4PTBA

Crystal structure of human sp100 phd-bromodomain in the free state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
NSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human SP100 PHD-Bromodomain in the free state
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Nuclear autoantigen Sp-100
total genus 59
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ptbA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ptbA01
3UV2A 1WESA 2M85A 4HBVA 4LZSA 5HFRA 1EQFA 4NQNA 5EP7A 3K2JA 4CUPA 3GG3A 2ECTA 4CUSA 5FG5A 5BT3A 4Z93A 5KTXA 4IOQA 5F5ZA 2ECWA 2DWWA 1XWHA 5TCMA 5LJ0A 3HMHA 4S3OC 4UYFA 3DWYA 4BW3A 4A0CD 5FG6A 2ECGA 5AD3A 4MEPA 1JM7A 5H1UA 3M63A 1F68A 4IC3A 4YYIA 5HRXA 3S92A 4N4FA 5TDRA 4FJCA 4NYVA 5A85A 4NRBA 5FFYA 4Z6IA 4A9EA 2ECVA 2HDPA 3LRQA 3ZYQA 5KH7A 5DKDA 4YY6A 5FE7A 4YATA 5F25A 3UV4A 4O74A 2DX8A 4WZ3B 3ZVYA 5C87A 4YC9A 5A5NA 2KWJA 3N9OA 2CSYA 4BW4A 5II1A 3MULA 5E0RA 5E9MA 3KV5A 5F36A 1RMDA 5CUEA 5E9KA 4A9NA 3IHPA 4S3OB 4HBYA 5D3HA 4O78A 4QR5A 5E74A 4QSTA 3ZPVE 3UVDA 3QZTA 2L85A 2L0BA 5CQ5A 4NQMA 3NXBA 3DQVR 2HYED 4IC2A 5CPEA 5D24A 2YQLA 4NUDA 5G05B 2NAAA 2QICA 4YYMA 5I40A 5CTLA 5B77A 5EWHA 4QEUA 5D3PA 3SVHA 4C9ZA 3QZSA 2F6JA 4GNDA 4BBQA 4QC1A 5H1VA 4TT4A 4IR5A 4HXSA 4O7BA 2Y43A 4A9KA 5HQ5A 4V3LC 2ECJA 4LYWA 5E7DA 2XEUA 4QEVA 4Y03A 4N4IA 5EVAA 3RTRB 4TQNA 2DVRA 5EWWA 5ETBA 5I88A 5CUAA 4ZQLA 5J0DA 5EWCA 3EB5A 5D3RA 4I7BA 4R8PK 3I3JA 3GV4A 2KYUA 2YDWA 5C13A 4UIWA 2CT2A 4GNFA 2JMJA 3UV5A 5LJ2A 5BT5A 5ENGA 2VP7A 5D7XA 4C67A 2YSMA 4CUQA 5CQTA 5F2PA 2IDAA 5CP5A 5JWMA 5EWVA 4C66A 3LXJA 3EB6A 5EV9A 5CUDA 5EA1A 1JOCA 2KFTA 2L80A 5DFBA 5C8GA 2G4AA 4KV4A 4YYGA 5CRMA 5LCWB 1WGMA 5D3NA 2M1RA 4J0SA 4PCEA 4IOOA 4TT2A 2G45A 4A49A 4PS5A 2NXBA 4NR8A 3SOXA 4QSRA 5D0CA 3PUQA 2KGGA 3O33A 4QSWA 5EK9A 4XUAA 5D3LA 4QSPA 4Z1SA 2YYRA 4MR5A 1WENA 2PNXA 4QR4A 5HQ7A 5LJ1A 5KO4A 4AKNA 2MUMA 4O64A 5FH8A 2VJEA 5JG6A 4J0RA 3UVWA 4O72A 4Z6HA 4XUBA 1WIMA 5DINA 4NRCA 3HMFA 4UIUA 2QJ0A 4QBMA 4YYJA 5E9VA 5EGUA 5FBXA 5FE4A 4ALHA 4L7XA 4TU6A 2D8SA 2YU4A 3N9NA 4J1PA 4LK9A 4IR3A 5FE2A 2BAYA 4F3IA 1MM2A 4MR6A 4NYXA 4ALGA 3LJWA 4NR4A 5CQAA 5A5OA 5H9MA 5CY9A 4KV1A 2YW8A 5FERA 5L8UA 2F42A 2KREA 3L1ZB 4NR5A 4PKLA 3ONIA 3AQAA 3L1XA 4AYCA 4OGIA 3U5NA 2YQDA 4Q6FA 4Q0NA 5D1LB 2MD7B 4A4BA 5FB1A 4OGJA 2E3KA 4LJNA 4TZ2A 2EODA 3HCSA 3N9MA 1E6IA 5K29A 5F1HA 2KIZA 5D26A 2LV9A 5J3XA 2VJEB 3SOUA 4NS5A 5IIDA 4LR6A 4AVXA 1JM7B 2LN0A 3G0LA 4NR6A 2AN6A 1N72A 3RPGC 5H85A 2YHOA 5KH9A 5L97A 4CCGX 4NYWA 5HJCA 4NRAA 2D9EA 4BJXA 5FE0A 4XYAA 4DONA 5AD2A 3U5JA 3MXFA 1N87A 5TDWA 5AMEA 5LKZA 1X4IA 4XY9A 1F62A 2R10A 3I2DA 4LADB 1WEOA 3FKMX 2MIQA 5DLZA 5ENIA 5IG6A 2YREA 4N3WA 1U6GB 5IGMA 4LDFA 1IYMA 3NG2A 4QEWA 3O34A 5B78A 3M62A 5I29A 3DPLR 3N9LA 3MUKA 4QR3A 4MR3A 4UYGA 4HXOA 4LZ2A 5LUUA 2FSAA 4CA1A 4QUUA 4MVTA 4CUUA 5DKAA 3T7LA 5B8DA 4BHWA 4YYHA 1HYJA 5DY7A 3C5KA 3N9QA 4QUTA 4CURA 4IORA 4MR4A 3IU5A 5DFCA 3Q2FA 1WE9A 2GRCA 2DATA 5E9YA 5B79A 2ZETC 2DKWA 2KGIA 5DX4A 4CUTA 4QNSA 4WIVA 4J3IA 4X2IA 5HFQA 2L5EA 5CQ3A 5DYUA 5L98A 3SVFA 2VPDA 2MD8C 4LYSA 5CQ7A 5DKHA 4CL9A 2VPGA 2JMIA 2C2VS 5DW1A 4MSXA 3KQIA 4NXJA 4PTBA 5EU1A 4NR9A 3GL6A 5FFVA 1DVPA 2KTBB 1WILA 2LDRA 4PPEA 5ENHA 1V87A 4QYLA 3MQMA 4PCIA 5D3JA 4YAXA 2I50A 5E73A 5EISA 4UIVA 3ASLA 4AUQB 5ETDA 4Z1QA 3LQHA 4KCXA 1WEMA 3MB4A 4QB3A 2YSJA 3PURA 5DYXA 2LXHC 2R0SA 5CGPA 4F52B 4O7AA 5L99A 2KWKA 4A9IA 5EPRA 5I3LA 3MB3A 4ZC9A 4E96A 4O75A 3PHDA 4TS8A 4BW1A 4I7CA 2N9GA 4TZ8A 4O76A 4UIZA 4O71A 2JRJA 5C11A 2E7OA 5ENCA 2MNYA 4P5OB 5FB0A 2C2LA 3KV6A 2L84A 2LGKA 2WP2A 5A82A 2RFJA 5F1LA 1LDKC 2OSSA 4QYDA 1JSPB 4XY8A 3ZTGA 2DVVA 1G25A 4B7YC 2YEKA 3HCTA 2R0YA 2RNYA 4QSVA 1FBVA 5HM0A 5I86A 3UW9A 2CKLA 5DFDA 5G4SA 4O7FA 4UP0A 4MENA 2LQ6A 2M3HA 5A5SA 2OXQC 2KR4A 2YYNA 5FE8A 4FO9A 2MJVB 5DW2A 5E3GA 5HRVA 4UIYA 5D1MB 5FFWA 5KH3A 4HXLA 2L43A 5TABA 4XI1A 5CRZA 1WEWA 4FLPA 3U5LA 4HXKA 5HRWA 4GNGA 1VD4A 3ZPV1 3O36A 3S91A 5IGLA 3JVJA 2KU3A 2ECIA 5AMFA 4N4GA 4WZ0A 5FE6A 3U5KA 4YH4A 5I80A 1LDJB 4LLBA 2VJFB 4LZRA 4MEOA 5C85A 2L5UA 3Q2EA 5EPSA 4FK5A 5C7NA 5LKTA 1T1HA 4HBWA 5KTUA 4GNEA 4WA6A 5L96A 5A5RA 5EICA 5EI4A 4HBXA 1X4UA 5DLXA 5ENEA 5G04B 4CLBA 2H0DA 5CQ4A 4TU4A 2LGVA 5KTWA 5IGKA 3P1FA 2RSDA 5HEMA 3L11A 5F62A 4A9JA 5G4RA 3IU6A 2VPBA 5CUBA 5I1QA 5CUCA 3UVYA 4ZUXU 4UI9B 1WEQA 4FIPA 5ACYA 4UITA 4UYHA 4YADA 2R0VA 2F6NA 5DYAA 5F63A 4HXPA 4L58A 5I83A 5FE3A 5EPBA 5EWDA 3SHBA 4TT6A 2JMDA 2KWOA 5C4QA 3P1EA 4LYIA 5F60A 5TRBA 5BT4A 5FE5A 2XB1A 5I7XA 3ZYUA 4CFLA 4I7DA 2YHNA 3T6RA 1BORA 2I7KA 5FE1A 2KWNA 2L75A 3RPGB 4A4CA 2K16A 5CS8A 2LGLA 4OUFA 3N9PA 4HXNA 2OO1A 5E9LA 4R2YA 5FEYA 5CU8A 4IR4A 2H0DB 3D7CA 2YUCA 4AYCB 4N4HA 4O77A 1JM4B 2MA6A 5DBMA 3ZNIA 2FUIA 4O7EA 4UP5A 4QSUA 3KNVA 4UYFB 2RS9B 2G43A 2YEMA 5LKUA 2VNFA 4NUCA 