4PTBA

Crystal structure of human sp100 phd-bromodomain in the free state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
NSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear autoantigen Sp-100
publication title Crystal structure of human SP100 PHD-Bromodomain in the free state
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 59
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ptbA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ptbA01
4NUDA 5ENFA 5EI4A 2YUCA 2VJEB 5E9VA 4AP4A 4QR3A 4LZSA 4A4BA 2L75A 5G4RA 4TS8A 5FE9A 2F42A 5F60A 4F3IA 3U5MA 5LKTA 5EWDA 4C9ZA 3MUKA 5I29A 5EPSA 5HRXA 2G45A 3UVXA 2LQ6A 3ZPVE 3L1XA 5CRZA 3MB4A 5ENJA 2XB1A 2L43A 5TABA 4UYEA 5B75A 4BW4A 2VPBA 2MD7B 2EODA 5FB1A 2MNZA 4AUQB 5L96A 3ZVZB 3U5KA 4CUUA 3ONIA 4CA1A 4QEUA 4QSXA 2LGVA 5FG5A 2D82A 3UVYA 2L85A 4KV1A 5L98A 2KWKA 2Y1NA 4FO9A 2C2LA 5A7CA 5CQTA 4O76A 2HDPA 3Q2EA 5D7XA 4YADA 4LYWA 2D9EA 1XWHA 3N9QA 3V43A 4O7CA 2F6JA 3HCUA 4DONA 5CQ5A 3SOXA 4ZDTA 3IU6A 2WP1A 2M3HA 4LR6A 4A9MA 4YYDA 2OXQC 2DKWA 5HRVA 5D3SA 2CSYA 3T6RA 3P1DA 3MXFA 4TT4A 4YAXA 5F1LA 2E6SA 4UYFB 1JM7B 4QF2A 3HCSA 5I89A 2FSAA 3T7LA 4LKAA 5AIUA 4ZC9A 3UV2A 4FJCA 2E7NA 1WUGA 1JOCA 1LDJB 5A5QA 2MNYA 3RTRB 4O7BA 5EM3A 3AQAA 3AADA 5J3XA 3DWYA 2ECIA 4BBQA 4XUBA 4QUUA 3JVLA 4LLBA 2KWOA 4NR5A 4I7CA 3O36A 5ETBA 4PTBA 4A9LA 2JMJA 3M99A 4FIPA 4ZQLA 2YYNA 4CFKA 2YSJA 5F2PA 4UIXA 5EYAF 5AMFA 2OO1A 5AD2A 4Z6HA 4IR3A 4MR3A 5CS8A 2FUIA 2DVSA 3I3JA 5LVRA 5D3TA 5H1VA 5I1QA 5CPEA 1JM7A 2RI7A 2JMDA 2L5EA 3GG3A 5I88A 2N9GA 2YEKA 4NXJA 4LRGA 4YYGA 5FB0A 4X3GA 4UYHA 2DATA 5FE6A 4QSUA 5A81A 4CUSA 3Q2FA 4PS5A 3P5OA 5CQAA 5FG6A 5FE5A 2QJ0A 3LQJA 5CU8A 3LXJA 5EWHA 5D3PA 5A5NA 5A83A 4CCGX 2H0DB 4WA6A 5FG4A 4Z1SA 4LDFA 4O7EA 5EPRA 4L58A 1WE9A 5DBMA 4O77A 3HCTA 4N4GA 4QSQA 5DFCA 2YU4A 1WEQA 1WEUA 5ENIA 5E9LA 4B86C 5CUGA 4QSTA 2KGGA 1HYJA 5FE0A 4MEQA 5I40A 2MD8C 3HMHA 4WHUA 3DPLR 1HYIA 3GV4A 4B7YC 5FE2A 1WEWA 3IHPA 4N4HA 4PCEA 2RS9B 5L97A 4KCXA 4HBVA 5HFRA 5CQ3A 2L0BA 4YC9A 5D24A 5IGNA 5C85A 3RCWA 5EK9A 2QICA 5A5OA 5HFQA 5LJ2A 2K16A 4NYVA 2DWWA 2OUOA 4RVRA 5E7DA 2MA5A 3N9MA 5F63A 5CQ7A 3ZVYA 5I7XA 4Z6IA 4F52B 1WILA 4XUAA 4J3IA 2NAAA 4QR4A 4LYIA 4O7FA 5CRMA 5IBNA 4UIUA 5C4QA 5AD3A 2KFTA 4IR4A 5EICA 5FFYA 2KWNA 4HXRA 4A9HA 4A9EA 4GNFA 4UP0A 3LJWA 4UIYA 4J1PA 5JI8A 3K2JA 5A5RA 4AVXA 2EA6A 2XEUA 4GNEA 3MB3A 4WZ2A 4QSWA 5C87A 3JVJA 4A9OA 5COIA 4ZW1A 5DKHA 4YYKA 4GNDA 5FE7A 1Z2QA 5FFWA 1X0JA 5DINA 4ZUXU 1Z60A 4I7DA 1ZBDB 5EGUA 5KH7A 4BJXA 2R0YA 1F62A 3D7CA 5BT5A 5DW2A 5E3DA 4J0RA 5EWVA 3L11A 4Q0NA 3PURA 5G05B 2YREA 4MEPA 3O7AA 2KU3A 4YYMA 2QIZA 2KTBB 4C67A 2I8NA 2HYED 2YQLA 4IOQA 4O70A 1MM2A 5E9KA 1N87A 3N9OA 5KTUA 4TU6A 2YURA 4MR6A 2E3KA 2ECGA 1FP0A 2LGLA 2M6MA 5TBNA 3NG2A 2YEMA 5FE4A 2K4DA 2R10A 5FH6A 3UW9A 5LJ1A 4NS5A 2C2VS 5CQ4A 5CUAA 5HLSA 2I50A 2MT5A 4QNSA 5HENA 4ALGA 4TKPB 5CFWA 5LKXA 2LDRA 3KV6A 5FERA 2I7KA 5AMEA 2UZGA 4QYLA 5D3LA 4PY6A 5EPBA 3JVKA 3L1ZB 5D0CA 2WP2A 3TLPA 4YH3A 1G25A 4UIZA 4QR5A 5G4SA 5D3RA 5B77A 2KYUA 4YY6A 5B79A 4XYAA 5F3AA 2K17A 5CTLA 5CUDA 2LRIC 4LADB 2Y43A 2YHNA 5G0FA 5F1HA 5IGMA 4YBMA 5FE1A 1WEMA 4O75A 4UIWA 4XY9A 5CY9A 5G04B 5E3GA 1VYXA 5FE3A 4A49A 4HXOA 4NQMA 4NUCA 4A9IA 3U5NA 2VP7A 3S91A 3PUQA 4NYXA 4WIVA 5LUUA 4A4CA 1WEVA 4O74A 5HQ5A 2GRCA 5D1MB 5EVAA 3HMEA 4NRCA 3DAIA 3U5LA 4TZ2A 1F68A 2D8SA 2E6RA 2LGGA 4MVTA 3RPGB 5HELA 4NR7A 5D25A 4LZ2A 5FH8A 5BT3A 5H1UA 2CSZA 4MENA 4QC3A 2E7OA 2RNXA 5C11A 3JVMA 2KGIA 3S92A 4AYCB 4FK5A 4QB3A 5DYCA 4CFLA 2LXPC 4O7AA 3N9PA 4TT6A 1VFYA 2OSSA 3M62A 4TTEA 3LRQA 4C66A 2JMIA 4GB0A 4LYSA 5F61A 4WZ0A 5ENGA 5CP5A 3IU5A 5LKZA 4MR4A 4O64A 4KV4A 2LGKA 5JWMA 5IGLA 3C5KA 1JSPB 2ZETC 5DX4A 5DLZA 4YY4A 4YH4A 2FUUA 5BT4A 1BORA 3G0LA 5I83A 2VPEA 5K29A 5ACYA 4TT2A 2MA6A 5EISA 4V3LC 5II1A 3O33A 5CUCA 5F25A 2Y1MA 4W4UA 5H1TA 1MM3A 5EWCA 5FDZA 2BAYA 5HQ6A 4HBYA 4QEWA 4QY4A 5DYUA 5II2A 3U5JA 1X4JA 1WUMA 2YW5A 4AYCA 3SOWA 4QSRA 5I3LA 2L5UA 4A9KA 5I7YA 1CHCA 4OUFA 2DX8A 2EGPA 2LN0A 3O37A 4YK0A 5D3JA 3O70A 5AITA 4I7BA 5H9MA 4YYJA 1Z6UA 3KQIA 3KNVA 5D1LB 2YQDA 5C7NA 3FL2A 5ENBA 1WIMA 5FE8A 1K2FA 3SHBA 5FEYA 3UVDA 2VPGA 5B76A 5HRWA 4XI1A 1WESA 5F36A 2YYRA 4A9JA 5C13A 4NR4A 4CLBA 4TQNA 1RMDA 3VK6A 5JG6A 5I86A 2KIZA 3N9LA 4LJNA 2H60A 4V3KC 5CQ8A 3QZTA 5KHMA 4R8PK 3SVHA 5TDWA 4NUEA 4X2IA 3SVFA 4IOOA 2L84A 3P1FA 2IDAA 4R2YA 4NYWA 4LZRA 5EU1A 4OGIA 5L8UA 5B8DA 4YBTA 3EB5A 2VJFA 4IR6A 4QYDA 5EWWA 4HXLA 5F62A 2PNXA 3O34A 5CQ6A 2ECWA 5A82A 3I2DA 2LXHC 4O72A 5HJCA 4CUPA 4NR6A 3SVGA 2CKLA 2KE1A 5B78A 4UYGA 5KTWA 4AKNA 3MHHA 5DKDA 4XY8A 2PUYA 2YQMA 3RPGC 3NXBA 1LDKC 4O71A 5D3NA 3C6WA 1JM4B 4R7EA 4N3WA 2KR4A 5E74A 4BW2A 3FKMX 4QEVA 3ZPV1 2AN6A 5LCWB 5LJ0A 1N72A 5CUBA 3EB6A 4GNGA 4QSPA 4MR5A 5F5ZA 5J0DA 2ECVA 4IR5A 2LSPB 4QF3A 2R0VA 2VJEA 5E9MA 4L7XA 3PHDA 4Z1QA 1T1HA 2ECNA 4WZ3B 2VPDA 3LQHA 5EQ1A 4BW1A 3N9NA 4J0SA 5A5PA 4QSSA 5E73A 3P1CA 4TZ8A 3O35A 3ASLA 5DFBA 3UVWA 5IIDA 4Q0OA 2K1JA 4A9NA 4MSXA 5IG6A 4IC3A 4CURA 4BHWA 4A0CD 3QZVA 3G0JA 4TU4A 4PCIA 4QBMA 5HQ7A 5IGKA 2MIQA 4PPEA 3HTKC 4TYLA 2YW8A 5KU3A 1V87A 4OGJA 4HXMA 2ECJA 4QC1A 5ETDA 3MQMA 4NQNA 5ENEA 2M1RA 5A5SA 2RFJA 3GL6A 4HXSA 4UP5A 1IYMA 2G43A 2VNFA 4NRBA 5TB6A 5D3HA 4Q6FA 4LK9A 5L99A 4YATA 3ZTGA 5D1KB 5C89A 4S3OC 4NN2A 5DLXA 5ENHA 5TCMA 5E0RA 3UV4A 2YSMA 3ZYQA 3QZSA 4Y03A 5CGPA 5DYAA 1WFKA 5C8GA 4UITA 5D26A 5DW1A 4NRAA 4WHWA 2G4AA 4BW3A 1WGMA 4NR9A 3UV5A 4UYFA 5EA1A 5LKUA 2KREA 3DQVR 4FLPA 2YT5A 3MHSA 4UYDA 2RNWA 5DKCA 5EV9A 1WEOA 5KH3A 5FFVA 2MJVB 4LC2A 4QSVA 4QZSA 4PKLA 5E9YA 4E96A 4YYNA 4MEOA 1FBVA 5EP7A 2G6QA 5TRBA 5DFDA 4YABA 5FBXA 2KWJA 5LVQA 4GPJA 3SOUA 2R0SA 5DY7A 5CZGA 2YELA 5L8TA 4YBSA 4IORA 4O78A 3HMFA 5HEMA 1WENA 1X4IA 4HBXA 3MULA 2NXBA 2LV9A 5DKAA 5DYXA 3U5PA 4UIVA 5KH9A 4NR8A 4A9FA 4IC2A 4Z93A 4UI9B 3KV5A 5TDRA 1E4UA 5CUEA 2CT2A 2DVQA 2RO1A 3ZYUA 2RSDA 4S3OB 5FH7A 4HXKA 2VJFB 5H85A 2YHOA 2MUMA 2L80A 4N4FA 5I80A 1WEEA 1U6GB 1X4UA 4QUTA 4HXNA 2F6NA 2CKLB 4ALHA 3P1EA 2ECTA 2JRJA 2H0DA 5KTXA 1WEPA 5ENCA 1EQFA 1ZS5A 4HXPA 4CUTA 1E6IA 4P5OB 2DVRA 4N4IA 4CUQA 3M63A 2DVVA 4CL9A 5HM0A 3ZNIA 3LQIA 4YYHA 4HBWA 5A85A 2RNYA 2M85A 1DVPA 4YYIA 5E9IA 5KO4A 3U5OA 2YDWA 5HCLA 1VD4A
