX A;  3JVK A;  4HBV A;  4E96 A;  1F68 A;  5FG5 A;  4QC3 A;  3ZYU A;  4FIP A;  1Z2Q A;  3HTK C;  2ZET C;  4MEQ A;  4NR6 A;  4NRC A;  4XUB A;  2GRC A;  2L75 A;  4TKP B;  3O34 A;  5LJ1 A;  1Z6U A;  2RO1 A;  5I80 A;  1WIL A;  3DQV R;  5ENC A;  3KNV A;  4LYW A;  5CUG A;  2EA6 A;  4QYD A;  4CUP A;  4ZDT A;  3ZTG A;  5BT4 A;  4XI1 A;  5AIU A;  5A7C A;  5HRW A;  5JG6 A;  4YY6 A;  3G0J A;  1E4U A;  4TU4 A;  5F36 A;  4QR5 A;  1DVP A;  2YW5 A;  5A5S A;  5LJ2 A;  4YYD A;  5FG4 A;  2QIZ A;  4KCX A;  2MUM A;  1F62 A;  2LGK A;  2VJE A;  4WZ0 A;  5I86 A;  4IC2 A;  5TRB A;  2ECI A;  2NAA A;  3N9M A;  4LYS A;  5CUC A;  2KWO A;  2YEK A;  5DIN A;  5LCW B;  5DYX A;  5EI4 A;  4LDF A;  4Z1Q A;  5FE5 A;  5J3X A;  4TT4 A;  1WEU A;  4MEP A;  3PUQ A;  5EWC A;  5EYA F;  3U5J A;  4CFL A;  2LV9 A;  3ZVY A;  4C67 A;  4A9F A;  4NUC A;  2CT2 A;  2YUC A;  5ENE A;  2YRE A;  3M99 A;  4O70 A;  4QYL A;  2YEM A;  4YYN A;  4A9M A;  2KTB B;  4DON A;  5EQ1 A;  3MB3 A;  5EK9 A;  5CUA A;  5HM0 A;  2E6S A;  3EB6 A;  4UIY A;  5A5Q A;  3DAI A;  2RS9 B;  3JVJ A;  5ACY A;  4Y03 A;  5BT3 A;  4NR8 A;  2VJF B;  2MD7 B;  4A9E A;  5CQ8 A;  5D24 A;  5KO4 A;  2XB1 A;  4A0C D;  2HYE D;  4NUE A;  2UZG A;  4LJN A;  5EWD A;  5EU1 A;  5HRX A;  2LN0 A;  4A9J A;  5I1Q A;  4MR3 A;  5G4R A;  2K1J A;  4QEU A;  5CPE A;  4ZW1 A;  3HCS A;  4LKA A;  4R7E A;  5A82 A;  2FUU A;  5D3P A;  5LKU A;  4CUU A;  5FE8 A;  4QSS A;  2E3K A;  5TDW A;  4J0S A;  2F42 A;  2YSM A;  5CQA A;  2CKL B;  4PPE A;  4TT6 A;  4MSX A;  1RMD A;  4CL9 A;  2YEL A;  3N9O A;  3LRQ A;  4TT2 A;  1IYM A;  4LRG A;  2LXP C;  5DFB A;  2L85 A;  3C6W A;  4IR6 A;  5CUD A;  2F6J A;  5HFQ A;  4B7Y C;  4UYG A;  4FO9 A;  4YK0 A;  4YAB A;  4Q0O A;  1FP0 A;  4N4I A;  4PCE A;  2PUY A;  4NXJ A;  4A9I A;  4O72 A;  3NXB A;  5CU8 A;  4CUT A;  2H0D A;  4WZ2 A;  2VJF A;  5KTU A;  5LKT A;  3SOW A;  4XUA A;  5EPR A;  5TAB A;  5A83 A;  4CUQ A;  3ZYQ A;  3PUR A;  4QZS A;  2R0V A;  3P1E A;  4ZC9 A;  4YAD A;  4QEV A;  3UVD A;  5LKX A;  4CCG X;  3N9N A;  1VFY A;  1U6G B;  4BW1 A;  5L96 A;  5EV9 A;  5IGK A;  4NS5 A;  2KFT A;  5EWV A;  4UIV A;  5F62 A;  2MA6 A;  2JMJ A;  5D1L B;  5B77 A;  4GPJ A;  1JM7 A;  2Y1M A;  1Z60 A;  2RNW A;  5TDR A;  4YBS A;  5J0D A;  2DKW A;  4WHU A;  3N9L A;  2OSS A;  5DYU A;  4XY8 A;  5F25 A;  5C89 A;  1LDK C;  5F2P A;  3GV4 A;  3P1D A;  2KRE A;  2ECV A;  5A5O A;  5DKD A;  5JI8 A;  2H0D B;  2YDW A;  3LXJ A;  4NR7 A;  4NR9 A;  3U5P A;  4F52 B;  3HME A;  4O77 A;  1LDJ B;  5AD2 A;  2DVQ A;  5B79 A;  1X4J A;  4GNG A;  5D1K B;  4CA1 A;  2G43 A;  4F3I A;  1HYI A;  3P5O A;  5LVQ A;  5D26 A;  3LQI A;  4PY6 A;  5IBN A;  3IU5 A;  3KV6 A;  2MT5 A;  4LC2 A;  5G04 B;  4OUF A;  1WEE A;  3VK6 A;  3UV5 A;  1MM2 A;  3O37 A;  5D3L A;  5EPS A;  2LGL A;  3RPG C;  5C87 A;  3QZT A;  4IR4 A;  3QZV A;  5EA1 A;  2KWK A;  3RPG B;  5FB0 A;  4QSR A;  3M63 A;  1JM7 B;  5IGN A;  5L98 A;  5CUB A;  2OO1 A;  4HBY A;  5D3N