5HQ6A 5II2A 2KE1A 5LVRA 5FH7A 2K1JA 5HCLA 2VJFA 3U5MA 4QSXA 5DYCA 4YYDA 5B75A 4A9HA 4ZW1A 3MHSA 5EYAF 3C6WA 4WHUA 4GB0A 3SVGA 5HENA 1K2FA 3P1DA 4NUEA 5ENFA 4CFKA 5LVQA 4TTEA 5KU3A 4W4UA 4TYLA 5D1KB 2CSZA 3SOWA 5FDZA 3JVLA 5LKXA 4V3KC 1CHCA 1VFYA 4MEQA 2RNWA 1WEVA 4A9FA 1X0JA 3DAIA 2RI7A 2DVQA 2YQMA 3FL2A 3VK6A 5H1TA 5JI8A 1VYXA 1WEUA 5G0FA 2VPEA 2E7NA 5A5PA 5FE9A 1WEPA 4UYEA 5A83A 4A9MA 3LQJA 2YURA 2PUYA 2UZGA 2LXPC 4WZ2A 3QZVA 5B76A 5IBNA 5CFWA 5I7YA 1WFKA 5EM3A 2DVSA 1Z60A 5A81A 2YELA 3O7AA 3P1CA 2YW5A 4TKPB 5KHMA 4QY4A 4A9OA 2E6RA 2WP1A 5E9IA 3TLPA 4YABA 2MT5A 2Y1NA 5CZGA 5E3DA 5FH6A 1FP0A 4YY4A 5I89A 1Z6UA 4O7CA 5CUGA 4R7EA 5HLSA 2K17A 2QIZA 5DKCA 3V43A 2ECNA 3G0JA 3HTKC 2OUOA 4UIXA 3O37A 4QC3A 1ZS5A 1WEEA 3JVMA 4LRGA 3RCWA 2MA5A 3ZVZB 4UYDA 2I8NA 1Z2QA 4QF2A 2CKLB 1ZBDB 1E4UA 3UVXA 3O70A 4O70A 4WHWA 3U5OA 5A7CA 5ENJA 2LGGA 4A9LA 5ENBA 2H60A 3P5OA 4HXMA 5TB6A 4QSQA 1X4JA 2MNZA 3HCUA 5AIUA 2RO1A 3MHHA 5C89A 5L8TA 4LKAA 4GPJA 5F61A 3JVKA 2E6SA 4YBSA 5EQ1A 4NN2A 3HMEA 4IR6A 5D25A 2EA6A 2Y1MA 4QZSA 4YBTA 1MM3A 5CQ6A 1WUGA 4HXRA 2FUUA 4YYKA 2LRIC 4AP4A 2G6QA 3LQIA 4NR7A 3O35A 5COIA 4ZDTA 4QSSA 4X3GA 2K4DA 4QF3A 4B86C 4YYNA 4Q0OA 1HYIA 4BW2A 2M6MA 3M99A 2EGPA 5D3SA 5TBNA 4YK0A 5D3TA 4YBMA 5AITA 5F3AA 3AADA 5A5QA 5FG4A 5IGNA 3U5PA 2YT5A 1WUMA 4PY6A 5HELA 2D82A 4YH3A 2RNXA 2LSPB 4RVRA 4LC2A 5CQ8A
chains in the Genus database with same CATH superfamily
3UV2A 1WESA 2M85A 4HBVA 4LZSA 5HFRA 2P57A 3SUBA 1EQFA 4NQNA 5EP7A 3K2JA 4CUPA 3GG3A 2ECTA 4CUSA 5FG5A 5BT3A 4Z93A 5KTXA 4IOQA 5F5ZA 2ECWA 2DWWA 1XWHA 5TCMA 5LJ0A 3HMHA 4S3OC 4UYFA 2XP0A 3DWYA 4BW3A 4A0CD 5FG6A 2ECGA 5AD3A 4MEPA 1JM7A 5H1UA 3M63A 1F68A 4IC3A 4YYIA 5HRXA 2B0OE 3S92A 4N4FA 5TDRA 4FJCA 4NYVA 5A85A 4NRBA 5FFYA 4Z6IA 4A9EA 2ECVA 2HDPA 3LRQA 3ZYQA 5KH7A 5DKDA 4YY6A 5FE7A 4YATA 5F25A 3UV4A 4O74A 2DX8A 4WZ3B 3ZVYA 5C87A 4YC9A 5A5NA 2KWJA 3N9OA 2CSYA 2KKXA 4BW4A 5II1A 3MULA 5E0RA 5E9MA 3KV5A 5F36A 1RMDA 5CUEA 5E9KA 4A9NA 3IHPA 4S3OB 4HBYA 5D3HA 4O78A 4QR5A 5E74A 4QSTA 3ZPVE 3O47A 3UVDA 3QZTA 2L85A 2L0BA 5CQ5A 4NQMA 3NXBA 3DQVR 2HYED 4IC2A 5CPEA 5D24A 2YQLA 4NUDA 5G05B 2NAAA 2QICA 4YYMA 5I40A 5CTLA 1DCQA 5B77A 5EWHA 4QEUA 5D3PA 3SVHA 3FANA 4C9ZA 3QZSA 2F6JA 4GNDA 4BBQA 4QC1A 5H1VA 4TT4A 4IR5A 4HXSA 4O7BA 3VKHA 2Y43A 4A9KA 5HQ5A 4V3LC 2ECJA 4LYWA 5E7DA 2XEUA 1ZKRA 4QEVA 4Y03A 4N4IA 5EVAA 3RTRB 5TBNA 4TQNA 2DVRA 2EGMA 5EWWA 5K3QA 5ETBA 5I88A 5CUAA 4ZQLA 5J0DA 5EWCA 3EB5A 3PLWA 5D3RA 4I7BA 4R8PK 3I3JA 3GV4A 2KYUA 2YDWA 5C13A 4UIWA 2CT2A 4GNFA 2JMJA 3UV5A 5LJ2A 4AI6A 5BT5A 5ENGA 2VP7A 5D7XA 4C67A 2YSMA 3FAOA 4CUQA 5CQTA 5F2PA 2IDAA 5CP5A 5JWMA 5EWVA 4C66A 3LXJA 3EB6A 5EV9A 5CUDA 5EA1A 3VKGA 1JOCA 2KFTA 2L80A 5DFBA 5C8GA 4O62A 2G4AA 2EXUA 4KV4A 4YYGA 5CRMA 5LCWB 1WGMA 5D3NA 2M1RA 4J0SA 4PCEA 4IOOA 4TT2A 2G45A 4A49A 4PS5A 2NXBA 4NR8A 5SVXA 3SOXA 4QSRA 5D0CA 3JUEA 3PUQA 2KGGA 3O33A 4QSWA 5EK9A 4XUAA 5D3LA 4QSPA 4Z1SA 2YYRA 4MR5A 1WENA 2PNXA 4QR4A 5HQ7A 3DWDA 5LJ1A 5KO4A 4AKNA 2FFWA 2MUMA 4O64A 5FH8A 2VJEA 5JG6A 4J0RA 3UVWA 4O72A 4Z6HA 3H7HA 4XUBA 1WIMA 5DINA 4NRCA 3HMFA 4UIUA 2QJ0A 4QBMA 4YYJA 5E9VA 5EGUA 5FBXA 5FE4A 4ALHA 4L7XA 4TU6A 2D8SA 2YU4A 3N9NA 4J1PA 4LK9A 4IR3A 5FE2A 2BAYA 4F3IA 1MM2A 4MR6A 4NYXA 4ALGA 3LJWA 4NR4A 5CQAA 5A5OA 5H9MA 2RR4A 5CY9A 4KV1A 2YW8A 5FERA 5L8UA 2F42A 2KREA 3L1ZB 4NR5A 4PKLA 3ONIA 3AQAA 3L1XA 4AYCA 4OGIA 3U5NA 2YQDA 4Q6FA 4Q0NA 5D1LB 2CONA 2MD7B 4A4BA 5FB1A 2D8UA 4OGJA 2E3KA 4LJNA 4TZ2A 2EODA 3HCSA 3N9MA 1E6IA 5K29A 5F1HA 2KIZA 5D26A 2LV9A 2CRWA 5J3XA 2VJEB 3SOUA 4NS5A 5IIDA 4LR6A 4AVXA 1JM7B 2LN0A 3G0LA 4NR6A 3FJUB 2AN6A 1N72A 3RPGC 5H85A 2YHOA 5KH9A 2XOZA 5L97A 2DJAA 4CCGX 4NYWA 5HJCA 4NRAA 2D9EA 4BJXA 5FE0A 4XYAA 4DONA 5AD2A 3U5JA 3MXFA 1N87A 5TDWA 5AMEA 5LKZA 1X4IA 4XY9A 1F62A 2R10A 3I2DA 4LADB 1WEOA 3FKMX 2MIQA 4AKIA 5DLZA 5ENIA 5IG6A 2YREA 4N3WA 1U6GB 5IGMA 4LDFA 1IYMA 3NG2A 4QEWA 3O34A 5B78A 3M62A 5I29A 3DPLR 3N9LA 3MUKA 4QR3A 4MR3A 4UYGA 2JUNA 4HXOA 4LZ2A 5LUUA 2FSAA 4CA1A 4QUUA 4MVTA 4CUUA 5DKAA 3T7LA 5B8DA 4BHWA 4YYHA 1HYJA 5DY7A 3C5KA 3N9QA 4QUTA 4CURA 4IORA 4MR4A 3IU5A 5DFCA 3Q2FA 1WE9A 2GRCA 2CRRA 2DATA 5E9YA 5B79A 2ZETC 2DKWA 2KGIA 5DX4A 4CUTA 4QNSA 4WIVA 4J3IA 4X2IA 5HFQA 2L5EA 5CQ3A 5DYUA 5L98A 3SVFA 2VPDA 2MD8C 4LYSA 5CQ7A 5DKHA 4CL9A 2VPGA 2JMIA 2C2VS 5DW1A 4MSXA 3KQIA 4NXJA 4PTBA 5EU1A 4NR9A 3GL6A 5FFVA 1DVPA 2KTBB 1WILA 2LDRA 4PPEA 5ENHA 1V87A 4QYLA 3MQMA 4PCIA 5D3JA 4YAXA 2I50A 5E73A 5EISA 4UIVA 3ASLA 4H9DA 4AUQB 5ETDA 4Z1QA 3LQHA 4KCXA 5SVYA 1WEMA 3MB4A 4QB3A 2YSJA 3PURA 5DYXA 2LXHC 2R0SA 5CGPA 4F52B 4O7AA 5L99A 2E61A 4A9IA 2KWKA 5EPRA 5I3LA 3MB3A 4ZC9A 4E96A 3D1DA 4O75A 3PHDA 4TS8A 4BW1A 4I7CA 2N9GA 3E2DA 4TZ8A 4O76A 4AKHA 4UIZA 4O71A 3FM8C 2JRJA 5C11A 2E7OA 5ENCA 2MNYA 4P5OB 5FB0A 