chains in the Genus database with same CATH superfamily
4NUDA 5ENFA 5EI4A 2YUCA 2VJEB 5E9VA 4AP4A 4QR3A 4LZSA 4A4BA 2M13A 2L75A 5G4RA 4TS8A 5FE9A 3D1BA 2F42A 5F60A 4F3IA 3U5MA 5LKTA 5EWDA 4C9ZA 3MUKA 5I29A 5EPSA 5HRXA 2G45A 3UVXA 2LQ6A 3ZPVE 3L1XA 5CRZA 3MB4A 5ENJA 2FD4A 2XB1A 2L43A 5TABA 4UYEA 5B75A 4BW4A 2VPBA 2MD7B 2EODA 5FB1A 2MNZA 3FAOA 4AUQB 5L96A 3ZVZB 3U5KA 4CUUA 2B0OE 3ONIA 4CA1A 4QEUA 4QSXA 2LGVA 4Z0OA 5FG5A 3JUEA 2D82A 3UVYA 2L85A 4KV1A 5L98A 2KWKA 2Y1NA 4FO9A 2C2LA 5A7CA 5CQTA 4O76A 2HDPA 3Q2EA 5D7XA 4YADA 4LYWA 2D9EA 1XWHA 3N9QA 3V43A 4O7CA 4AKHA 2F6JA 3HCUA 4DONA 5CQ5A 3SOXA 2KKYA 4ZDTA 3IU6A 2WP1A 2E61A 4LR6A 2M3HA 4A9MA 4YYDA 2OXQC 2DKWA 5HRVA 5D3SA 2CSYA 3T6RA 3P1DA 3MXFA 4TT4A 4YAXA 5F1LA 2E6SA 4UYFB 1JM7B 4QF2A 3HCSA 5I89A 2FSAA 3T7LA 4LKAA 5AIUA 4ZC9A 3UV2A 4FJCA 2E7NA 1WUGA 1JOCA 1LDJB 5A5QA 2MNYA 3RTRB 4O7BA 5EM3A 2XOZA 3AQAA 3AADA 5J3XA 3DWYA 2ECIA 4BBQA 4XUBA 4QUUA 3JVLA 5SVIA 4LLBA 2KWOA 4NR5A 4I7CA 3O36A 5ETBA 4PTBA 4A9LA 2FFWA 2JMJA 3M99A 4FIPA 4ZQLA 2YYNA 4CFKA 2YSJA 5F2PA 4UIXA 5EYAF 5AMFA 2OO1A 5AD2A 4Z6HA 4IR3A 4MR3A 5CS8A 3ERRA 2FUIA 2DVSA 3KDEC 3I3JA 5LVRA 5D3TA 5H1VA 5I1QA 5CPEA 1JM7A 2RI7A 2JMDA 2L5EA 3GG3A 5I88A 2N9GA 2YEKA 4NXJA 4LRGA 4YYGA 5FB0A 1DCQA 4X3GA 4UYHA 2DATA 5FE6A 1MBMA 4QSUA 5A81A 4CUSA 3Q2FA 4PS5A 3P5OA 5CQAA 5FG6A 5FE5A 2QJ0A 3LQJA 5CU8A 3LXJA 2RR4A 5EWHA 5D3PA 5A5NA 5A83A 4CCGX 2H0DB 4WA6A 5FG4A 4Z1SA 4LDFA 4O7EA 5EPRA 4L58A 1WE9A 5DBMA 4O77A 3HCTA 4N4GA 2CRRA 4QSQA 5DFCA 2YU4A 1WEQA 1WEUA 5ENIA 3O47A 5E9LA 4B86C 5CUGA 4QSTA 2KGGA 1HYJA 5FE0A 4MEQA 5I40A 2MD8C 3HMHA 4WHUA 3DPLR 1HYIA 3GV4A 4B7YC 5FE2A 1WEWA 3IHPA 4N4HA 4PCEA 2RS9B 5L97A 4KCXA 4HBVA 5HFRA 5CQ3A 2L0BA 4YC9A 5D24A 5IGNA 5C85A 3RCWA 5EK9A 2QICA 5A5OA 5HFQA 5LJ2A 2K16A 4NYVA 2DWWA 2OUOA 4RVRA 5E7DA 2MA5A 3N9MA 5F63A 5K3QA 5CQ7A 3ZVYA 5I7XA 4Z6IA 4F52B 1WILA 2EGMA 4XUAA 2XOCA 5SVXA 4J3IA 2NAAA 4QR4A 4LYIA 4O7FA 5CRMA 5IBNA 4UIUA 5C4QA 5AD3A 2KFTA 4IR4A 5EICA 5FFYA 2KWNA 4HXRA 4AKIA 4A9HA 2EJNA 4A9EA 4GNFA 4UP0A 3LJWA 4UIYA 4J1PA 5JI8A 3K2JA 2JUNA 5A5RA 4AVXA 2EA6A 2XEUA 4GNEA 3MB3A 3DWDA 4WZ2A 4QSWA 5C87A 3JVJA 4A9OA 5COIA 4ZW1A 5DKHA 4YYKA 4GNDA 5FE7A 1Z2QA 5FFWA 1X0JA 5DINA 4ZUXU 1Z60A 4I7DA 1ZBDB 5EGUA 5KH7A 4BJXA 2R0YA 1F62A 3D7CA 5BT5A 5DW2A 5E3DA 4J0RA 5EWVA 3L11A 4Q0NA 3PURA 5G05B 2YREA 4MEPA 3O7AA 2KU3A 4YYMA 2QIZA 2KTBB 4C67A 2I8NA 2HYED 2YQLA 4IOQA 4O70A 1MM2A 5E9KA 1N87A 3N9OA 5KTUA 4TU6A 2YURA 4MR6A 2E3KA 3MDBC 2ECGA 5SVIB 1FP0A 2LGLA 2M6MA 5TBNA 3NG2A 2YEMA 5FE4A 2K4DA 2R10A 5FH6A 3UW9A 5LJ1A 4NS5A 2C2VS 5CQ4A 4OGEA 5CUAA 5HLSA 2I50A 2MT5A 4QNSA 5HENA 4ALGA 4TKPB 5CFWA 5LKXA 2LDRA 3KV6A 5FERA 2I7KA 5AMEA 2UZGA 4QYLA 5D3LA 4PY6A 5EPBA 3JVKA 3L1ZB 5D0CA 2WP2A 3TLPA 4YH3A 1G25A 4UIZA 4QR5A 5G4SA 5D3RA 5B77A 2KYUA 4YY6A 2P57A 4XYAA 5B79A 5F3AA 2K17A 2IQJA 5CTLA 5CUDA 2LRIC 4LADB 2JM3A 3M7KA 4AI6A 3E2DA 2Y43A 2YHNA 5G0FA 5F1HA 5IGMA 4YBMA 5FE1A 1WEMA 4O75A 4UIWA 4XY9A 5CY9A 5G04B 5E3GA 1VYXA 5FE3A 2DJAA 4HXOA 4A49A 4NQMA 4NUCA 4A9IA 3U5NA 2VP7A 3S91A 3PUQA 4NYXA 4WIVA 5LUUA 4A4CA 1WEVA 4O74A 5HQ5A 2GRCA 2XOYA 5D1MB 5EVAA 3HMEA 4NRCA 3DAIA 3U5LA 4TZ2A 1F68A 2D8SA 2E6RA 2LGGA 4MVTA 3RPGB 5HELA 4NR7A 5D25A 4LZ2A 5FH8A 5BT3A 5H1UA 4Z0RA 2CSZA 4MENA 4QC3A 2E7OA 2RNXA 2OWAA 3JVMA 5C11A 2KGIA 4O62A 3S92A 2YVRA 4AYCB 4FK5A 4QB3A 5DYCA 4CFLA 2LXPC 4O7AA 3N9PA 4TT6A 1VFYA 2OSSA 3M62A 4TTEA 3LRQA 4C66A 2JMIA 4GB0A 4LYSA 5F61A 4WZ0A 5ENGA 5CP5A 3IU5A 5LKZA 4MR4A 4O64A 4KV4A 2LGKA 5JWMA 5IGLA 3C5KA 1JSPB 2ZETC 5DX4A 5DLZA 4YY4A 4YH4A 3VKGA 2FUUA 5BT4A 1BORA 3G0LA 5I83A 2VPEA 5K29A 5ACYA 4TT2A 2MA6A 5EISA 4V3LC 5II1A 3O33A 5CUCA 5F25A 2Y1MA 4W4UA 5H1TA 1MM3A 5EWCA 5FDZA 2BAYA 5HQ6A 4HBYA 4QEWA 4QY4A 5DYUA 5II2A 3U5JA 1X4JA 3FJUB 1WUMA 2YW5A 4AYCA 3SOWA 4QSRA 5I3LA 2L5UA 4A9KA 5I7YA 1CHCA 4OUFA 2DX8A 2EGPA 2LN0A 3O37A 4YK0A 5D3JA 3O70A 5AITA 4I7BA 5H9MA 4YYJA 1Z6UA 3KQIA 3KNVA 5D1LB 2MKEA 2YQDA 5C7NA 3FL2A 2LAUA 5ENBA 3VKHA 5FE8A 1K2FA 1WIMA 2CRWA 3SHBA 5FEYA 3UVDA 2VPGA 5B76A 5HRWA 4XI1A 2EXUA 1WESA 5F36A 2YYRA 4A9JA 5C13A 4NR4A 4CLBA 4TQNA 1RMDA 3T9KA 3VK6A 5JG6A 5I86A 2KIZA 3N9LA 4LJNA 2H60A 4V3KC 5CQ8A 3QZTA 5KHMA 4R8PK 3SVHA 3LDYA 5TDWA 4NUEA 4X2IA 3SVFA 4IOOA 2L84A 3FANA 3P1FA 2IDAA 4R2YA 4NYWA 4LZRA 5EU1A 4OGIA 5L8UA 5B8DA 4YBTA 2D8UA 3EB5A 2VJFA 4IR6A 4QYDA 5EWWA 4HXLA 5F62A 2PNXA 3O34A 5CQ6A 2ECWA 5A82A 3I2DA 2LXHC 3Q1DA 4O72A 5HJCA 4CUPA 4NR6A 3SVGA 2CKLA 2KE1A 5B78A 4UYGA 5KTWA 1ZKRA 4AKNA 3MHHA 4OGCA 5DKDA 4AKGA 4XY8A 2PUYA 2YQMA 3H7HA 3NXBA 3RPGC 1LDKC 4O71A 5D3NA 3C6WA 1JM4B 3D1DA 4R7EA 4N3WA 2KR4A 5E74A 4BW2A 3FKMX 4QEVA 3ZPV1 2AN6A 5LCWB 5LJ0A 1N72A 5CUBA 3EB6A 4GNGA 4QSPA 4MR5A 5F5ZA 5J0DA 3DDTA 2ECVA 4IR5A 2LSPB 4QF3A 2R0VA 2VJEA 5E9MA 4L7XA 3PHDA 4Z1QA 1T1HA 2ECNA 4WZ3B 2VPDA 3LQHA 5EQ1A 4BW1A 3N9NA 4J0SA 5A5PA 4QSSA 5E73A 3LVQE 3P1CA 4TZ8A 3O35A 3ASLA 5DFBA 3UVWA 5IIDA 4Q0OA 2K1JA 4A9NA 2CONA 4MSXA 3PLWA 5IG6A 4IC3A 4CURA 4BHWA 4A0CD 3QZVA 1PUOA 3G0JA 3FEHA 4TU4A 4PCIA 4QBMA 