A;  4NR5 A;  3C5K A;  5B75 A;  5KH3 A;  2YQL A;  5TB6 A;  2VPB A;  2YHO A;  4QR3 A;  5EP7 A;  5EM3 A;  4QUU A;  4IOR A;  1X0J A;  4N4H A;  3SOU A;  5G4S A;  5CZG A;  3AAD A;  5IGM A;  2ECJ A;  5E0R A;  2VPG A;  5CQ7 A;  4UYD A;  4LAD B;  2MIQ A;  3DWY A;  2I8N A;  2ECG A;  3P1F A;  4QSP A;  4QNS A;  3GL6 A;  4QSU A;  5KTW A;  2YU4 A;  1WEP A;  5CGP A;  2QJ0 A;  4X3G A;  4HXP A;  4A9O A;  4O71 A;  3T6R A;  4BHW A;  4HXK A;  5FFY A;  1WEN A;  4QF2 A;  4GNE A;  2JRJ A;  3ZVZ B;  5E9L A;  4TS8 A;  4IOO A;  4FLP A;  5H9M A;  5G0F A;  2L84 A;  5A5N A;  2G4A A;  2LSP B;  4YYH A;  2MNZ A;  4V3K C;  5HQ6 A;  4YYG A;  2LQ6 A;  4N4G A;  3MUK A;  5A81 A;  5FDZ A;  5DKH A;  5DX4 A;  2FSA A;  4QST A;  4YBT A;  4LR6 A;  5L97 A;  5AMF A;  4TQN A;  5FE9 A;  3MHH A;  5E9M A;  4L7X A;  4WZ3 B;  5D3J A;  5HQ7 A;  2K16 A;  3MHS A;  4XYA A;  4FJC A;  1WES A;  4A49 A;  4UIU A;  4NR4 A;  5AIT A;  4YYK A;  4UP0 A;  4J0R A;  5C4Q A;  4AVX A;  2IDA A;  4OGJ A;  5DYC A;  2KGG A;  5E3G A;  4MEO A;  2C2V S;  2EOD A;  5DLZ A;  5D7X A;  5HEL A;  5ENG A;  2LXH C;  5IID A;  5TBN A;  4O74 A;  4AKN A;  5HEN A;  5I29 A;  5FH6 A;  2KIZ A;  4HXN A;  1N87 A;  5FE6 A;  5ETB A;  5H1U A;  5F1L A;  2KWJ A;  5E9V A;  5E3D A;  4QY4 A;  4HXM A;  5DKC A;  4TU6 A;  4NQN A;  5HRV A;  1EQF A;  1WEO A;  2ECN A;  4LLB A;  4HXR A;  4TZ2 A;  5B78 A;  5H1T A;  4QSQ A;  5DLX A;  4QBM A;  2VPE A;  4PKL A;  5II2 A;  3FKM X;  3Q2E A;  4CUR A;  5ENF A;  3L1Z B;  2ECW A;  2RFJ A;  2YUR A;  1WUM A;  3I2D A;  1X4U A;  5FFV A;  2DWW A;  4I7C A;  5BT5 A;  1ZBD B;  4NRB A;  3L11 A;  4QF3 A;  4J1P A;  5LUU A;  5EGU A;  4KV1 A;  2E7O A;  2JMI A;  3SHB A;  1JOC A;  4YC9 A;  1HYJ A;  5FE2 A;  2YHN A;  1VD4 A;  4UYE A;  4P5O B;  3V43 A;  4BW4 A;  5KU3 A;  4MR4 A;  3UVW A;  4CLB A;  4IR3 A;  5DBM A;  5I7X A;  5FER A;  2RSD A;  3HCU A;  2JMD A;  3HMF A;  1WGM A;  4Z1S A;  3S91 A;  5FG6 A;  2H60 A;  5DKA A;  2E7N A;  4A9L A;  5HLS A;  4YAT A;  2MNY A;  4RVR A;  3ONI A;  3IHP A;  4NN2 A;  2D82 A;  2HDP A;  4BW2 A;  4HBX A;  3MB4 A;  4IR5 A;  4A4C A;  4O7A A;  2CSY A;  3U5N A;  5F63 A;  4UIT A;  5FE3 A;  3UVY A;  5AD3 A;  3I3J A;  2BAY A;  2L43 A;  4TZ8 A;  4IC3 A;  4Z93 A;  3JVM A;  1JM4 B;  4UIW A;  5FH7 A;  4O75 A;  4C66 A;  5FH8 A;  2L0B A;  4GNF A;  2NXB A;  3D7C A;  4UYH A;  2KU3 A;  5CTL A;  3G0L A;  5DY7 A;  2VPD A;  2D9E A;  2K4D A;  3U5M A;  5HEM A;  5E9K A;  5E74 A;  4I7D A;  3U5O A;  1WEV A;  3N9Q A;  3LJW A;  4GB0 A;  5H1V A;  3RTR B;  4QSW A;  1CHC A;  2RNY A;  4UP5 A;  1WFK A;  2RI7 A;  4UIZ A;  4J3I A;  5I40 A;  2R0S A;  3DPL R;  5DFC A;  3UV4 A;  2AN6 A;  4Z6I A;  5DW2 A;  3MQM A;  4KV4 A;  5HJC A;  2KYU A;  2M85 A;  2Y1N A;  4UI9 B;  5EPB A;  4HXS A;  5I89 A;  4QSV A;  3SOX A;  3O35 A;  3LQJ A;  3Q2F A;  2L80 A;  4LK9 A;  3UV2 A;  4Q0N A;  2C2L A;  2YSJ A;  4TYL A;  2N9G A;  4YH3 A;  4FK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...