2C2LA 3KV6A 2L84A 2LGKA 2WP2A 5A82A 2RFJA 5F1LA 1LDKC 3Q1DA 2OSSA 3LDYA 4QYDA 1JSPB 4XY8A 3ZTGA 3M7KA 2DVVA 3D1BA 1G25A 4B7YC 2YEKA 3HCTA 2R0YA 2RNYA 4QSVA 1FBVA 5HM0A 5I86A 3UW9A 2CKLA 5DFDA 5G4SA 4O7FA 4UP0A 4MENA 2LQ6A 2JM3A 2M3HA 5A5SA 2OXQC 2KR4A 2YYNA 5FE8A 4FO9A 2MJVB 5DW2A 5SVIA 5E3GA 5HRVA 4UIYA 5D1MB 5FFWA 5KH3A 4HXLA 2L43A 5TABA 4XI1A 5CRZA 1WEWA 4FLPA 3U5LA 4HXKA 5HRWA 4GNGA 1VD4A 3ZPV1 3O36A 2CSVA 3S91A 5IGLA 3JVJA 2KU3A 2ECIA 5AMFA 4N4GA 4WZ0A 5FE6A 3U5KA 4YH4A 5I80A 1LDJB 3MDBC 4LLBA 2VJFB 4LZRA 4MEOA 5C85A 2L5UA 3Q2EA 5EPSA 4FK5A 5C7NA 5LKTA 1T1HA 4HBWA 5KTUA 4GNEA 4WA6A 5L96A 5A5RA 4AKGA 5EICA 5EI4A 4HBXA 1X4UA 5DLXA 5ENEA 5G04B 4CLBA 2H0DA 5CQ4A 4TU4A 2LGVA 5KTWA 5IGKA 3P1FA 2RSDA 5HEMA 3L11A 2KKYA 5F62A 4A9JA 5G4RA 3IU6A 2VPBA 5CUBA 5I1QA 5CUCA 3UVYA 4ZUXU 4UI9B 1WEQA 4FIPA 5ACYA 4UITA 4UYHA 4YADA 2R0VA 2F6NA 5DYAA 5F63A 4HXPA 4L58A 5I83A 5FE3A 5EPBA 5EWDA 3SHBA 4TT6A 2JMDA 2KWOA 5C4QA 3P1EA 4LYIA 5F60A 5TRBA 5BT4A 5FE5A 2XB1A 5I7XA 3ZYUA 4CFLA 1MBMA 2L7PA 2YHNA 4I7DA 5SVIB 3T6RA 1BORA 2I7KA 5FE1A 2KWNA 2L75A 3RPGB 4A4CA 2K16A 5CS8A 2LGLA 4OUFA 3N9PA 4HXNA 2OO1A 5E9LA 4R2YA 5FEYA 5CU8A 4IR4A 2H0DB 3D7CA 2YUCA 4AYCB 4N4HA 4O77A 1JM4B 2MA6A 3KDEC 5DBMA 3ZNIA 2FUIA 4O7EA 4UP5A 4QSUA 3KNVA 4UYFB 2RS9B 2G43A 2YEMA 5LKUA 2VNFA 4NUCA 5HQ6A 5II2A 2KE1A 5LVRA 5FH7A 2K1JA 5HCLA 2VJFA 4Z0RA 3U5MA 4QSXA 5DYCA 4YYDA 5B75A 4A9HA 4ZW1A 3MHSA 5EYAF 3C6WA 4WHUA 4GB0A 3SVGA 5HENA 1K2FA 3P1DA 4NUEA 5ENFA 4CFKA 5LVQA 2IQJA 4TTEA 5KU3A 4W4UA 4TYLA 5D1KB 2CSZA 3SOWA 5FDZA 3JVLA 5LKXA 4V3KC 1CHCA 1VFYA 4MEQA 2RNWA 1WEVA 4A9FA 1X0JA 3DAIA 2RI7A 2DVQA 2YQMA 3FL2A 3VK6A 5H1TA 5JI8A 1VYXA 1WEUA 5G0FA 2VPEA 2E7NA 5A5PA 5FE9A 1WEPA 4F1PA 4UYEA 5A83A 3LJUX 4A9MA 3LQJA 2YURA 2PUYA 2UZGA 2LXPC 4WZ2A 3QZVA 5B76A 5IBNA 5CFWA 5I7YA 1WFKA 5EM3A 2DVSA 1Z60A 5A81A 2YELA 3O7AA 3ERRA 3P1CA 2YW5A 4TKPB 2M13A 2XOYA 5KHMA 4QY4A 4A9OA 2E6RA 3DDTA 2WP1A 4OGEA 5E9IA 3TLPA 4YABA 2MT5A 2Y1NA 5CZGA 5E3DA 5FH6A 1FP0A 4YY4A 2XOCA 5I89A 1Z6UA 3FEHA 4O7CA 5CUGA 4R7EA 5HLSA 2K17A 2QIZA 5DKCA 3V43A 2ECNA 3G0JA 2MKEA 2OUOA 4UIXA 3HTKC 3O37A 4QC3A 1ZS5A 1WEEA 3JVMA 4LRGA 3RCWA 2MA5A 3LVRE 4UYDA 2LAUA 2I8NA 2DSMA 1Z2QA 4QF2A 3ZVZB 2CKLB 1ZBDB 1E4UA 3UVXA 3O70A 4O70A 4WHWA 3U5OA 5A7CA 5ENJA 2LGGA 4A9LA 5ENBA 2H60A 3T9KA 3P5OA 4HXMA 5TB6A 4QSQA 1X4JA 2MNZA 3HCUA 5AIUA 2RO1A 3MHHA 5C89A 5L8TA 2OWAA 4LKAA 4GPJA 1PUOA 2EJNA 5F61A 3JVKA 2E6SA 4Z0OA 4YBSA 5EQ1A 4NN2A 3HMEA 4IR6A 5D25A 2EA6A 2YVRA 2Y1MA 4QZSA 4YBTA 1MM3A 5CQ6A 1WUGA 4HXRA 2FUUA 4YYKA 2LRIC 4AP4A 3LVQE 2G6QA 3LQIA 4NR7A 3O35A 5COIA 4ZDTA 4QSSA 4X3GA 2K4DA 4QF3A 4B86C 4YYNA 4Q0OA 1HYIA 4BW2A 2FD4A 2M6MA 2EGPA 5D3SA 3M99A 4YK0A 5D3TA 4YBMA 4OGCA 5F3AA 3AADA 5AITA 4QQ4A 5A5QA 5FG4A 5IGNA 3U5PA 2YT5A 1WUMA 4PY6A 5HELA 2D82A 4YH3A 2RNXA 2LSPB 4RVRA 4LC2A 5CQ8A
chains in the Genus database with same CATH topology
3UV2A 1WESA 2M85A 4HBVA 4LZSA 5HFRA 1EQFA 4NQNA 5EP7A 3K2JA 4CUPA 3GG3A 2ECTA 4CUSA 5FG5A 5BT3A 4Z93A 5KTXA 4IOQA 5F5ZA 2ECWA 2DWWA 1XWHA 5TCMA 5LJ0A 3HMHA 4S3OC 4UYFA 3DWYA 4BW3A 4A0CD 5FG6A 2ECGA 5AD3A 4MEPA 1JM7A 5H1UA 3M63A 1F68A 4IC3A 4YYIA 5HRXA 3S92A 4N4FA 5TDRA 4FJCA 4NYVA 5A85A 4NRBA 5FFYA 4Z6IA 4A9EA 2ECVA 2HDPA 3LRQA 3ZYQA 5KH7A 5DKDA 4YY6A 5FE7A 4YATA 5F25A 3UV4A 4O74A 2DX8A 4WZ3B 3ZVYA 5C87A 4YC9A 5A5NA 2KWJA 3N9OA 2CSYA 4BW4A 5II1A 3MULA 5E0RA 5E9MA 3KV5A 5F36A 1RMDA 5CUEA 5E9KA 4A9NA 3IHPA 4S3OB 4HBYA 5D3HA 4O78A 4QR5A 5E74A 4QSTA 3ZPVE 3UVDA 3QZTA 2L85A 2L0BA 5CQ5A 4NQMA 3NXBA 3DQVR 2HYED 4IC2A 5CPEA 5D24A 2YQLA 4NUDA 5G05B 2NAAA 2QICA 4YYMA 5I40A 5CTLA 5B77A 5EWHA 4QEUA 5D3PA 3SVHA 4C9ZA 3QZSA 2F6JA 4GNDA 4BBQA 4QC1A 5H1VA 4TT4A 4IR5A 4HXSA 4O7BA 2Y43A 4A9KA 5HQ5A 4V3LC 2ECJA 4LYWA 5E7DA 2XEUA 4QEVA 4Y03A 4N4IA 5EVAA 3RTRB 4TQNA 2DVRA 5EWWA 5ETBA 5I88A 5CUAA 4ZQLA 5J0DA 5EWCA 3EB5A 5D3RA 4I7BA 4R8PK 3I3JA 3GV4A 2KYUA 2YDWA 5C13A 4UIWA 2CT2A 4GNFA 2JMJA 3UV5A 5LJ2A 5BT5A 5ENGA 2VP7A 5D7XA 4C67A 2YSMA 4CUQA 5CQTA 5F2PA 2IDAA 5CP5A 5JWMA 5EWVA 4C66A 3LXJA 3EB6A 5EV9A 5CUDA 5EA1A 1JOCA 2KFTA 2L80A 5DFBA 5C8GA 2G4AA 4KV4A 4YYGA 5CRMA 5LCWB 1WGMA 5D3NA 2M1RA 4J0SA 4PCEA 4IOOA 4TT2A 2G45A 4A49A 4PS5A 2NXBA 4NR8A 3SOXA 4QSRA 5D0CA 3PUQA 2KGGA 3O33A 4QSWA 5EK9A 4XUAA 5D3LA 4QSPA 4Z1SA 2YYRA 4MR5A 1WENA 2PNXA 4QR4A 5HQ7A 5LJ1A 5KO4A 4AKNA 2MUMA 4O64A 5FH8A 2VJEA 5JG6A 4J0RA 3UVWA 4O72A 4Z6HA 4XUBA 1WIMA 5DINA 4NRCA 3HMFA 4UIUA 2QJ0A 4QBMA 4YYJA 5E9VA 5EGUA 5FBXA 5FE4A 4ALHA 4L7XA 4TU6A 2D8SA 2YU4A 3N9NA 4J1PA 4LK9A 4IR3A 5FE2A 2BAYA 4F3IA 1MM2A 4MR6A 4NYXA 4ALGA 3LJWA 4NR4A 5CQAA 5A5OA 5H9MA 5CY9A 4KV1A 2YW8A 5FERA 5L8UA 2F42A 2KREA 3L1ZB 4NR5A 4PKLA 3ONIA 3AQAA 3L1XA 4AYCA 4OGIA 3U5NA 2YQDA 4Q6FA 4Q0NA 5D1LB 2MD7B 4A4BA 5FB1A 4OGJA 2E3KA 4LJNA 4TZ2A 