5HQ7A 5IGKA 2MIQA 4PPEA 3HTKC 4TYLA 3SUBA 2YW8A 5KU3A 1V87A 4OGJA 4HXMA 2ECJA 4QC1A 5ETDA 3MQMA 4NQNA 5ENEA 2DSMA 2M1RA 5A5SA 2RFJA 3GL6A 4HXSA 4UP5A 1IYMA 2CSVA 2G43A 2VNFA 4NRBA 5TB6A 5D3HA 4Q6FA 4LK9A 5L99A 4YATA 3ZTGA 5D1KB 5C89A 4S3OC 4NN2A 2KKXA 5DLXA 5ENHA 5TCMA 5E0RA 3UV4A 2YSMA 3ZYQA 3QZSA 4Y03A 5CGPA 5DYAA 4F1PA 1WFKA 5C8GA 4UITA 5D26A 5DW1A 4NRAA 4WHWA 3FM8C 2G4AA 4BW3A 1WGMA 4NR9A 3UV5A 4UYFA 5EA1A 5LKUA 2KREA 3DQVR 4FLPA 2YT5A 3MHSA 4UYDA 2RNWA 5DKCA 5EV9A 1WEOA 5KH3A 5FFVA 2MJVB 4LC2A 4QSVA 4QZSA 4PKLA 5E9YA 4E96A 4YYNA 4MEOA 1FBVA 5EP7A 2G6QA 5TRBA 5DFDA 4YABA 5FBXA 2KWJA 5LVQA 4GPJA 3SOUA 2R0SA 5SVYA 5DY7A 5CZGA 2YELA 5L8TA 2XP0A 4YBSA 4IORA 4O78A 3HMFA 5HEMA 1WENA 2L7PA 1X4IA 4HBXA 3MULA 2NXBA 2LV9A 5DKAA 5DYXA 3U5PA 4UIVA 5KH9A 4NR8A 4A9FA 4IC2A 4Z93A 4UI9B 3KV5A 5TDRA 1E4UA 5CUEA 2CT2A 2DVQA 2RO1A 3ZYUA 2RSDA 4S3OB 5FH7A 4HXKA 2VJFB 5H85A 2YHOA 2MUMA 2L80A 4N4FA 5I80A 1WEEA 1U6GB 1X4UA 4QUTA 4HXNA 4H9DA 2F6NA 2CKLB 4ALHA 3P1EA 2ECTA 2JRJA 2H0DA 5KTXA 1WEPA 5ENCA 1EQFA 1ZS5A 4HXPA 4CUTA 1E6IA 3LJUX 4P5OB 2DVRA 4N4IA 4CUQA 3M63A 2DVVA 4CL9A 5HM0A 3ZNIA 4QQ4A 3LQIA 4YYHA 4HBWA 5A85A 2RNYA 2M85A 1DVPA 4YYIA 5E9IA 5KO4A 3U5OA 2YDWA 3LVRE 5HCLA 1VD4A
chains in the Genus database with same CATH topology
4NUDA 5ENFA 5EI4A 2YUCA 2VJEB 5E9VA 4AP4A 4QR3A 4LZSA 4A4BA 2L75A 5G4RA 4TS8A 5FE9A 2F42A 5F60A 4F3IA 3U5MA 5LKTA 5EWDA 4C9ZA 3MUKA 5I29A 5EPSA 5HRXA 2G45A 3UVXA 2LQ6A 3ZPVE 3L1XA 5CRZA 3MB4A 5ENJA 2XB1A 2L43A 5TABA 4UYEA 5B75A 4BW4A 2VPBA 2MD7B 2EODA 5FB1A 2MNZA 4AUQB 5L96A 3ZVZB 3U5KA 4CUUA 3ONIA 4CA1A 4QEUA 4QSXA 2LGVA 5FG5A 2D82A 3UVYA 2L85A 4KV1A 5L98A 2KWKA 2Y1NA 4FO9A 2C2LA 5A7CA 5CQTA 4O76A 2HDPA 3Q2EA 5D7XA 4YADA 4LYWA 2D9EA 1XWHA 3N9QA 3V43A 4O7CA 2F6JA 3HCUA 4DONA 5CQ5A 3SOXA 4ZDTA 3IU6A 2WP1A 2M3HA 4LR6A 4A9MA 4YYDA 2OXQC 2DKWA 5HRVA 5D3SA 2CSYA 3T6RA 3P1DA 3MXFA 4TT4A 4YAXA 5F1LA 2E6SA 4UYFB 1JM7B 4QF2A 3HCSA 5I89A 2FSAA 3T7LA 4LKAA 5AIUA 4ZC9A 3UV2A 4FJCA 2E7NA 1WUGA 1JOCA 1LDJB 5A5QA 2MNYA 3RTRB 4O7BA 5EM3A 3AQAA 3AADA 5J3XA 3DWYA 2ECIA 4BBQA 4XUBA 4QUUA 3JVLA 4LLBA 2KWOA 4NR5A 4I7CA 3O36A 5ETBA 4PTBA 4A9LA 2JMJA 3M99A 4FIPA 4ZQLA 2YYNA 4CFKA 2YSJA 5F2PA 4UIXA 5EYAF 5AMFA 2OO1A 5AD2A 4Z6HA 4IR3A 4MR3A 5CS8A 2FUIA 2DVSA 3I3JA 5LVRA 5D3TA 5H1VA 5I1QA 5CPEA 1JM7A 2RI7A 2JMDA 2L5EA 3GG3A 5I88A 2N9GA 2YEKA 4NXJA 4LRGA 4YYGA 5FB0A 4X3GA 4UYHA 2DATA 5FE6A 4QSUA 5A81A 4CUSA 3Q2FA 4PS5A 3P5OA 5CQAA 5FG6A 5FE5A 2QJ0A 3LQJA 5CU8A 3LXJA 5EWHA 5D3PA 5A5NA 5A83A 4CCGX 2H0DB 4WA6A 5FG4A 4Z1SA 4LDFA 4O7EA 5EPRA 4L58A 1WE9A 5DBMA 4O77A 3HCTA 4N4GA 4QSQA 5DFCA 2YU4A 1WEQA 1WEUA 5ENIA 5E9LA 4B86C 5CUGA 4QSTA 2KGGA 1HYJA 5FE0A 4MEQA 5I40A 2MD8C 3HMHA 4WHUA 3DPLR 1HYIA 3GV4A 4B7YC 5FE2A 1WEWA 3IHPA 4N4HA 4PCEA 2RS9B 5L97A 4KCXA 4HBVA 5HFRA 5CQ3A 2L0BA 4YC9A 5D24A 5IGNA 5C85A 3RCWA 5EK9A 2QICA 5A5OA 5HFQA 5LJ2A 2K16A 4NYVA 2DWWA 2OUOA 4RVRA 5E7DA 2MA5A 3N9MA 5F63A 5CQ7A 3ZVYA 5I7XA 4Z6IA 4F52B 1WILA 4XUAA 4J3IA 2NAAA 4QR4A 4LYIA 4O7FA 5CRMA 5IBNA 4UIUA 5C4QA 5AD3A 2KFTA 4IR4A 5EICA 5FFYA 2KWNA 4HXRA 4A9HA 4A9EA 4GNFA 4UP0A 3LJWA 4UIYA 4J1PA 5JI8A 3K2JA 5A5RA 4AVXA 2EA6A 2XEUA 4GNEA 3MB3A 4WZ2A 4QSWA 5C87A 3JVJA 4A9OA 5COIA 4ZW1A 5DKHA 4YYKA 4GNDA 5FE7A 1Z2QA 5FFWA 1X0JA 5DINA 4ZUXU 1Z60A 4I7DA 1ZBDB 5EGUA 5KH7A 4BJXA 2R0YA 1F62A 3D7CA 5BT5A 5DW2A 5E3DA 4J0RA 5EWVA 3L11A 4Q0NA 3PURA 5G05B 2YREA 4MEPA 3O7AA 2KU3A 4YYMA 2QIZA 2KTBB 4C67A 2I8NA 2HYED 2YQLA 4IOQA 4O70A 1MM2A 5E9KA 1N87A 3N9OA 5KTUA 4TU6A 2YURA 4MR6A 2E3KA 2ECGA 1FP0A 2LGLA 2M6MA 5TBNA 3NG2A 2YEMA 5FE4A 2K4DA 2R10A 5FH6A 3UW9A 5LJ1A 4NS5A 2C2VS 5CQ4A 5CUAA 5HLSA 2I50A 2MT5A 4QNSA 5HENA 4ALGA 4TKPB 5CFWA 5LKXA 2LDRA 3KV6A 5FERA 2I7KA 5AMEA 2UZGA 4QYLA 5D3LA 4PY6A 5EPBA 3JVKA 3L1ZB 5D0CA 2WP2A 3TLPA 4YH3A 1G25A 4UIZA 4QR5A 5G4SA 5D3RA 5B77A 2KYUA 4YY6A 5B79A 4XYAA 5F3AA 2K17A 5CTLA 5CUDA 2LRIC 4LADB 2Y43A 2YHNA 5G0FA 5F1HA 5IGMA 4YBMA 5FE1A 1WEMA 4O75A 4UIWA 4XY9A 5CY9A 5G04B 5E3GA 1VYXA 5FE3A 4A49A 4HXOA 4NQMA 4NUCA 4A9IA 3U5NA 2VP7A 3S91A 3PUQA 4NYXA 4WIVA 5LUUA 4A4CA 1WEVA 4O74A 5HQ5A 2GRCA 5D1MB 5EVAA 3HMEA 4NRCA 3DAIA 3U5LA 4TZ2A 1F68A 2D8SA 2E6RA 2LGGA 4MVTA 3RPGB 5HELA 4NR7A 5D25A 4LZ2A 5FH8A 5BT3A 5H1UA 2CSZA 4MENA 4QC3A 2E7OA 2RNXA 5C11A 3JVMA 2KGIA 3S92A 4AYCB 4FK5A 4QB3A 5DYCA 4CFLA 2LXPC 4O7AA 3N9PA 4TT6A 1VFYA 2OSSA 3M62A 4TTEA 3LRQA 4C66A 2JMIA 4GB0A 4LYSA 5F61A 4WZ0A 5ENGA 5CP5A 3IU5A 5LKZA 4MR4A 4O64A 4KV4A 2LGKA 5JWMA 5IGLA 3C5KA 1JSPB 2ZETC 5DX4A 5DLZA 4YY4A 4YH4A 2FUUA 5BT4A 1BORA 3G0LA 5I83A 2VPEA 5K29A 5ACYA 4TT2A 2MA6A 5EISA 4V3LC 5II1A 3O33A 5CUCA 5F25A 2Y1MA 4W4UA 5H1TA 1MM3A 5EWCA 5FDZA 2BAYA 5HQ6A 4HBYA 4QEWA 4QY4A 5DYUA 5II2A 3U5JA 1X4JA 1WUMA 2YW5A 4AYCA 3SOWA 4QSRA 5I3LA 2L5UA 4A9KA 5I7YA 1CHCA 4OUFA 2DX8A 2EGPA 2LN0A 3O37A 4YK0A 5D3JA 3O70A 5AITA 4I7BA 5H9MA 4YYJA 1Z6UA 3KQIA 3KNVA 5D1LB 2YQDA 5C7NA 3FL2A 5ENBA 1WIMA 5FE8A 1K2FA 3SHBA 5FEYA 3UVDA 2VPGA 5B76A 5HRWA 4XI1A 1WESA 5F36A 2YYRA 4A9JA 5C13A 4NR4A 4CLBA 4TQNA 1RMDA 3VK6A 5JG6A 5I86A 2KIZA 3N9LA 4LJNA 2H60A 4V3KC 5CQ8A 3QZTA 5KHMA 4R8PK 3SVHA 5TDWA 4NUEA 4X2IA 3SVFA 4IOOA 2L84A 3P1FA 2IDAA 4R2YA 4NYWA 4LZRA 5EU1A 4OGIA 5L8UA 5B8DA 4YBTA 3EB5A 2VJFA 4IR6A 4QYDA 5EWWA 4HXLA 5F62A 2PNXA 3O34A 5CQ6A 2ECWA 5A82A 3I2DA 2LXHC 4O72A 5HJCA 4CUPA 4NR6A 3SVGA 2CKLA 2KE1A 5B78A 4UYGA 5KTWA 4AKNA 3MHHA 5DKDA 4XY8A 2PUYA 2YQMA 3RPGC 3NXBA 1LDKC 4O71A 5D3NA 3C6WA 1JM4B 4R7EA 4N3WA 2KR4A 5E74A 4BW2A 3FKMX 4QEVA 3ZPV1 2AN6A 5LCWB 5LJ0A 1N72A 5CUBA 3EB6A 4GNGA 4QSPA 4MR5A 5F5ZA 5J0DA 2ECVA 4IR5A 2LSPB 4QF3A 2R0VA 2VJEA 5E9MA 4L7XA 3PHDA 4Z1QA 1T1HA 2ECNA 4WZ3B 2VPDA 3LQHA 5EQ1A 4BW1A 3N9NA 4J0SA 5A5PA 4QSSA 5E73A 3P1CA 4TZ8A 3O35A 3ASLA 5DFBA 3UVWA 5IIDA 4Q0OA 2K1JA 4A9NA 4MSXA 5IG6A 4IC3A 4CURA 4BHWA 4A0CD 3QZVA 3G0JA 4TU4A 4PCIA 4QBMA 5HQ7A 5IGKA 2MIQA 4PPEA 3HTKC 4TYLA 2YW8A 5KU3A 1V87A 4OGJA 4HXMA 2ECJA 4QC1A 5ETDA 3MQMA 4NQNA 5ENEA 2M1RA 5A5SA 2RFJA 3GL6A 4HXSA 4UP5A 1IYMA 2G43A 2VNFA 4NRBA 5TB6A 5D3HA 4Q6FA 4LK9A 5L99A 4YATA 3ZTGA 5D1KB 5C89A 4S3OC 4NN2A 5DLXA 5ENHA 5TCMA 5E0RA 3UV4A 2YSMA 3ZYQA 3QZSA 4Y03A 5CGPA 5DYAA 1WFKA 5C8GA 4UITA 5D26A 5DW1A 4NRAA 4WHWA 2G4AA 4BW3A 1WGMA 4NR9A 3UV5A 4UYFA 5EA1A 5LKUA 2KREA 3DQVR 4FLPA 2YT5A 3MHSA 4UYDA 2RNWA 5DKCA 5EV9A 1WEOA 5KH3A 5FFVA 2MJVB 4LC2A 4QSVA 4QZSA 4PKLA 5E9YA 4E96A 4YYNA 4MEOA 1FBVA 5EP7A 2G6QA 5TRBA 5DFDA 4YABA 5FBXA 2KWJA 5LVQA 4GPJA 3SOUA 2R0SA 5DY7A 5CZGA 2YELA 5L8TA 4YBSA 4IORA 4O78A 3HMFA 5HEMA 1WENA 1X4IA 4HBXA 3MULA 2NXBA 2LV9A 5DKAA 5DYXA 3U5PA 4UIVA 5KH9A 4NR8A 4A9FA 4IC2A 4Z93A 4UI9B 3KV5A 5TDRA 1E4UA 5CUEA 2CT2A 2DVQA 2RO1A 3ZYUA 2RSDA 4S3OB 5FH7A 4HXKA 2VJFB 5H85A 2YHOA 2MUMA 2L80A 4N4FA 5I80A 1WEEA 1U6GB 1X4UA 4QUTA 4HXNA 2F6NA 2CKLB 4ALHA 3P1EA 2ECTA 2JRJA 2H0DA 5KTXA 1WEPA 5ENCA 1EQFA 1ZS5A 4HXPA 4CUTA 1E6IA 4P5OB 2DVRA 4N4IA 4CUQA 3M63A 2DVVA 4CL9A 5HM0A 3ZNIA 3LQIA 4YYHA 4HBWA 5A85A 2RNYA 2M85A 1DVPA 4YYIA 5E9IA 5KO4A 3U5OA 2YDWA 5HCLA 1VD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUD A;  5ENF A;  5EI4 A;  2YUC A;  2VJE B;  5E9V A;  4AP4 A;  4QR3 A;  4LZS A;  4A4B A;  2L75 A;  5G4R A;  4TS8 A;  5FE9 A;  2F42 A;  5F60 A;  4F3I A;  3U5M A;  5LKT A;  5EWD A;  4C9Z A;  3MUK A;  5I29 A;  5EPS A;  5HRX A;  2G45 A;  3UVX A;  2LQ6 A;  3ZPV E;  3L1X A;  5CRZ A;  3MB4 A;  5ENJ A;  2XB1 A;  2L43 A;  5TAB A;  4UYE A;  5B75 A;  4BW4 A;  2VPB A;  2MD7 B;  2EOD A;  5FB1 A;  2MNZ A;  4AUQ B;  5L96 A;  3ZVZ B;  3U5K A;  4CUU A;  3ONI A;  4CA1 A;  4QEU A;  4QSX A;  2LGV A;  5FG5 A;  2D82 A;  3UVY A;  2L85 A;  4KV1 A;  5L98 A;  2KWK A;  2Y1N A;  4FO9 A;  2C2L A;  5A7C A;  5CQT A;  4O76 A;  2HDP A;  3Q2E A;  5D7X A;  4YAD A;  4LYW A;  2D9E A;  1XWH A;  3N9Q A;  3V43 A;  4O7C A;  2F6J A;  3HCU A;  4DON A;  5CQ5 A;  3SOX A;  4ZDT A;  3IU6 A;  2WP1 A;  2M3H A;  4LR6 A;  4A9M A;  4YYD A;  2OXQ C;  2DKW A;  5HRV A;  5D3S A;  2CSY A;  3T6R A;  3P1D A;  3MXF A;  4TT4 A;  4YAX A;  5F1L A;  2E6S A;  4UYF B;  1JM7 B;  4QF2 A;  3HCS A;  5I89 A;  2FSA A;  3T7L A;  4LKA A;  5AIU A;  4ZC9 A;  3UV2 A;  4FJC A;  2E7N A;  1WUG A;  1JOC A;  1LDJ B;  5A5Q A;  2MNY A;  3RTR B;  4O7B A;  5EM3 A;  3AQA A;  3AAD A;  5J3X A;  3DWY A;  2ECI A;  4BBQ A;  4XUB A;  4QUU A;  3JVL A;  4LLB A;  2KWO A;  4NR5 A;  4I7C A;  3O36 A;  5ETB A;  4PTB A;  4A9L A;  2JMJ A;  3M99 A;  4FIP A;  4ZQL A;  2YYN A;  4CFK A;  2YSJ A;  5F2P A;  4UIX A;  5EYA F;  5AMF A;  2OO1 A;  5AD2 A;  4Z6H A;  4IR3 A;  4MR3 A;  5CS8 A;  2FUI A;  2DVS A;  3I3J A;  5LVR A;  5D3T A;  5H1V A;  5I1Q A;  5CPE A;  1JM7 A;  2RI7 A;  2JMD A;  2L5E A;  3GG3 A;  5I88 A;  2N9G A;  2YEK A;  4NXJ A;  4LRG A;  4YYG A;  5FB0 A;  4X3G A;  4UYH A;  2DAT A;  5FE6 A;  4QSU A;  5A81 A;  4CUS A;  3Q2F A;  4PS5 A;  3P5O A;  5CQA A;  5FG6 A;  5FE5 A;  2QJ0 A;  3LQJ A;  5CU8 A;  3LXJ A;  5EWH A;  5D3P A;  5A5N A;  5A83 A;  4CCG X;  2H0D B;  4WA6 A;  5FG4 A;  4Z1S A;  4LDF A;  4O7E A;  5EPR A;  4L58 A;  1WE9 A;  5DBM A;  4O77 A;  3HCT A;  4N4G A;  4QSQ A;  5DFC A;  2YU4 A;  1WEQ A;  1WEU A;  5ENI A;  5E9L A;  4B86 C;  5CUG A;  4QST A;  2KGG A;  1HYJ A;  5FE0 A;  4MEQ A;  5I40 A;  2MD8 C;  3HMH A;  4WHU A;  3DPL R;  1HYI A;  3GV4 A;  4B7Y C;  5FE2 A;  1WEW A;  3IHP A;  4N4H A;  4PCE A;  2RS9 B;  5L97 A;  4KCX A;  4HBV A;  5HFR A;  5CQ3 A;  2L0B A;  4YC9 A;  5D24 A;  5IGN A;  5C85 A;  3RCW A;  5EK9 A;  2QIC A;  5A5O A;  5HFQ A;  5LJ2 A;  2K16 A;  4NYV A;  2DWW A;  2OUO A;  4RVR A;  5E7D A;  2MA5 A;  3N9M A;  5F63 A;  5CQ7 A;  3ZVY A;  5I7X A;  4Z6I A;  4F52 B;  1WIL A;  4XUA A;  4J3I A;  2NAA A;  4QR4 A;  4LYI A;  4O7F A;  5CRM A;  5IBN A;  4UIU A;  5C4Q A;  5AD3 A;  2KFT A;  4IR4 A;  5EIC A;  5FFY A;  2KWN A;  4HXR A;  4A9H A;  4A9E A;  4GNF A;  4UP0 A;  3LJW A;  4UIY A;  4J1P A;  5JI8 A;  3K2J A;  5A5R A;  4AVX A;  2EA6 A;  2XEU A;  4GNE A;  3MB3 A;  4WZ2 A;  4QSW A;  5C87 A;  3JVJ A;  4A9O A;  5COI A;  4ZW1 A;  5DKH A;  4YYK A;  4GND A;  5FE7 A;  1Z2Q A;  5FFW A;  1X0J A;  5DIN A;  4ZUX U;  1Z60 A;  4I7D A;  1ZBD B;  5EGU A;  5KH7 A;  4BJX A;  2R0Y A;  1F62 A;  3D7C A;  5BT5 A;  5DW2 A;  5E3D A;  4J0R A;  5EWV A;  3L11 A;  4Q0N A;  3PUR A;  5G05 B;  2YRE A;  4MEP A;  3O7A A;  2KU3 A;  4YYM A;  2QIZ A;  2KTB B;  4C67 A;  2I8N A;  2HYE D;  2YQL A;  4IOQ A;  4O70 A;  1MM2 A;  5E9K A;  1N87 A;  3N9O A;  5KTU A;  4TU6 A;  2YUR A;  4MR6 A;  2E3K A;  2ECG A;  1FP0 A;  2LGL A;  2M6M A;  5TBN A;  3NG2 A;  2YEM A;  5FE4 A;  2K4D A;  2R10 A;  5FH6 A;  3UW9 A;  5LJ1 A;  4NS5 A;  2C2V S;  5CQ4 A;  5CUA A;  5HLS A;  2I50 A;  2MT5 A;  4QNS A;  5HEN A;  4ALG A;  4TKP B;  5CFW A;  5LKX A;  2LDR A;  3KV6 A;  5FER A;  2I7K A;  5AME A;  2UZG A;  4QYL A;  5D3L A;  4PY6 A;  5EPB A;  3JVK A;  3L1Z B;  5D0C A;  2WP2 A;  3TLP A;  4YH3 A;  1G25 A;  4UIZ A;  4QR5 A;  5G4S A;  5D3R A;  5B77 A;  2KYU A;  4YY6 A;  5B79 A;  4XYA A;  5F3A A;  2K17 A;  5CTL A;  5CUD A;  2LRI C;  4LAD B;  2Y43 A;  2YHN A;  5G0F A;  5F1H A;  5IGM A;  4YBM A;  5FE1 A;  1WEM A;  4O75 A;  4UIW A;  4XY9 A;  5CY9 A;  5G04 B;  5E3G A;  1VYX A;  5FE3 A;  4A49 A;  4HXO A;  4NQM A;  4NUC A;  4A9I A;  3U5N A;  2VP7 A;  3S91 A;  3PUQ A;  