2EODA 3HCSA 3N9MA 1E6IA 5K29A 5F1HA 2KIZA 5D26A 2LV9A 5J3XA 2VJEB 3SOUA 4NS5A 5IIDA 4LR6A 4AVXA 1JM7B 2LN0A 3G0LA 4NR6A 2AN6A 1N72A 3RPGC 5H85A 2YHOA 5KH9A 5L97A 4CCGX 4NYWA 5HJCA 4NRAA 2D9EA 4BJXA 5FE0A 4XYAA 4DONA 5AD2A 3U5JA 3MXFA 1N87A 5TDWA 5AMEA 5LKZA 1X4IA 4XY9A 1F62A 2R10A 3I2DA 4LADB 1WEOA 3FKMX 2MIQA 5DLZA 5ENIA 5IG6A 2YREA 4N3WA 1U6GB 5IGMA 4LDFA 1IYMA 3NG2A 4QEWA 3O34A 5B78A 3M62A 5I29A 3DPLR 3N9LA 3MUKA 4QR3A 4MR3A 4UYGA 4HXOA 4LZ2A 5LUUA 2FSAA 4CA1A 4QUUA 4MVTA 4CUUA 5DKAA 3T7LA 5B8DA 4BHWA 4YYHA 1HYJA 5DY7A 3C5KA 3N9QA 4QUTA 4CURA 4IORA 4MR4A 3IU5A 5DFCA 3Q2FA 1WE9A 2GRCA 2DATA 5E9YA 5B79A 2ZETC 2DKWA 2KGIA 5DX4A 4CUTA 4QNSA 4WIVA 4J3IA 4X2IA 5HFQA 2L5EA 5CQ3A 5DYUA 5L98A 3SVFA 2VPDA 2MD8C 4LYSA 5CQ7A 5DKHA 4CL9A 2VPGA 2JMIA 2C2VS 5DW1A 4MSXA 3KQIA 4NXJA 4PTBA 5EU1A 4NR9A 3GL6A 5FFVA 1DVPA 2KTBB 1WILA 2LDRA 4PPEA 5ENHA 1V87A 4QYLA 3MQMA 4PCIA 5D3JA 4YAXA 2I50A 5E73A 5EISA 4UIVA 3ASLA 4AUQB 5ETDA 4Z1QA 3LQHA 4KCXA 1WEMA 3MB4A 4QB3A 2YSJA 3PURA 5DYXA 2LXHC 2R0SA 5CGPA 4F52B 4O7AA 5L99A 2KWKA 4A9IA 5EPRA 5I3LA 3MB3A 4ZC9A 4E96A 4O75A 3PHDA 4TS8A 4BW1A 4I7CA 2N9GA 4TZ8A 4O76A 4UIZA 4O71A 2JRJA 5C11A 2E7OA 5ENCA 2MNYA 4P5OB 5FB0A 2C2LA 3KV6A 2L84A 2LGKA 2WP2A 5A82A 2RFJA 5F1LA 1LDKC 2OSSA 4QYDA 1JSPB 4XY8A 3ZTGA 2DVVA 1G25A 4B7YC 2YEKA 3HCTA 2R0YA 2RNYA 4QSVA 1FBVA 5HM0A 5I86A 3UW9A 2CKLA 5DFDA 5G4SA 4O7FA 4UP0A 4MENA 2LQ6A 2M3HA 5A5SA 2OXQC 2KR4A 2YYNA 5FE8A 4FO9A 2MJVB 5DW2A 5E3GA 5HRVA 4UIYA 5D1MB 5FFWA 5KH3A 4HXLA 2L43A 5TABA 4XI1A 5CRZA 1WEWA 4FLPA 3U5LA 4HXKA 5HRWA 4GNGA 1VD4A 3ZPV1 3O36A 3S91A 5IGLA 3JVJA 2KU3A 2ECIA 5AMFA 4N4GA 4WZ0A 5FE6A 3U5KA 4YH4A 5I80A 1LDJB 4LLBA 2VJFB 4LZRA 4MEOA 5C85A 2L5UA 3Q2EA 5EPSA 4FK5A 5C7NA 5LKTA 1T1HA 4HBWA 5KTUA 4GNEA 4WA6A 5L96A 5A5RA 5EICA 5EI4A 4HBXA 1X4UA 5DLXA 5ENEA 5G04B 4CLBA 2H0DA 5CQ4A 4TU4A 2LGVA 5KTWA 5IGKA 3P1FA 2RSDA 5HEMA 3L11A 5F62A 4A9JA 5G4RA 3IU6A 2VPBA 5CUBA 5I1QA 5CUCA 3UVYA 4ZUXU 4UI9B 1WEQA 4FIPA 5ACYA 4UITA 4UYHA 4YADA 2R0VA 2F6NA 5DYAA 5F63A 4HXPA 4L58A 5I83A 5FE3A 5EPBA 5EWDA 3SHBA 4TT6A 2JMDA 2KWOA 5C4QA 3P1EA 4LYIA 5F60A 5TRBA 5BT4A 5FE5A 2XB1A 5I7XA 3ZYUA 4CFLA 4I7DA 2YHNA 3T6RA 1BORA 2I7KA 5FE1A 2KWNA 2L75A 3RPGB 4A4CA 2K16A 5CS8A 2LGLA 4OUFA 3N9PA 4HXNA 2OO1A 5E9LA 4R2YA 5FEYA 5CU8A 4IR4A 2H0DB 3D7CA 2YUCA 4AYCB 4N4HA 4O77A 1JM4B 2MA6A 5DBMA 3ZNIA 2FUIA 4O7EA 4UP5A 4QSUA 3KNVA 4UYFB 2RS9B 2G43A 2YEMA 5LKUA 2VNFA 4NUCA 5HQ6A 5II2A 2KE1A 5LVRA 5FH7A 2K1JA 5HCLA 2VJFA 3U5MA 4QSXA 5DYCA 4YYDA 5B75A 4A9HA 4ZW1A 3MHSA 5EYAF 3C6WA 4WHUA 4GB0A 3SVGA 5HENA 1K2FA 3P1DA 4NUEA 5ENFA 4CFKA 5LVQA 4TTEA 5KU3A 4W4UA 4TYLA 5D1KB 2CSZA 3SOWA 5FDZA 3JVLA 5LKXA 4V3KC 1CHCA 1VFYA 4MEQA 2RNWA 1WEVA 4A9FA 1X0JA 3DAIA 2RI7A 2DVQA 2YQMA 3FL2A 3VK6A 5H1TA 5JI8A 1VYXA 1WEUA 5G0FA 2VPEA 2E7NA 5A5PA 5FE9A 1WEPA 4UYEA 5A83A 4A9MA 3LQJA 2YURA 2PUYA 2UZGA 2LXPC 4WZ2A 3QZVA 5B76A 5IBNA 5CFWA 5I7YA 1WFKA 5EM3A 2DVSA 1Z60A 5A81A 2YELA 3O7AA 3P1CA 2YW5A 4TKPB 5KHMA 4QY4A 4A9OA 2E6RA 2WP1A 5E9IA 3TLPA 4YABA 2MT5A 2Y1NA 5CZGA 5E3DA 5FH6A 1FP0A 4YY4A 5I89A 1Z6UA 4O7CA 5CUGA 4R7EA 5HLSA 2K17A 2QIZA 5DKCA 3V43A 2ECNA 3G0JA 3HTKC 2OUOA 4UIXA 3O37A 4QC3A 1ZS5A 1WEEA 3JVMA 4LRGA 3RCWA 2MA5A 3ZVZB 4UYDA 2I8NA 1Z2QA 4QF2A 2CKLB 1ZBDB 1E4UA 3UVXA 3O70A 4O70A 4WHWA 3U5OA 5A7CA 5ENJA 2LGGA 4A9LA 5ENBA 2H60A 3P5OA 4HXMA 5TB6A 4QSQA 1X4JA 2MNZA 3HCUA 5AIUA 2RO1A 3MHHA 5C89A 5L8TA 4LKAA 4GPJA 5F61A 3JVKA 2E6SA 4YBSA 5EQ1A 4NN2A 3HMEA 4IR6A 5D25A 2EA6A 2Y1MA 4QZSA 4YBTA 1MM3A 5CQ6A 1WUGA 4HXRA 2FUUA 4YYKA 2LRIC 4AP4A 2G6QA 3LQIA 4NR7A 3O35A 5COIA 4ZDTA 4QSSA 4X3GA 2K4DA 4QF3A 4B86C 4YYNA 4Q0OA 1HYIA 4BW2A 2M6MA 3M99A 2EGPA 5D3SA 5TBNA 4YK0A 5D3TA 4YBMA 5AITA 5F3AA 3AADA 5A5QA 5FG4A 5IGNA 3U5PA 2YT5A 1WUMA 4PY6A 5HELA 2D82A 4YH3A 2RNXA 2LSPB 4RVRA 4LC2A 5CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UV2 A;  1WES A;  2M85 A;  4HBV A;  4LZS A;  5HFR A;  1EQF A;  4NQN A;  5EP7 A;  3K2J A;  4CUP A;  3GG3 A;  2ECT A;  4CUS A;  5FG5 A;  5BT3 A;  4Z93 A;  5KTX A;  4IOQ A;  5F5Z A;  2ECW A;  2DWW A;  1XWH A;  5TCM A;  5LJ0 A;  3HMH A;  4S3O C;  4UYF A;  3DWY A;  4BW3 A;  4A0C D;  5FG6 A;  2ECG A;  5AD3 A;  4MEP A;  1JM7 A;  5H1U A;  3M63 A;  1F68 A;  4IC3 A;  4YYI A;  5HRX A;  3S92 A;  4N4F A;  5TDR A;  4FJC A;  4NYV A;  5A85 A;  4NRB A;  5FFY A;  4Z6I A;  4A9E A;  2ECV A;  2HDP A;  3LRQ A;  3ZYQ A;  5KH7 A;  5DKD A;  4YY6 A;  5FE7 A;  4YAT A;  5F25 A;  3UV4 A;  4O74 A;  2DX8 A;  4WZ3 B;  3ZVY A;  5C87 A;  4YC9 A;  5A5N A;  2KWJ A;  3N9O A;  2CSY A;  4BW4 A;  5II1 A;  3MUL A;  5E0R A;  5E9M A;  3KV5 A;  5F36 A;  1RMD A;  5CUE A;  5E9K A;  4A9N A;  3IHP A;  4S3O B;  4HBY A;  5D3H A;  4O78 A;  4QR5 A;  5E74 A;  4QST A;  3ZPV E;  3UVD A;  3QZT A;  2L85 A;  2L0B