4NYX A;  4WIV A;  5LUU A;  4A4C A;  1WEV A;  4O74 A;  5HQ5 A;  2GRC A;  5D1M B;  5EVA A;  3HME A;  4NRC A;  3DAI A;  3U5L A;  4TZ2 A;  1F68 A;  2D8S A;  2E6R A;  2LGG A;  4MVT A;  3RPG B;  5HEL A;  4NR7 A;  5D25 A;  4LZ2 A;  5FH8 A;  5BT3 A;  5H1U A;  2CSZ A;  4MEN A;  4QC3 A;  2E7O A;  2RNX A;  5C11 A;  3JVM A;  2KGI A;  3S92 A;  4AYC B;  4FK5 A;  4QB3 A;  5DYC A;  4CFL A;  2LXP C;  4O7A A;  3N9P A;  4TT6 A;  1VFY A;  2OSS A;  3M62 A;  4TTE A;  3LRQ A;  4C66 A;  2JMI A;  4GB0 A;  4LYS A;  5F61 A;  4WZ0 A;  5ENG A;  5CP5 A;  3IU5 A;  5LKZ A;  4MR4 A;  4O64 A;  4KV4 A;  2LGK A;  5JWM A;  5IGL A;  3C5K A;  1JSP B;  2ZET C;  5DX4 A;  5DLZ A;  4YY4 A;  4YH4 A;  2FUU A;  5BT4 A;  1BOR A;  3G0L A;  5I83 A;  2VPE A;  5K29 A;  5ACY A;  4TT2 A;  2MA6 A;  5EIS A;  4V3L C;  5II1 A;  3O33 A;  5CUC A;  5F25 A;  2Y1M A;  4W4U A;  5H1T A;  1MM3 A;  5EWC A;  5FDZ A;  2BAY A;  5HQ6 A;  4HBY A;  4QEW A;  4QY4 A;  5DYU A;  5II2 A;  3U5J A;  1X4J A;  1WUM A;  2YW5 A;  4AYC A;  3SOW A;  4QSR A;  5I3L A;  2L5U A;  4A9K A;  5I7Y A;  1CHC A;  4OUF A;  2DX8 A;  2EGP A;  2LN0 A;  3O37 A;  4YK0 A;  5D3J A;  3O70 A;  5AIT A;  4I7B A;  5H9M A;  4YYJ A;  1Z6U A;  3KQI A;  3KNV A;  5D1L B;  2YQD A;  5C7N A;  3FL2 A;  5ENB A;  1WIM A;  5FE8 A;  1K2F A;  3SHB A;  5FEY A;  3UVD A;  2VPG A;  5B76 A;  5HRW A;  4XI1 A;  1WES A;  5F36 A;  2YYR A;  4A9J A;  5C13 A;  4NR4 A;  4CLB A;  4TQN A;  1RMD A;  3VK6 A;  5JG6 A;  5I86 A;  2KIZ A;  3N9L A;  4LJN A;  2H60 A;  4V3K C;  5CQ8 A;  3QZT A;  5KHM A;  4R8P K;  3SVH A;  5TDW A;  4NUE A;  4X2I A;  3SVF A;  4IOO A;  2L84 A;  3P1F A;  2IDA A;  4R2Y A;  4NYW A;  4LZR A;  5EU1 A;  4OGI A;  5L8U A;  5B8D A;  4YBT A;  3EB5 A;  2VJF A;  4IR6 A;  4QYD A;  5EWW A;  4HXL A;  5F62 A;  2PNX A;  3O34 A;  5CQ6 A;  2ECW A;  5A82 A;  3I2D A;  2LXH C;  4O72 A;  5HJC A;  4CUP A;  4NR6 A;  3SVG A;  2CKL A;  2KE1 A;  5B78 A;  4UYG A;  5KTW A;  4AKN A;  3MHH A;  5DKD A;  4XY8 A;  2PUY A;  2YQM A;  3RPG C;  3NXB A;  1LDK C;  4O71 A;  5D3N A;  3C6W A;  1JM4 B;  4R7E A;  4N3W A;  2KR4 A;  5E74 A;  4BW2 A;  3FKM X;  4QEV A;  3ZPV 1;  2AN6 A;  5LCW B;  5LJ0 A;  1N72 A;  5CUB A;  3EB6 A;  4GNG A;  4QSP A;  4MR5 A;  5F5Z A;  5J0D A;  2ECV A;  4IR5 A;  2LSP B;  4QF3 A;  2R0V A;  2VJE A;  5E9M A;  4L7X A;  3PHD A;  4Z1Q A;  1T1H A;  2ECN A;  4WZ3 B;  2VPD A;  3LQH A;  5EQ1 A;  4BW1 A;  3N9N A;  4J0S A;  5A5P A;  4QSS A;  5E73 A;  3P1C A;  4TZ8 A;  3O35 A;  3ASL A;  5DFB A;  3UVW A;  5IID A;  4Q0O A;  2K1J A;  4A9N A;  4MSX A;  5IG6 A;  4IC3 A;  4CUR A;  4BHW A;  4A0C D;  3QZV A;  3G0J A;  4TU4 A;  4PCI A;  4QBM A;  5HQ7 A;  5IGK A;  2MIQ A;  4PPE A;  3HTK C;  4TYL A;  2YW8 A;  5KU3 A;  1V87 A;  4OGJ A;  4HXM A;  2ECJ A;  4QC1 A;  5ETD A;  3MQM A;  4NQN A;  5ENE A;  2M1R A;  5A5S A;  2RFJ A;  3GL6 A;  4HXS A;  4UP5 A;  1IYM A;  2G43 A;  2VNF A;  4NRB A;  5TB6 A;  5D3H A;  4Q6F A;  4LK9 A;  5L99 A;  4YAT A;  3ZTG A;  5D1K B;  5C89 A;  4S3O C;  4NN2 A;  5DLX A;  5ENH A;  5TCM A;  5E0R A;  3UV4 A;  2YSM A;  3ZYQ A;  3QZS A;  4Y03 A;  5CGP A;  5DYA A;  1WFK A;  5C8G A;  4UIT A;  5D26 A;  5DW1 A;  4NRA A;  4WHW A;  2G4A A;  4BW3 A;  1WGM A;  4NR9 A;  3UV5 A;  4UYF A;  5EA1 A;  5LKU A;  2KRE A;  3DQV R;  4FLP A;  2YT5 A;  3MHS A;  4UYD A;  2RNW A;  5DKC A;  5EV9 A;  1WEO A;  5KH3 A;  5FFV A;  2MJV B;  4LC2 A;  4QSV A;  4QZS A;  4PKL A;  5E9Y A;  4E96 A;  4YYN A;  4MEO A;  1FBV A;  5EP7 A;  2G6Q A;  5TRB A;  5DFD A;  4YAB A;  5FBX A;  2KWJ A;  5LVQ A;  4GPJ A;  3SOU A;  2R0S A;  5DY7 A;  5CZG A;  2YEL A;  5L8T A;  4YBS A;  4IOR A;  4O78 A;  3HMF A;  5HEM A;  1WEN A;  1X4I A;  4HBX A;  3MUL A;  2NXB A;  2LV9 A;  5DKA A;  5DYX A;  3U5P A;  4UIV A;  5KH9 A;  4NR8 A;  4A9F A;  4IC2 A;  4Z93 A;  4UI9 B;  3KV5 A;  5TDR A;  1E4U A;  5CUE A;  2CT2 A;  2DVQ A;  2RO1 A;  3ZYU A;  2RSD A;  4S3O B;  5FH7 A;  4HXK A;  2VJF B;  5H85 A;  2YHO A;  2MUM A;  2L80 A;  4N4F A;  5I80 A;  1WEE A;  1U6G B;  1X4U A;  4QUT A;  4HXN A;  2F6N A;  2CKL B;  4ALH A;  3P1E A;  2ECT A;  2JRJ A;  2H0D A;  5KTX A;  1WEP A;  5ENC A;  1EQF A;  1ZS5 A;  4HXP A;  4CUT A;  1E6I A;  4P5O B;  2DVR A;  4N4I A;  4CUQ A;  3M63 A;  2DVV A;  4CL9 A;  5HM0 A;  3ZNI A;  3LQI A;  4YYH A;  4HBW A;  5A85 A;  2RNY A;  2M85 A;  1DVP A;  4YYI A;  5E9I A;  5KO4 A;  3U5O A;  2YDW A;  5HCL A;  1VD4 A; 
#chains in the Genus database with same CATH topology
 4NUD A;  5ENF A;  5EI4 A;  2YUC A;  2VJE B;  5E9V A;  4AP4 A;  4QR3 A;  4LZS A;  4A4B A;  2M13 A;  2L75 A;  5G4R A;  4TS8 A;  5FE9 A;  3D1B A;  2F42 A;  5F60 A;  4F3I A;  3U5M A;  5LKT A;  5EWD A;  4C9Z A;  3MUK A;  5I29 A;  5EPS A;  5HRX A;  2G45 A;  3UVX A;  2LQ6 A;  3ZPV E;  3L1X A;  5CRZ A;  3MB4 A;  5ENJ A;  2FD4 A;  2XB1 A;  2L43 A;  5TAB A;  4UYE A;  5B75 A;  4BW4 A;  2VPB A;  2MD7 B;  2EOD A;  5FB1 A;  2MNZ A;  3FAO A;  4AUQ B;  5L96 A;  3ZVZ B;  3U5K A;  4CUU A;  2B0O E;  3ONI A;  4CA1 A;  4QEU A;  4QSX A;  2LGV A;  4Z0O A;  5FG5 A;  3JUE A;  2D82 A;  3UVY A;  2L85 A;  4KV1 A;  5L98 A;  2KWK A;  2Y1N A;  4FO9 A;  2C2L A;  5A7C A;  5CQT A;  4O76 A;  2HDP A;  3Q2E A;  5D7X A;  4YAD A;  4LYW A;  2D9E A;  1XWH A;  3N9Q A;  3V43 A;  4O7C A;  4AKH A;  2F6J A;  3HCU A;  4DON A;  5CQ5 A;  3SOX A;  2KKY A;  4ZDT A;  3IU6 A;  2WP1 A;  2E61 A;  4LR6 A;  2M3H A;  4A9M A;  4YYD A;  2OXQ C;  2DKW A;  5HRV A;  5D3S A;  2CSY A;  3T6R A;  3P1D A;  3MXF A;  4TT4 A;  4YAX A;  5F1L A;  2E6S A;  4UYF B;  1JM7 B;  4QF2 A;  3HCS A;  5I89 A;  2FSA A;  3T7L A;  4LKA A;  5AIU A;  4ZC9 A;  3UV2 A;  4FJC A;  2E7N A;  1WUG A;  1JOC A;  1LDJ B;  5A5Q A;  2MNY A;  3RTR B;  4O7B A;  5EM3 A;  2XOZ A;  3AQA A;  3AAD A;  5J3X A;  3DWY A;  2ECI A;  4BBQ A;  4XUB A;  4QUU A;  3JVL A;  5SVI A;  4LLB A;  2KWO A;  4NR5 A;  4I7C A;  3O36 A;  5ETB A;  4PTB A;  4A9L A;  2FFW A;  2JMJ A;  3M99 A;  4FIP A;  4ZQL A;  2YYN A;  4CFK A;  2YSJ A;  5F2P A;  4UIX A;  5EYA F;  5AMF A;  2OO1 A;  5AD2 A;  4Z6H A;  4IR3 A;  4MR3 A;  5CS8 A;  3ERR A;  2FUI A;  2DVS A;  3KDE C;  3I3J A;  5LVR A;  5D3T A;  5H1V A;  5I1Q A;  5CPE A;  1JM7 A;  2RI7 A;  2JMD A;  2L5E A;  3GG3 A;  5I88 A;  2N9G A;  2YEK A;  4NXJ A;  4LRG A;  4YYG A;  5FB0 A;  1DCQ A;  4X3G A;  4UYH A;  2DAT A;  5FE6 A;  1MBM A;  4QSU A;  5A81 A;  4CUS A;  3Q2F A;  4PS5 A;  3P5O A;  5CQA A;  5FG6 A;  5FE5 A;  2QJ0 A;  3LQJ A;  5CU8 A;  3LXJ A;  2RR4 A;  5EWH A;  5D3P A;  5A5N A;  5A83 A;  4CCG X;  2H0D B;  4WA6 A;  5FG4 A;  4Z1S A;  4LDF A;  4O7E A;  5EPR A;  4L58 A;  1WE9 A;  5DBM A;  4O77 A;  3HCT A;  4N4G A;  2CRR A;  4QSQ A;  5DFC A;  2YU4 A;  1WEQ A;  1WEU A;  5ENI A;  3O47 A;  5E9L A;  4B86 C;  5CUG A;  4QST A;  2KGG A;  1HYJ A;  5FE0 A;  4MEQ A;  5I40 A;  2MD8 C;  3HMH A;  4WHU A;  3DPL R;  1HYI A;  3GV4 A;  4B7Y C;  5FE2 A;  1WEW A;  3IHP A;  4N4H A;  4PCE A;  2RS9 B;  5L97 A;  4KCX A;  4HBV A;  5HFR A;  5CQ3 A;  2L0B A;  4YC9 A;  5D24 A;  5IGN A;  5C85 A;  3RCW A;  5EK9 A;  2QIC A;  5A5O A;  5HFQ A;  5LJ2 A;  2K16 A;  4NYV A;  2DWW A;  2OUO A;  4RVR A;  5E7D A;  2MA5 A;  3N9M A;  5F63 A;  5K3Q A;  5CQ7 A;  3ZVY A;  5I7X A;  4Z6I A;  4F52 B;  1WIL A;  2EGM A;  4XUA A;  2XOC A;  5SVX A;  4J3I A;  2NAA A;  4QR4 A;  4LYI A;  4O7F A;  5CRM A;  5IBN A;  4UIU A;  5C4Q A;  5AD3 A;  2KFT A;  4IR4 A;  5EIC A;  5FFY A;  2KWN A;  4HXR A;  4AKI A;  4A9H A;  2EJN A;  4A9E A;  4GNF A;  4UP0 A;  3LJW A;  4UIY A;  4J1P A;  5JI8 A;  3K2J A;  2JUN A;  5A5R A;  4AVX A;  2EA6 A;  2XEU A;  4GNE A;  3MB3 A;  3DWD A;  4WZ2 A;  4QSW A;  5C87 A;  3JVJ A;  4A9O A;  5COI A;  4ZW1 A;  5DKH A;  4YYK A;  4GND A;  5FE7 A;  1Z2Q A;  5FFW A;  1X0J A;  5DIN A;  4ZUX U;  1Z60 A;  4I7D A;  1ZBD B;  5EGU A;  5KH7 A;  4BJX A;  2R0Y A;  1F62 A;  3D7C A;  5BT5 A;  5DW2 A;  5E3D A;  4J0R A;  5EWV A;  3L11 A;  4Q0N A;  3PUR A;  5G05 B;  2YRE A;  4MEP A;  3O7A A;  2KU3 A;  4YYM A;  2QIZ A;  2KTB B;  4C67 A;  2I8N A;  2HYE D;  2YQL A;  4IOQ A;  4O70 A;  1MM2 A;  5E9K A;  1N87 A;  3N9O A;  5KTU A;  4TU6 A;  2YUR A;  4MR6 A;  2E3K A;  3MDB C;  2ECG A;  5SVI B;  1FP0 A;  2LGL A;  2M6M A;  5TBN A;  3NG2 A;  2YEM A;  5FE4 A;  2K4D A;  2R10 A;  5FH6 A;  3UW9 A;  5LJ1 A;  4NS5 A;  2C2V S;  5CQ4 A;  4OGE A;  5CUA A;  5HLS A;  2I50 A;  2MT5 A;  4QNS A;  5HEN A;  4ALG A;  4TKP B;  5CFW A;  5LKX A;  2LDR A;  3KV6 A;  5FER A;  2I7K A;  5AME A;  2UZG A;  4QYL A;  5D3L A;  4PY6 A;  5EPB A;  3JVK A;  3L1Z B;  5D0C A;  2WP2 A;  3TLP A;  4YH3 A;  1G25 A;  4UIZ A;  4QR5 A;  5G4S A;  5D3R A;  5B77 A;  2KYU A;  4YY6 A;  2P57 A;  4XYA A;  5B79 A;  5F3A A;  2K17 A;  2IQJ A;  5CTL A;  5CUD A;  2LRI C;  4LAD B;  2JM3 A;  3M7K A;  4AI6 A;  3E2D A;  2Y43 A;  2YHN A;  5G0F A;  5F1H A;  5IGM A;  4YBM A;  5FE1 A;  1WEM A;  4O75 A;  4UIW A;  4XY9 A;  5CY9 A;  5G04 B;  5E3G A;  1VYX A;  5FE3 A;  2DJA A;  4HXO A;  4A49 A;  4NQM A;  4NUC A;  4A9I A;  3U5N A;  2VP7 A;  3S91 A;  3PUQ A;  4NYX A;  4WIV A;  5LUU A;  4A4C A;  1WEV A;  4O74 A;  5HQ5 A;  2GRC A;  2XOY A;  5D1M B;  5EVA A;  3HME A;  4NRC A;  3DAI A;  3U5L A;  4TZ2 A;  1F68 A;  2D8S A;  2E6R A;  2LGG A;  4MVT A;  3RPG B;  5HEL A;  4NR7 A;  5D25 A;  4LZ2 A;  5FH8 A;  5BT3 A;  5H1U A;  4Z0R A;  2CSZ A;  4MEN A;  4QC3 A;  2E7O A;  2RNX A;  2OWA A;  3JVM A;  5C11 A;  2KGI A;  4O62 A;  3S92 A;  2YVR A;  4AYC B;  4FK5 A;  4QB3 A;  5DYC A;  4CFL A;  2LXP C;  4O7A A;  3N9P A;  4TT6 A;  1VFY A;  2OSS A;  3M62 A;  4TTE A;  3LRQ A;  4C66 A;  2JMI A;  4GB0 A;  4LYS A;  5F61 A;  4WZ0 A;  5ENG A;  5CP5 A;  3IU5 A;  5LKZ A;  4MR4 A;  4O64 A;  4KV4 A;  2LGK A;  5JWM A;  5IGL A;  3C5K A;  1JSP B;  2ZET C;  5DX4 A;  5DLZ A;  4YY4 A;  4YH4 A;  3VKG A;  2FUU A;  5BT4 A;  1BOR A;  3G0L A;  5I83 A;  2VPE A;  5K29 A;  5ACY A;  4TT2 A;  2MA6 A;  5EIS A;  4V3L C;  5II1 A;  3O33 A;  5CUC A;  5F25 A;  2Y1M A;  4W4U A;  5H1T A;  1MM3 A;  5EWC A;  5FDZ A;  2BAY A;  5HQ6 A;  4HBY A;  4QEW A;  4QY4 A;  5DYU A;  5II2 A;  3U5J A;  1X4J A;  3FJU B;  1WUM A;  2YW5 A;  4AYC A;  3SOW A;  4QSR A;  5I3L A;  2L5U A;  4A9K A;  5I7Y A;  1CHC A;  4OUF A;  2DX8 A;  2EGP A;  2LN0 A;  3O37 A;  4YK0 A;  5D3J A;  3O70 A;  5AIT A;  4I7B A;  5H9M A;  4YYJ A;  1Z6U A;  3KQI A;  3KNV A;  5D1L B;  2MKE A;  2YQD A;  5C7N A;  3FL2 A;  2LAU A;  5ENB A;  3VKH A;  5FE8 A;  1K2F A;  1WIM A;  2CRW A;  3SHB A;  5FEY A;  3UVD A;  2VPG A;  5B76 A;  5HRW A;  4XI1 A;  2EXU A;  1WES A;  5F36 A;  2YYR A;  4A9J A;  5C13 A;  4NR4 A;  4CLB A;  4TQN A;  1RMD A;  3T9K A;  3VK6 A;  5JG6 A;  5I86 A;  2KIZ A;  3N9L A;  4LJN A;  2H60 A;  4V3K C;  5CQ8 A;  3QZT A;  5KHM A;  4R8P K;  3SVH A;  3LDY A;  5TDW A;  4NUE A;  4X2I A;  3SVF A;  4IOO A;  2L84 A;  3FAN A;  3P1F A;  2IDA A;  4R2Y A;  4NYW A;  4LZR A;  5EU1 A;  4OGI A;  5L8U A;  5B8D A;  4YBT A;  2D8U A;  3EB5 A;  2VJF A;  4IR6 A;  4QYD A;  5EWW A;  4HXL A;  5F62 A;  2PNX A;  3O34 A;  5CQ6 A;  2ECW A;  5A82 A;  3I2D A;  2LXH C;  3Q1D A;  4O72 A;  5HJC A;  4CUP A;  4NR6 A;  3SVG A;  2CKL A;  2KE1 A;  5B78 A;  4UYG A;  5KTW A;  1ZKR A;  4AKN A;  3MHH A;  4OGC A;  5DKD A;  4AKG A;  4XY8 A;  2PUY A;  2YQM A;  3H7H A;  3NXB A;  3RPG C;  1LDK C;  4O71 