A;  5CQ5 A;  4NQM A;  3NXB A;  3DQV R;  2HYE D;  4IC2 A;  5CPE A;  5D24 A;  2YQL A;  4NUD A;  5G05 B;  2NAA A;  2QIC A;  4YYM A;  5I40 A;  5CTL A;  5B77 A;  5EWH A;  4QEU A;  5D3P A;  3SVH A;  4C9Z A;  3QZS A;  2F6J A;  4GND A;  4BBQ A;  4QC1 A;  5H1V A;  4TT4 A;  4IR5 A;  4HXS A;  4O7B A;  2Y43 A;  4A9K A;  5HQ5 A;  4V3L C;  2ECJ A;  4LYW A;  5E7D A;  2XEU A;  4QEV A;  4Y03 A;  4N4I A;  5EVA A;  3RTR B;  4TQN A;  2DVR A;  5EWW A;  5ETB A;  5I88 A;  5CUA A;  4ZQL A;  5J0D A;  5EWC A;  3EB5 A;  5D3R A;  4I7B A;  4R8P K;  3I3J A;  3GV4 A;  2KYU A;  2YDW A;  5C13 A;  4UIW A;  2CT2 A;  4GNF A;  2JMJ A;  3UV5 A;  5LJ2 A;  5BT5 A;  5ENG A;  2VP7 A;  5D7X A;  4C67 A;  2YSM A;  4CUQ A;  5CQT A;  5F2P A;  2IDA A;  5CP5 A;  5JWM A;  5EWV A;  4C66 A;  3LXJ A;  3EB6 A;  5EV9 A;  5CUD A;  5EA1 A;  1JOC A;  2KFT A;  2L80 A;  5DFB A;  5C8G A;  2G4A A;  4KV4 A;  4YYG A;  5CRM A;  5LCW B;  1WGM A;  5D3N A;  2M1R A;  4J0S A;  4PCE A;  4IOO A;  4TT2 A;  2G45 A;  4A49 A;  4PS5 A;  2NXB A;  4NR8 A;  3SOX A;  4QSR A;  5D0C A;  3PUQ A;  2KGG A;  3O33 A;  4QSW A;  5EK9 A;  4XUA A;  5D3L A;  4QSP A;  4Z1S A;  2YYR A;  4MR5 A;  1WEN A;  2PNX A;  4QR4 A;  5HQ7 A;  5LJ1 A;  5KO4 A;  4AKN A;  2MUM A;  4O64 A;  5FH8 A;  2VJE A;  5JG6 A;  4J0R A;  3UVW A;  4O72 A;  4Z6H A;  4XUB A;  1WIM A;  5DIN A;  4NRC A;  3HMF A;  4UIU A;  2QJ0 A;  4QBM A;  4YYJ A;  5E9V A;  5EGU A;  5FBX A;  5FE4 A;  4ALH A;  4L7X A;  4TU6 A;  2D8S A;  2YU4 A;  3N9N A;  4J1P A;  4LK9 A;  4IR3 A;  5FE2 A;  2BAY A;  4F3I A;  1MM2 A;  4MR6 A;  4NYX A;  4ALG A;  3LJW A;  4NR4 A;  5CQA A;  5A5O A;  5H9M A;  5CY9 A;  4KV1 A;  2YW8 A;  5FER A;  5L8U A;  2F42 A;  2KRE A;  3L1Z B;  4NR5 A;  4PKL A;  3ONI A;  3AQA A;  3L1X A;  4AYC A;  4OGI A;  3U5N A;  2YQD A;  4Q6F A;  4Q0N A;  5D1L B;  2MD7 B;  4A4B A;  5FB1 A;  4OGJ A;  2E3K A;  4LJN A;  4TZ2 A;  2EOD A;  3HCS A;  3N9M A;  1E6I A;  5K29 A;  5F1H A;  2KIZ A;  5D26 A;  2LV9 A;  5J3X A;  2VJE B;  3SOU A;  4NS5 A;  5IID A;  4LR6 A;  4AVX A;  1JM7 B;  2LN0 A;  3G0L A;  4NR6 A;  2AN6 A;  1N72 A;  3RPG C;  5H85 A;  2YHO A;  5KH9 A;  5L97 A;  4CCG X;  4NYW A;  5HJC A;  4NRA A;  2D9E A;  4BJX A;  5FE0 A;  4XYA A;  4DON A;  5AD2 A;  3U5J A;  3MXF A;  1N87 A;  5TDW A;  5AME A;  5LKZ A;  1X4I A;  4XY9 A;  1F62 A;  2R10 A;  3I2D A;  4LAD B;  1WEO A;  3FKM X;  2MIQ A;  5DLZ A;  5ENI A;  5IG6 A;  2YRE A;  4N3W A;  1U6G B;  5IGM A;  4LDF A;  1IYM A;  3NG2 A;  4QEW A;  3O34 A;  5B78 A;  3M62 A;  5I29 A;  3DPL R;  3N9L A;  3MUK A;  4QR3 A;  4MR3 A;  4UYG A;  4HXO A;  4LZ2 A;  5LUU A;  2FSA A;  4CA1 A;  4QUU A;  4MVT A;  4CUU A;  5DKA A;  3T7L A;  5B8D A;  4BHW A;  4YYH A;  1HYJ A;  5DY7 A;  3C5K A;  3N9Q A;  4QUT A;  4CUR A;  4IOR A;  4MR4 A;  3IU5 A;  5DFC A;  3Q2F A;  1WE9 A;  2GRC A;  2DAT A;  5E9Y A;  5B79 A;  2ZET C;  2DKW A;  2KGI A;  5DX4 A;  4CUT A;  4QNS A;  4WIV A;  4J3I A;  4X2I A;  5HFQ A;  2L5E A;  5CQ3 A;  5DYU A;  5L98 A;  3SVF A;  2VPD A;  2MD8 C;  4LYS A;  5CQ7 A;  5DKH A;  4CL9 A;  2VPG A;  2JMI A;  2C2V S;  5DW1 A;  4MSX A;  3KQI A;  4NXJ A;  4PTB A;  5EU1 A;  4NR9 A;  3GL6 A;  5FFV A;  1DVP A;  2KTB B;  1WIL A;  2LDR A;  4PPE A;  5ENH A;  1V87 A;  4QYL A;  3MQM A;  4PCI A;  5D3J A;  4YAX A;  2I50 A;  5E73 A;  5EIS A;  4UIV A;  3ASL A;  4AUQ B;  5ETD A;  4Z1Q A;  3LQH A;  4KCX A;  1WEM A;  3MB4 A;  4QB3 A;  2YSJ A;  3PUR A;  5DYX A;  2LXH C;  2R0S A;  5CGP A;  4F52 B;  4O7A A;  5L99 A;  2KWK A;  4A9I A;  5EPR A;  5I3L A;  3MB3 A;  4ZC9 A;  4E96 A;  4O75 A;  3PHD A;  4TS8 A;  4BW1 A;  4I7C A;  2N9G A;  4TZ8 A;  4O76 A;  4UIZ A;  4O71 A;  2JRJ A;  5C11 A;  2E7O A;  5ENC A;  2MNY A;  4P5O B;  5FB0 A;  2C2L A;  3KV6 A;  2L84 A;  2LGK A;  2WP2 A;  5A82 A;  2RFJ A;  5F1L A;  1LDK C;  2OSS A;  4QYD A;  1JSP B;  4XY8 A;  3ZTG A;  2DVV A;  1G25 A;  4B7Y C;  2YEK A;  3HCT A;  2R0Y A;  2RNY A;  4QSV A;  1FBV A;  5HM0 A;  5I86 A;  3UW9 A;  2CKL A;  5DFD A;  5G4S A;  4O7F A;  4UP0 A;  4MEN A;  2LQ6 A;  2M3H A;  5A5S A;  2OXQ C;  2KR4 A;  2YYN A;  5FE8 A;  4FO9 A;  2MJV B;  5DW2 A;  5E3G A;  5HRV A;  4UIY A;  5D1M B;  5FFW A;  5KH3 A;  4HXL A;  2L43 A;  5TAB A;  4XI1 A;  5CRZ A;  1WEW A;  4FLP A;  3U5L A;  4HXK A;  5HRW A;  4GNG A;  1VD4 A;  3ZPV 1;  3O36 A;  3S91 A;  5IGL A;  3JVJ A;  2KU3 A;  2ECI A;  5AMF A;  4N4G A;  4WZ0 A;  5FE6 A;  3U5K A;  4YH4 A;  5I80 A;  1LDJ B;  4LLB A;  2VJF B;  4LZR A;  4MEO A;  5C85 A;  2L5U A;  3Q2E A;  5EPS A;  4FK5 A;  5C7N A;  5LKT A;  1T1H A;  4HBW A;  5KTU A;  4GNE A;  4WA6 A;  5L96 A;  5A5R A;  5EIC A;  5EI4 A;  4HBX A;  1X4U A;  5DLX A;  5ENE A;  5G04 B;  4CLB A;  2H0D A;  5CQ4 A;  4TU4 A;  2LGV A;  5KTW A;  5IGK A;  3P1F A;  2RSD A;  5HEM A;  3L11 A;  5F62 A;  4A9J