A;  5D3N A;  3C6W A;  1JM4 B;  3D1D A;  4R7E A;  4N3W A;  2KR4 A;  5E74 A;  4BW2 A;  3FKM X;  4QEV A;  3ZPV 1;  2AN6 A;  5LCW B;  5LJ0 A;  1N72 A;  5CUB A;  3EB6 A;  4GNG A;  4QSP A;  4MR5 A;  5F5Z A;  5J0D A;  3DDT A;  2ECV A;  4IR5 A;  2LSP B;  4QF3 A;  2R0V A;  2VJE A;  5E9M A;  4L7X A;  3PHD A;  4Z1Q A;  1T1H A;  2ECN A;  4WZ3 B;  2VPD A;  3LQH A;  5EQ1 A;  4BW1 A;  3N9N A;  4J0S A;  5A5P A;  4QSS A;  5E73 A;  3LVQ E;  3P1C A;  4TZ8 A;  3O35 A;  3ASL A;  5DFB A;  3UVW A;  5IID A;  4Q0O A;  2K1J A;  4A9N A;  2CON A;  4MSX A;  3PLW A;  5IG6 A;  4IC3 A;  4CUR A;  4BHW A;  4A0C D;  3QZV A;  1PUO A;  3G0J A;  3FEH A;  4TU4 A;  4PCI A;  4QBM A;  5HQ7 A;  5IGK A;  2MIQ A;  4PPE A;  3HTK C;  4TYL A;  3SUB A;  2YW8 A;  5KU3 A;  1V87 A;  4OGJ A;  4HXM A;  2ECJ A;  4QC1 A;  5ETD A;  3MQM A;  4NQN A;  5ENE A;  2DSM A;  2M1R A;  5A5S A;  2RFJ A;  3GL6 A;  4HXS A;  4UP5 A;  1IYM A;  2CSV A;  2G43 A;  2VNF A;  4NRB A;  5TB6 A;  5D3H A;  4Q6F A;  4LK9 A;  5L99 A;  4YAT A;  3ZTG A;  5D1K B;  5C89 A;  4S3O C;  4NN2 A;  2KKX A;  5DLX A;  5ENH A;  5TCM A;  5E0R A;  3UV4 A;  2YSM A;  3ZYQ A;  3QZS A;  4Y03 A;  5CGP A;  5DYA A;  4F1P A;  1WFK A;  5C8G A;  4UIT A;  5D26 A;  5DW1 A;  4NRA A;  4WHW A;  3FM8 C;  2G4A A;  4BW3 A;  1WGM A;  4NR9 A;  3UV5 A;  4UYF A;  5EA1 A;  5LKU A;  2KRE A;  3DQV R;  4FLP A;  2YT5 A;  3MHS A;  4UYD A;  2RNW A;  5DKC A;  5EV9 A;  1WEO A;  5KH3 A;  5FFV A;  2MJV B;  4LC2 A;  4QSV A;  4QZS A;  4PKL A;  5E9Y A;  4E96 A;  4YYN A;  4MEO A;  1FBV A;  5EP7 A;  2G6Q A;  5TRB A;  5DFD A;  4YAB A;  5FBX A;  2KWJ A;  5LVQ A;  4GPJ A;  3SOU A;  2R0S A;  5SVY A;  5DY7 A;  5CZG A;  2YEL A;  5L8T A;  2XP0 A;  4YBS A;  4IOR A;  4O78 A;  3HMF A;  5HEM A;  1WEN A;  2L7P A;  1X4I A;  4HBX A;  3MUL A;  2NXB A;  2LV9 A;  5DKA A;  5DYX A;  3U5P A;  4UIV A;  5KH9 A;  4NR8 A;  4A9F A;  4IC2 A;  4Z93 A;  4UI9 B;  3KV5 A;  5TDR A;  1E4U A;  5CUE A;  2CT2 A;  2DVQ A;  2RO1 A;  3ZYU A;  2RSD A;  4S3O B;  5FH7 A;  4HXK A;  2VJF B;  5H85 A;  2YHO A;  2MUM A;  2L80 A;  4N4F A;  5I80 A;  1WEE A;  1U6G B;  1X4U A;  4QUT A;  4HXN A;  4H9D A;  2F6N A;  2CKL B;  4ALH A;  3P1E A;  2ECT A;  2JRJ A;  2H0D A;  5KTX A;  1WEP A;  5ENC A;  1EQF A;  1ZS5 A;  4HXP A;  4CUT A;  1E6I A;  3LJU X;  4P5O B;  2DVR A;  4N4I A;  4CUQ A;  3M63 A;  2DVV A;  4CL9 A;  5HM0 A;  3ZNI A;  4QQ4 A;  3LQI A;  4YYH A;  4HBW A;  5A85 A;  2RNY A;  2M85 A;  1DVP A;  4YYI A;  5E9I A;  5KO4 A;  3U5O A;  2YDW A;  3LVR E;  5HCL A;  1VD4 A; 
#chains in the Genus database with same CATH homology
 4NUD A;  5ENF A;  5EI4 A;  2YUC A;  2VJE B;  5E9V A;  4AP4 A;  4QR3 A;  4LZS A;  4A4B A;  2L75 A;  5G4R A;  4TS8 A;  5FE9 A;  2F42 A;  5F60 A;  4F3I A;  3U5M A;  5LKT A;  5EWD A;  4C9Z A;  3MUK A;  5I29 A;  5EPS A;  5HRX A;  2G45 A;  3UVX A;  2LQ6 A;  3ZPV E;  3L1X A;  5CRZ A;  3MB4 A;  5ENJ A;  2XB1 A;  2L43 A;  5TAB A;  4UYE A;  5B75 A;  4BW4 A;  2VPB A;  2MD7 B;  2EOD A;  5FB1 A;  2MNZ A;  4AUQ B;  5L96 A;  3ZVZ B;  3U5K A;  4CUU A;  3ONI A;  4CA1 A;  4QEU A;  4QSX A;  2LGV A;  5FG5 A;  2D82 A;  3UVY A;  2L85 A;  4KV1 A;  5L98 A;  2KWK A;  2Y1N A;  4FO9 A;  2C2L A;  5A7C A;  5CQT A;  4O76 A;  2HDP A;  3Q2E A;  5D7X A;  4YAD A;  4LYW A;  2D9E A;  1XWH A;  3N9Q A;  3V43 A;  4O7C A;  2F6J A;  3HCU A;  4DON A;  5CQ5 A;  3SOX A;  4ZDT A;  3IU6 A;  2WP1 A;  2M3H A;  4LR6 A;  4A9M A;  4YYD A;  2OXQ C;  2DKW A;  5HRV A;  5D3S A;  2CSY A;  3T6R A;  3P1D A;  3MXF A;  4TT4 A;  4YAX A;  5F1L A;  2E6S A;  4UYF B;  1JM7 B;  4QF2 A;  3HCS A;  5I89 A;  2FSA A;  3T7L A;  4LKA A;  5AIU A;  4ZC9 A;  3UV2 A;  4FJC A;  2E7N A;  1WUG A;  1JOC A;  1LDJ B;  5A5Q A;  2MNY A;  3RTR B;  4O7B A;  5EM3 A;  3AQA A;  3AAD A;  5J3X A;  3DWY A;  2ECI A;  4BBQ A;  4XUB A;  4QUU A;  3JVL A;  4LLB A;  2KWO A;  4NR5 A;  4I7C A;  3O36 A;  5ETB A;  4PTB A;  4A9L A;  2JMJ A;  3M99 A;  4FIP A;  4ZQL A;  2YYN A;  4CFK A;  2YSJ A;  5F2P A;  4UIX A;  5EYA F;  5AMF A;  2OO1 A;  5AD2 A;  4Z6H A;  4IR3 A;  4MR3 A;  5CS8 A;  2FUI A;  2DVS A;  3I3J A;  5LVR A;  5D3T A;  5H1V A;  5I1Q A;  5CPE A;  1JM7 A;  2RI7 A;  2JMD A;  2L5E A;  3GG3 A;  5I88 A;  2N9G A;  2YEK A;  4NXJ A;  4LRG A;  4YYG A;  5FB0 A;  4X3G A;  4UYH A;  2DAT A;  5FE6 A;  4QSU A;  5A81 A;  4CUS A;  3Q2F A;  4PS5 A;  3P5O A;  5CQA A;  5FG6 A;  5FE5 A;  2QJ0 A;  3LQJ A;  5CU8 A;  3LXJ A;  5EWH A;  5D3P A;  5A5N A;  5A83 A;  4CCG X;  2H0D B;  4WA6 A;  5FG4 A;  4Z1S A;  4LDF A;  4O7E A;  5EPR A;  4L58 A;  1WE9 A;  5DBM A;  4O77 A;  3HCT A;  4N4G A;  4QSQ A;  5DFC A;  2YU4 A;  1WEQ A;  1WEU A;  5ENI A;  5E9L A;  4B86 C;  5CUG A;  4QST A;  2KGG A;  1HYJ A;  5FE0 A;  4MEQ A;  5I40 A;  2MD8 C;  3HMH A;  4WHU A;  3DPL R;  1HYI A;  3GV4 A;  4B7Y C;  5FE2 A;  1WEW A;  3IHP A;  4N4H A;  4PCE A;  2RS9 B;  5L97 A;  4KCX A;  4HBV A;  5HFR A;  5CQ3 A;  2L0B A;  4YC9 A;  5D24 A;  5IGN A;  5C85 A;  3RCW A;  5EK9 A;  2QIC A;  5A5O A;  5HFQ A;  5LJ2 A;  2K16 A;  4NYV A;  2DWW A;  2OUO A;  4RVR A;  5E7D A;  2MA5 A;  3N9M A;  5F63 A;  5CQ7 A;  3ZVY A;  5I7X A;  4Z6I A;  4F52 B;  1WIL A;  4XUA A;  4J3I A;  2NAA A;  4QR4 A;  4LYI A;  4O7F A;  5CRM A;  5IBN A;  4UIU A;  5C4Q A;  5AD3 A;  2KFT A;  4IR4 A;  5EIC A;  5FFY A;  2KWN A;  4HXR A;  4A9H A;  4A9E A;  4GNF A;  4UP0 A;  3LJW A;  4UIY A;  4J1P A;  5JI8 A;  3K2J A;  5A5R A;  4AVX A;  2EA6 A;  2XEU A;  4GNE A;  3MB3 A;  4WZ2 A;  4QSW A;  5C87 A;  3JVJ A;  4A9O A;  5COI A;  4ZW1 A;  5DKH A;  4YYK A;  4GND A;  5FE7 A;  1Z2Q A;  5FFW A;  1X0J A;  5DIN A;  4ZUX U;  1Z60 