A;  5G4R A;  3IU6 A;  2VPB A;  5CUB A;  5I1Q A;  5CUC A;  3UVY A;  4ZUX U;  4UI9 B;  1WEQ A;  4FIP A;  5ACY A;  4UIT A;  4UYH A;  4YAD A;  2R0V A;  2F6N A;  5DYA A;  5F63 A;  4HXP A;  4L58 A;  5I83 A;  5FE3 A;  5EPB A;  5EWD A;  3SHB A;  4TT6 A;  2JMD A;  2KWO A;  5C4Q A;  3P1E A;  4LYI A;  5F60 A;  5TRB A;  5BT4 A;  5FE5 A;  2XB1 A;  5I7X A;  3ZYU A;  4CFL A;  4I7D A;  2YHN A;  3T6R A;  1BOR A;  2I7K A;  5FE1 A;  2KWN A;  2L75 A;  3RPG B;  4A4C A;  2K16 A;  5CS8 A;  2LGL A;  4OUF A;  3N9P A;  4HXN A;  2OO1 A;  5E9L A;  4R2Y A;  5FEY A;  5CU8 A;  4IR4 A;  2H0D B;  3D7C A;  2YUC A;  4AYC B;  4N4H A;  4O77 A;  1JM4 B;  2MA6 A;  5DBM A;  3ZNI A;  2FUI A;  4O7E A;  4UP5 A;  4QSU A;  3KNV A;  4UYF B;  2RS9 B;  2G43 A;  2YEM A;  5LKU A;  2VNF A;  4NUC A;  5HQ6 A;  5II2 A;  2KE1 A;  5LVR A;  5FH7 A;  2K1J A;  5HCL A;  2VJF A;  3U5M A;  4QSX A;  5DYC A;  4YYD A;  5B75 A;  4A9H A;  4ZW1 A;  3MHS A;  5EYA F;  3C6W A;  4WHU A;  4GB0 A;  3SVG A;  5HEN A;  1K2F A;  3P1D A;  4NUE A;  5ENF A;  4CFK A;  5LVQ A;  4TTE A;  5KU3 A;  4W4U A;  4TYL A;  5D1K B;  2CSZ A;  3SOW A;  5FDZ A;  3JVL A;  5LKX A;  4V3K C;  1CHC A;  1VFY A;  4MEQ A;  2RNW A;  1WEV A;  4A9F A;  1X0J A;  3DAI A;  2RI7 A;  2DVQ A;  2YQM A;  3FL2 A;  3VK6 A;  5H1T A;  5JI8 A;  1VYX A;  1WEU A;  5G0F A;  2VPE A;  2E7N A;  5A5P A;  5FE9 A;  1WEP A;  4UYE A;  5A83 A;  4A9M A;  3LQJ A;  2YUR A;  2PUY A;  2UZG A;  2LXP C;  4WZ2 A;  3QZV A;  5B76 A;  5IBN A;  5CFW A;  5I7Y A;  1WFK A;  5EM3 A;  2DVS A;  1Z60 A;  5A81 A;  2YEL A;  3O7A A;  3P1C A;  2YW5 A;  4TKP B;  5KHM A;  4QY4 A;  4A9O A;  2E6R A;  2WP1 A;  5E9I A;  3TLP A;  4YAB A;  2MT5 A;  2Y1N A;  5CZG A;  5E3D A;  5FH6 A;  1FP0 A;  4YY4 A;  5I89 A;  1Z6U A;  4O7C A;  5CUG A;  4R7E A;  5HLS A;  2K17 A;  2QIZ A;  5DKC A;  3V43 A;  2ECN A;  3G0J A;  3HTK C;  2OUO A;  4UIX A;  3O37 A;  4QC3 A;  1ZS5 A;  1WEE A;  3JVM A;  4LRG A;  3RCW A;  2MA5 A;  3ZVZ B;  4UYD A;  2I8N A;  1Z2Q A;  4QF2 A;  2CKL B;  1ZBD B;  1E4U A;  3UVX A;  3O70 A;  4O70 A;  4WHW A;  3U5O A;  5A7C A;  5ENJ A;  2LGG A;  4A9L A;  5ENB A;  2H60 A;  3P5O A;  4HXM A;  5TB6 A;  4QSQ A;  1X4J A;  2MNZ A;  3HCU A;  5AIU A;  2RO1 A;  3MHH A;  5C89 A;  5L8T A;  4LKA A;  4GPJ A;  5F61 A;  3JVK A;  2E6S A;  4YBS A;  5EQ1 A;  4NN2 A;  3HME A;  4IR6 A;  5D25 A;  2EA6 A;  2Y1M A;  4QZS A;  4YBT A;  1MM3 A;  5CQ6 A;  1WUG A;  4HXR A;  2FUU A;  4YYK A;  2LRI C;  4AP4 A;  2G6Q A;  3LQI A;  4NR7 A;  3O35 A;  5COI A;  4ZDT A;  4QSS A;  4X3G A;  2K4D A;  4QF3 A;  4B86 C;  4YYN A;  4Q0O A;  1HYI A;  4BW2 A;  2M6M A;  3M99 A;  2EGP A;  5D3S A;  5TBN A;  4YK0 A;  5D3T A;  4YBM A;  5AIT A;  5F3A A;  3AAD A;  5A5Q A;  5FG4 A;  5IGN A;  3U5P A;  2YT5 A;  1WUM A;  4PY6 A;  5HEL A;  2D82 A;  4YH3 A;  2RNX A;  2LSP B;  4RVR A;  4LC2 A;  5CQ8 A; 
#chains in the Genus database with same CATH topology
 3UV2 A;  1WES A;  2M85 A;  4HBV A;  4LZS A;  5HFR A;  2P57 A;  3SUB A;  1EQF A;  4NQN A;  5EP7 A;  3K2J A;  4CUP A;  3GG3 A;  2ECT A;  4CUS A;  5FG5 A;  5BT3 A;  4Z93 A;  5KTX A;  4IOQ A;  5F5Z A;  2ECW A;  2DWW A;  1XWH A;  5TCM A;  5LJ0 A;  3HMH A;  4S3O C;  4UYF A;  2XP0 A;  3DWY A;  4BW3 A;  4A0C D;  5FG6 A;  2ECG A;  5AD3 A;  4MEP A;  1JM7 A;  5H1U A;  3M63 A;  1F68 A;  4IC3 A;  4YYI A;  5HRX A;  2B0O E;  3S92 A;  4N4F A;  5TDR A;  4FJC A;  4NYV A;  5A85 A;  4NRB A;  5FFY A;  4Z6I A;  4A9E A;  2ECV A;  2HDP A;  3LRQ A;  3ZYQ A;  5KH7 A;  5DKD A;  4YY6 A;  5FE7 A;  4YAT A;  5F25 A;  3UV4 A;  4O74 A;  2DX8 A;  4WZ3 B;  3ZVY A;  5C87 A;  4YC9 A;  5A5N A;  2KWJ A;  3N9O A;  2CSY A;  2KKX A;  4BW4 A;  5II1 A;  3MUL A;  5E0R A;  5E9M A;  3KV5 A;  5F36 A;  1RMD A;  5CUE A;  5E9K A;  4A9N A;  3IHP A;  4S3O B;  4HBY A;  5D3H A;  4O78 A;  4QR5 A;  5E74 A;  4QST A;  3ZPV E;  3O47 A;  3UVD A;  3QZT A;  2L85 A;  2L0B A;  5CQ5 A;  4NQM A;  3NXB A;  3DQV R;  2HYE D;  4IC2 A;  5CPE A;  5D24 A;  2YQL A;  4NUD A;  5G05 B;  2NAA A;  2QIC A;  4YYM A;  5I40 A;  5CTL A;  1DCQ A;  5B77 A;  5EWH A;  4QEU A;  5D3P A;  3SVH A;  3FAN A;  4C9Z A;  3QZS A;  2F6J A;  4GND A;  4BBQ A;  4QC1 A;  5H1V A;  4TT4 A;  4IR5 A;  4HXS A;  4O7B A;  3VKH A;  2Y43 A;  4A9K A;  5HQ5 A;  4V3L C;  2ECJ A;  4LYW A;  5E7D A;  2XEU A;  1ZKR A;  4QEV A;  4Y03 A;  4N4I A;  5EVA A;  3RTR B;  5TBN A;  4TQN A;  2DVR A;  2EGM A;  5EWW A;  5K3Q A;  5ETB A;  5I88 A;  5CUA A;  4ZQL A;  5J0D A;  5EWC A;  3EB5 A;  3PLW A;  5D3R A;  4I7B A;  4R8P K;  3I3J A;  3GV4 A;  2KYU A;  2YDW A;  5C13 A;  4UIW A;  2CT2 A;  4GNF A;  2JMJ A;  3UV5 A;  5LJ2 A;  4AI6 A;  5BT5 A;  5ENG A;  2VP7 A;  5D7X A;  4C67 A;  2YSM A;  3FAO A;  4CUQ A;  5CQT A;  5F2P A;  2IDA A;  5CP5 A;  5JWM A;  5EWV A;  4C66 A;  3LXJ A;  3EB6 A;  5EV9 A;  5CUD A;  5EA1 A;  3VKG A;  1JOC A;  2KFT A;  2L80 A;  5DFB A;  5C8G A;  4O62 A;  2G4A A;  2EXU A;  4KV4 A;  4YYG A;  5CRM A;  5LCW B;  1WGM A;  5D3N A;  2M1R A;  4J0S A;  4PCE A;  4IOO A;  4TT2 A;  2G45 A;  4A49 A;  4PS5 A;  2NXB A;  4NR8 A;  5SVX A;  3SOX A;  4QSR A;  5D0C A;  3JUE A;  3PUQ A;  2KGG A;  3O33 A;  4QSW A;  5EK9 A;  4XUA A;  5D3L A;  4QSP A;  4Z1S A;  2YYR A;  4MR5 A;  1WEN A;  2PNX A;  4QR4 A;  5HQ7 A;  3DWD A;  5LJ1 A;  5KO4 A;  4AKN A;  2FFW A;  2MUM A;  4O64 A;  5FH8 A;  2VJE A;  5JG6 A;  4J0R A;  3UVW A;  4O72 A;  4Z6H A;  3H7H A;  4XUB A;  1WIM A;  5DIN A;  4NRC A;  3HMF A;  4UIU A;  2QJ0 A;  4QBM A;  4YYJ A;  5E9V A;  5EGU A;  5FBX A;  5FE4 A;  4ALH A;  4L7X A;  4TU6 A;  2D8S A;  2YU4 A;  3N9N A;  4J1P A;  4LK9 A;  4IR3 A;  5FE2 A;  2BAY A;  4F3I A;  1MM2 A;  4MR6 A;  4NYX A;  4ALG A;  3LJW A;  4NR4 A;  5CQA A;  5A5O A;  5H9M A;  2RR4 A;  5CY9 A;  4KV1 A;  2YW8 A;  5FER A;  5L8U A;  2F42 A;  2KRE A;  3L1Z B;  4NR5 A;  4PKL A;  3ONI A;  3AQA A;  3L1X A;  4AYC A;  4OGI A;  3U5N A;  2YQD A;  4Q6F A;  4Q0N A;  5D1L B;  2CON A;  2MD7 B;  4A4B A;  5FB1 A;  2D8U A;  4OGJ A;  2E3K A;  4LJN A;  4TZ2 A;  2EOD A;  3HCS A;  3N9M A;  1E6I A;  5K29 A;  5F1H A;  2KIZ A;  5D26 A;  2LV9 A;  2CRW A;  5J3X A;  2VJE B;  3SOU A;  4NS5 A;  5IID A;  4LR6 A;  4AVX A;  1JM7 B;  2LN0 A;  3G0L A;  4NR6 A;  3FJU B;  2AN6 A;  1N72 A;  3RPG C;  5H85 A;  2YHO A;  5KH9 A;  2XOZ A;  5L97 A;  2DJA A;  4CCG X;  4NYW A;  5HJC A;  4NRA A;  2D9E A;  4BJX A;  5FE0 A;  4XYA A;  4DON A;  5AD2 A;  3U5J A;  3MXF A;  1N87 A;  5TDW A;  5AME A;  5LKZ A;  1X4I A;  4XY9 A;  1F62 A;  2R10 A;  3I2D A;  4LAD B;  1WEO A;  3FKM X;  2MIQ A;  4AKI A;  5DLZ A;  5ENI A;  5IG6 A;  2YRE A;  4N3W A;  1U6G B;  5IGM A;  4LDF A;  1IYM A;  3NG2 A;  4QEW A;  3O34 A;  5B78 A;  3M62 A;  5I29 A;  3DPL R;  3N9L A;  3MUK A;  4QR3 A;  4MR3 A;  4UYG A;  2JUN A;  4HXO A;  4LZ2 A;  5LUU A;  2FSA A;  4CA1 A;  4QUU A;  4MVT A;  4CUU A;  5DKA A;  3T7L A;  5B8D A;  4BHW A;  4YYH A;  1HYJ A;  5DY7 A;  3C5K A;  3N9Q A;  4QUT A;  4CUR A;  4IOR A;  4MR4 A;  3IU5 A;  5DFC A;  3Q2F A;  1WE9 A;  2GRC A;  2CRR A;  2DAT A;  5E9Y A;  5B79 A;  2ZET C;  2DKW A;  2KGI A;  5DX4 A;  4CUT A;  4QNS A;  4WIV A;  4J3I A;  4X2I A;  5HFQ A;  2L5E A;  5CQ3 A;  5DYU A;  5L98 A;  3SVF A;  2VPD A;  2MD8 C;  4LYS A;  5CQ7 A;  5DKH A;  4CL9 A;  2VPG A;  2JMI A;  2C2V S;  5DW1 A;  4MSX A;  3KQI A;  4NXJ A;  4PTB A;  5EU1 A;  4NR9 A;  3GL6 A;  5FFV A;  1DVP A;  2KTB B;  1WIL A;  2LDR A;  4PPE A;  5ENH A;  1V87 A;  4QYL A;  3MQM A;  4PCI A;  5D3J A;  4YAX A;  2I50 A;  5E73 A;  5EIS A;  4UIV A;  3ASL A;  4H9D A;  4AUQ B;  5ETD A;  4Z1Q A;  3LQH A;  4KCX A;  5SVY A;  1WEM A;  3MB4 A;  4QB3 A;  2YSJ A;  3PUR A;  5DYX A;  2LXH C;  2R0S A;  5CGP A;  4F52 B;  4O7A A;  5L99 A;  2E61 A;  4A9I A;  2KWK A;  5EPR A;  5I3L A;  3MB3 A;  4ZC9 A;  4E96 A;  3D1D A;  4O75 A;  3PHD A;  4TS8 A;  4BW1 A;  4I7C A;  2N9G A;  3E2D A;  4TZ8 A;  4O76 A;  4AKH A;  4UIZ A;  4O71 A;  3FM8 C;  2JRJ A;  5C11 A;  2E7O A;  5ENC A;  2MNY A;  4P5O B;  5FB0 A;  2C2L A;  3KV6 A;  2L84 A;  2LGK A;  2WP2 A;  5A82 A;  2RFJ A;  5F1L A;  1LDK C;  3Q1D A;  2OSS A;  3LDY A;  4QYD A;  1JSP B;  4XY8 A;  3ZTG A;  3M7K A;  2DVV A;  3D1B A;  1G25 A;  4B7Y C;  2YEK A;  3HCT A;  2R0Y A;  2RNY A;  4QSV A;  1FBV A;  5HM0 A;  5I86 A;  3UW9 A;  2CKL A;  5DFD A;  5G4S A;  4O7F A;  4UP0 A;  4MEN A;  2LQ6 A;  2JM3 A;  2M3H A;  5A5S A;  2OXQ C;  2KR4 A;  2YYN A;  5FE8 A;  4FO9 A;  2MJV B;  5DW2 A;  5SVI A;  5E3G A;  5HRV A;  4UIY A;  5D1M B;  5FFW A;  5KH3 A;  4HXL A;  2L43 A;  5TAB A;  4XI1 A;  5CRZ A;  1WEW A;  4FLP A;  3U5L A;  4HXK A;  5HRW A;  4GNG A;  1VD4 A;  3ZPV 1;  3O36 A;  2CSV A;  3S91 A;  5IGL A;  3JVJ A;  2KU3 A;  2ECI A;  5AMF A;  4N4G A;  4WZ0 A;  5FE6 A;  3U5K A;  4YH4 A;  5I80 A;  1LDJ B;  3MDB C;  4LLB A;  2VJF B;  4LZR A;  4MEO A;  5C85 A;  2L5U A;  3Q2E A;  5EPS A;  4FK5 A;  5C7N A;  5LKT A;  1T1H A;  4HBW A;  5KTU A;  4GNE A;  4WA6 A;  5L96 A;  5A5R A;  4AKG A;  5EIC A;  5EI4 A;  4HBX A;  1X4U A;  5DLX A;  5ENE A;  5G04 B;  4CLB A;  2H0D A;  5CQ4 A;  4TU4 A;  2LGV A;  5KTW A;  5IGK A;  3P1F A;  2RSD A;  5HEM A;  3L11 A;  2KKY A;  5F62 A;  4A9J A;  5G4R A;  3IU6 A;  2VPB A;  5CUB A;  5I1Q A;  5CUC A;  3UVY A;  4ZUX U;  4UI9 B;  1WEQ A;  4FIP A;  5ACY A;  4UIT A;  4UYH A;  4YAD A;  2R0V A;  2F6N A;  5DYA A;  5F63 A;  4HXP A;  4L58 A;  5I83 A;  5FE3 A;  5EPB A;  5EWD A;  3SHB A;  4TT6 A;  2JMD A;  2KWO A;  5C4Q A;  3P1E A;  4LYI A;  5F60 A;  5TRB A;  5BT4 A;  5FE5 A;  2XB1 A;  5I7X A;  3ZYU A;  4CFL A;  1MBM A;  2L7P A;  2YHN A;  4I7D A;  5SVI B;  3T6R A;  1BOR A;  2I7K A;  5FE1 A;  2KWN A;  