A;  4I7D A;  1ZBD B;  5EGU A;  5KH7 A;  4BJX A;  2R0Y A;  1F62 A;  3D7C A;  5BT5 A;  5DW2 A;  5E3D A;  4J0R A;  5EWV A;  3L11 A;  4Q0N A;  3PUR A;  5G05 B;  2YRE A;  4MEP A;  3O7A A;  2KU3 A;  4YYM A;  2QIZ A;  2KTB B;  4C67 A;  2I8N A;  2HYE D;  2YQL A;  4IOQ A;  4O70 A;  1MM2 A;  5E9K A;  1N87 A;  3N9O A;  5KTU A;  4TU6 A;  2YUR A;  4MR6 A;  2E3K A;  2ECG A;  1FP0 A;  2LGL A;  2M6M A;  5TBN A;  3NG2 A;  2YEM A;  5FE4 A;  2K4D A;  2R10 A;  5FH6 A;  3UW9 A;  5LJ1 A;  4NS5 A;  2C2V S;  5CQ4 A;  5CUA A;  5HLS A;  2I50 A;  2MT5 A;  4QNS A;  5HEN A;  4ALG A;  4TKP B;  5CFW A;  5LKX A;  2LDR A;  3KV6 A;  5FER A;  2I7K A;  5AME A;  2UZG A;  4QYL A;  5D3L A;  4PY6 A;  5EPB A;  3JVK A;  3L1Z B;  5D0C A;  2WP2 A;  3TLP A;  4YH3 A;  1G25 A;  4UIZ A;  4QR5 A;  5G4S A;  5D3R A;  5B77 A;  2KYU A;  4YY6 A;  5B79 A;  4XYA A;  5F3A A;  2K17 A;  5CTL A;  5CUD A;  2LRI C;  4LAD B;  2Y43 A;  2YHN A;  5G0F A;  5F1H A;  5IGM A;  4YBM A;  5FE1 A;  1WEM A;  4O75 A;  4UIW A;  4XY9 A;  5CY9 A;  5G04 B;  5E3G A;  1VYX A;  5FE3 A;  4A49 A;  4HXO A;  4NQM A;  4NUC A;  4A9I A;  3U5N A;  2VP7 A;  3S91 A;  3PUQ A;  4NYX A;  4WIV A;  5LUU A;  4A4C A;  1WEV A;  4O74 A;  5HQ5 A;  2GRC A;  5D1M B;  5EVA A;  3HME A;  4NRC A;  3DAI A;  3U5L A;  4TZ2 A;  1F68 A;  2D8S A;  2E6R A;  2LGG A;  4MVT A;  3RPG B;  5HEL A;  4NR7 A;  5D25 A;  4LZ2 A;  5FH8 A;  5BT3 A;  5H1U A;  2CSZ A;  4MEN A;  4QC3 A;  2E7O A;  2RNX A;  5C11 A;  3JVM A;  2KGI A;  3S92 A;  4AYC B;  4FK5 A;  4QB3 A;  5DYC A;  4CFL A;  2LXP C;  4O7A A;  3N9P A;  4TT6 A;  1VFY A;  2OSS A;  3M62 A;  4TTE A;  3LRQ A;  4C66 A;  2JMI A;  4GB0 A;  4LYS A;  5F61 A;  4WZ0 A;  5ENG A;  5CP5 A;  3IU5 A;  5LKZ A;  4MR4 A;  4O64 A;  4KV4 A;  2LGK A;  5JWM A;  5IGL A;  3C5K A;  1JSP B;  2ZET C;  5DX4 A;  5DLZ A;  4YY4 A;  4YH4 A;  2FUU A;  5BT4 A;  1BOR A;  3G0L A;  5I83 A;  2VPE A;  5K29 A;  5ACY A;  4TT2 A;  2MA6 A;  5EIS A;  4V3L C;  5II1 A;  3O33 A;  5CUC A;  5F25 A;  2Y1M A;  4W4U A;  5H1T A;  1MM3 A;  5EWC A;  5FDZ A;  2BAY A;  5HQ6 A;  4HBY A;  4QEW A;  4QY4 A;  5DYU A;  5II2 A;  3U5J A;  1X4J A;  1WUM A;  2YW5 A;  4AYC A;  3SOW A;  4QSR A;  5I3L A;  2L5U A;  4A9K A;  5I7Y A;  1CHC A;  4OUF A;  2DX8 A;  2EGP A;  2LN0 A;  3O37 A;  4YK0 A;  5D3J A;  3O70 A;  5AIT A;  4I7B A;  5H9M A;  4YYJ A;  1Z6U A;  3KQI A;  3KNV A;  5D1L B;  2YQD A;  5C7N A;  3FL2 A;  5ENB A;  1WIM A;  5FE8 A;  1K2F A;  3SHB A;  5FEY A;  3UVD A;  2VPG A;  5B76 A;  5HRW A;  4XI1 A;  1WES A;  5F36 A;  2YYR A;  4A9J A;  5C13 A;  4NR4 A;  4CLB A;  4TQN A;  1RMD A;  3VK6 A;  5JG6 A;  5I86 A;  2KIZ A;  3N9L A;  4LJN A;  2H60 A;  4V3K C;  5CQ8 A;  3QZT A;  5KHM A;  4R8P K;  3SVH A;  5TDW A;  4NUE A;  4X2I A;  3SVF A;  4IOO A;  2L84 A;  3P1F A;  2IDA A;  4R2Y A;  4NYW A;  4LZR A;  5EU1 A;  4OGI A;  5L8U A;  5B8D A;  4YBT A;  3EB5 A;  2VJF A;  4IR6 A;  4QYD A;  5EWW A;  4HXL A;  5F62 A;  2PNX A;  3O34 A;  5CQ6 A;  2ECW A;  5A82 A;  3I2D A;  2LXH C;  4O72 A;  5HJC A;  4CUP A;  4NR6 A;  3SVG A;  2CKL A;  2KE1 A;  5B78 A;  4UYG A;  5KTW A;  4AKN A;  3MHH A;  5DKD A;  4XY8 A;  2PUY A;  2YQM A;  3RPG C;  3NXB A;  1LDK C;  4O71 A;  5D3N A;  3C6W A;  1JM4 B;  4R7E A;  4N3W A;  2KR4 A;  5E74 A;  4BW2 A;  3FKM X;  4QEV A;  3ZPV 1;  2AN6 A;  5LCW B;  5LJ0 A;  1N72 A;  5CUB A;  3EB6 A;  4GNG A;  4QSP A;  4MR5 A;  5F5Z A;  5J0D A;  2ECV A;  4IR5 A;  2LSP B;  4QF3 A;  2R0V A;  2VJE A;  5E9M A;  4L7X A;  3PHD A;  4Z1Q A;  1T1H A;  2ECN A;  4WZ3 B;  2VPD A;  3LQH A;  5EQ1 A;  4BW1 A;  3N9N A;  4J0S A;  5A5P A;  4QSS A;  5E73 A;  3P1C A;  4TZ8 A;  3O35 A;  3ASL A;  5DFB A;  3UVW A;  5IID A;  4Q0O A;  2K1J A;  4A9N A;  4MSX A;  5IG6 A;  4IC3 A;  4CUR A;  4BHW A;  4A0C D;  3QZV A;  3G0J A;  4TU4 A;  4PCI A;  4QBM A;  5HQ7 A;  5IGK A;  2MIQ A;  4PPE A;  3HTK C;  4TYL A;  2YW8 A;  5KU3 A;  1V87 A;  4OGJ A;  4HXM A;  2ECJ A;  4QC1 A;  5ETD A;  3MQM A;  4NQN A;  5ENE A;  2M1R A;  5A5S A;  2RFJ A;  3GL6 A;  4HXS A;  4UP5 A;  1IYM A;  2G43 A;  2VNF A;  4NRB A;  5TB6 A;  5D3H A;  4Q6F A;  4LK9 A;  5L99 A;  4YAT A;  3ZTG A;  5D1K B;  5C89 A;  4S3O C;  4NN2 A;  5DLX A;  5ENH A;  5TCM A;  5E0R A;  3UV4 A;  2YSM A;  3ZYQ A;  3QZS A;  4Y03 A;  5CGP A;  5DYA A;  1WFK A;  5C8G A;  4UIT A;  5D26 A;  5DW1 A;  4NRA A;  4WHW A;  2G4A A;  4BW3 A;  1WGM A;  4NR9 A;  3UV5 A;  4UYF A;  5EA1 A;  5LKU A;  2KRE A;  3DQV R;  4FLP A;  2YT5 A;  3MHS A;  4UYD A;  2RNW A;  5DKC A;  5EV9 A;  1WEO A;  5KH3 A;  5FFV A;  2MJV B;  4LC2 A;  4QSV A;  4QZS A;  4PKL A;  5E9Y A;  4E96 A;  4YYN A;  4MEO A;  1FBV A;  5EP7 A;  2G6Q A;  5TRB A;  5DFD A;  4YAB A;  5FBX A;  2KWJ A;  5LVQ A;  4GPJ A;  3SOU A;  2R0S A;  5DY7 A;  5CZG A;  2YEL A;  5L8T A;  4YBS A;  4IOR A;  4O78 A;  3HMF A;  5HEM A;  1WEN A;  1X4I A;  4HBX A;  3MUL A;  2NXB A;  2LV9 A;  5DKA A;  5DYX A;  3U5P A;  4UIV A;  5KH9 A;  4NR8 A;  4A9F A;  4IC2 A;  4Z93 A;  4UI9 B;  3KV5 A;  5TDR A;  1E4U A;  5CUE A;  2CT2 A;  2DVQ A;  2RO1 A;  3ZYU A;  2RSD A;  4S3O B;  5FH7 A;  4HXK A;  2VJF B;  5H85 A;  2YHO A;  2MUM A;  2L80 A;  4N4F A;  5I80 A;  1WEE A;  1U6G B;  1X4U A;  4QUT A;  4HXN A;  2F6N A;  2CKL B;  4ALH A;  3P1E A;  2ECT A;  2JRJ A;  2H0D A;  5KTX A;  1WEP A;  5ENC A;  1EQF A;  1ZS5 A;  4HXP A;  4CUT A;  1E6I A;  4P5O B;  2DVR A;  4N4I A;  4CUQ A;  3M63 A;  2DVV A;  4CL9 A;  5HM0 A;  3ZNI A;  3LQI A;  4YYH A;  4HBW A;  5A85 A;  2RNY A;  2M85 A;  1DVP A;  4YYI A;  5E9I A;  5KO4 A;  3U5O A;  2YDW A;  5HCL A;  1VD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...