2L75 A;  3RPG B;  4A4C A;  2K16 A;  5CS8 A;  2LGL A;  4OUF A;  3N9P A;  4HXN A;  2OO1 A;  5E9L A;  4R2Y A;  5FEY A;  5CU8 A;  4IR4 A;  2H0D B;  3D7C A;  2YUC A;  4AYC B;  4N4H A;  4O77 A;  1JM4 B;  2MA6 A;  3KDE C;  5DBM A;  3ZNI A;  2FUI A;  4O7E A;  4UP5 A;  4QSU A;  3KNV A;  4UYF B;  2RS9 B;  2G43 A;  2YEM A;  5LKU A;  2VNF A;  4NUC A;  5HQ6 A;  5II2 A;  2KE1 A;  5LVR A;  5FH7 A;  2K1J A;  5HCL A;  2VJF A;  4Z0R A;  3U5M A;  4QSX A;  5DYC A;  4YYD A;  5B75 A;  4A9H A;  4ZW1 A;  3MHS A;  5EYA F;  3C6W A;  4WHU A;  4GB0 A;  3SVG A;  5HEN A;  1K2F A;  3P1D A;  4NUE A;  5ENF A;  4CFK A;  5LVQ A;  2IQJ A;  4TTE A;  5KU3 A;  4W4U A;  4TYL A;  5D1K B;  2CSZ A;  3SOW A;  5FDZ A;  3JVL A;  5LKX A;  4V3K C;  1CHC A;  1VFY A;  4MEQ A;  2RNW A;  1WEV A;  4A9F A;  1X0J A;  3DAI A;  2RI7 A;  2DVQ A;  2YQM A;  3FL2 A;  3VK6 A;  5H1T A;  5JI8 A;  1VYX A;  1WEU A;  5G0F A;  2VPE A;  2E7N A;  5A5P A;  5FE9 A;  1WEP A;  4F1P A;  4UYE A;  5A83 A;  3LJU X;  4A9M A;  3LQJ A;  2YUR A;  2PUY A;  2UZG A;  2LXP C;  4WZ2 A;  3QZV A;  5B76 A;  5IBN A;  5CFW A;  5I7Y A;  1WFK A;  5EM3 A;  2DVS A;  1Z60 A;  5A81 A;  2YEL A;  3O7A A;  3ERR A;  3P1C A;  2YW5 A;  4TKP B;  2M13 A;  2XOY A;  5KHM A;  4QY4 A;  4A9O A;  2E6R A;  3DDT A;  2WP1 A;  4OGE A;  5E9I A;  3TLP A;  4YAB A;  2MT5 A;  2Y1N A;  5CZG A;  5E3D A;  5FH6 A;  1FP0 A;  4YY4 A;  2XOC A;  5I89 A;  1Z6U A;  3FEH A;  4O7C A;  5CUG A;  4R7E A;  5HLS A;  2K17 A;  2QIZ A;  5DKC A;  3V43 A;  2ECN A;  3G0J A;  2MKE A;  2OUO A;  4UIX A;  3HTK C;  3O37 A;  4QC3 A;  1ZS5 A;  1WEE A;  3JVM A;  4LRG A;  3RCW A;  2MA5 A;  3LVR E;  4UYD A;  2LAU A;  2I8N A;  2DSM A;  1Z2Q A;  4QF2 A;  3ZVZ B;  2CKL B;  1ZBD B;  1E4U A;  3UVX A;  3O70 A;  4O70 A;  4WHW A;  3U5O A;  5A7C A;  5ENJ A;  2LGG A;  4A9L A;  5ENB A;  2H60 A;  3T9K A;  3P5O A;  4HXM A;  5TB6 A;  4QSQ A;  1X4J A;  2MNZ A;  3HCU A;  5AIU A;  2RO1 A;  3MHH A;  5C89 A;  5L8T A;  2OWA A;  4LKA A;  4GPJ A;  1PUO A;  2EJN A;  5F61 A;  3JVK A;  2E6S A;  4Z0O A;  4YBS A;  5EQ1 A;  4NN2 A;  3HME A;  4IR6 A;  5D25 A;  2EA6 A;  2YVR A;  2Y1M A;  4QZS A;  4YBT A;  1MM3 A;  5CQ6 A;  1WUG A;  4HXR A;  2FUU A;  4YYK A;  2LRI C;  4AP4 A;  3LVQ E;  2G6Q A;  3LQI A;  4NR7 A;  3O35 A;  5COI A;  4ZDT A;  4QSS A;  4X3G A;  2K4D A;  4QF3 A;  4B86 C;  4YYN A;  4Q0O A;  1HYI A;  4BW2 A;  2FD4 A;  2M6M A;  2EGP A;  5D3S A;  3M99 A;  4YK0 A;  5D3T A;  4YBM A;  4OGC A;  5F3A A;  3AAD A;  5AIT A;  4QQ4 A;  5A5Q A;  5FG4 A;  5IGN A;  3U5P A;  2YT5 A;  1WUM A;  4PY6 A;  5HEL A;  2D82 A;  4YH3 A;  2RNX A;  2LSP B;  4RVR A;  4LC2 A;  5CQ8 A; 
#chains in the Genus database with same CATH homology
 3UV2 A;  1WES A;  2M85 A;  4HBV A;  4LZS A;  5HFR A;  1EQF A;  4NQN A;  5EP7 A;  3K2J A;  4CUP A;  3GG3 A;  2ECT A;  4CUS A;  5FG5 A;  5BT3 A;  4Z93 A;  5KTX A;  4IOQ A;  5F5Z A;  2ECW A;  2DWW A;  1XWH A;  5TCM A;  5LJ0 A;  3HMH A;  4S3O C;  4UYF A;  3DWY A;  4BW3 A;  4A0C D;  5FG6 A;  2ECG A;  5AD3 A;  4MEP A;  1JM7 A;  5H1U A;  3M63 A;  1F68 A;  4IC3 A;  4YYI A;  5HRX A;  3S92 A;  4N4F A;  5TDR A;  4FJC A;  4NYV A;  5A85 A;  4NRB A;  5FFY A;  4Z6I A;  4A9E A;  2ECV A;  2HDP A;  3LRQ A;  3ZYQ A;  5KH7 A;  5DKD A;  4YY6 A;  5FE7 A;  4YAT A;  5F25 A;  3UV4 A;  4O74 A;  2DX8 A;  4WZ3 B;  3ZVY A;  5C87 A;  4YC9 A;  5A5N A;  2KWJ A;  3N9O A;  2CSY A;  4BW4 A;  5II1 A;  3MUL A;  5E0R A;  5E9M A;  3KV5 A;  5F36 A;  1RMD A;  5CUE A;  5E9K A;  4A9N A;  3IHP A;  4S3O B;  4HBY A;  5D3H A;  4O78 A;  4QR5 A;  5E74 A;  4QST A;  3ZPV E;  3UVD A;  3QZT A;  2L85 A;  2L0B A;  5CQ5 A;  4NQM A;  3NXB A;  3DQV R;  2HYE D;  4IC2 A;  5CPE A;  5D24 A;  2YQL A;  4NUD A;  5G05 B;  2NAA A;  2QIC A;  4YYM A;  5I40 A;  5CTL A;  5B77 A;  5EWH A;  4QEU A;  5D3P A;  3SVH A;  4C9Z A;  3QZS A;  2F6J A;  4GND A;  4BBQ A;  4QC1 A;  5H1V A;  4TT4 A;  4IR5 A;  4HXS A;  4O7B A;  2Y43 A;  4A9K A;  5HQ5 A;  4V3L C;  2ECJ A;  4LYW A;  5E7D A;  2XEU A;  4QEV A;  4Y03 A;  4N4I A;  5EVA A;  3RTR B;  4TQN A;  2DVR A;  5EWW A;  5ETB A;  5I88 A;  5CUA A;  4ZQL A;  5J0D A;  5EWC A;  3EB5 A;  5D3R A;  4I7B A;  4R8P K;  3I3J A;  3GV4 A;  2KYU A;  2YDW A;  5C13 A;  4UIW A;  2CT2 A;  4GNF A;  2JMJ A;  3UV5 A;  5LJ2 A;  5BT5 A;  5ENG A;  2VP7 A;  5D7X A;  4C67 A;  2YSM A;  4CUQ A;  5CQT A;  5F2P A;  2IDA A;  5CP5 A;  5JWM A;  5EWV A;  4C66 A;  3LXJ A;  3EB6 A;  5EV9 A;  5CUD A;  5EA1 A;  1JOC A;  2KFT A;  2L80 A;  5DFB A;  5C8G A;  2G4A A;  4KV4 A;  4YYG A;  5CRM A;  5LCW B;  1WGM A;  5D3N A;  2M1R A;  4J0S A;  4PCE A;  4IOO A;  4TT2 A;  2G45 A;  4A49 A;  4PS5 A;  2NXB A;  4NR8 A;  3SOX A;  4QSR A;  5D0C A;  3PUQ A;  2KGG A;  3O33 A;  4QSW A;  5EK9 A;  4XUA A;  5D3L A;  4QSP A;  4Z1S A;  2YYR A;  4MR5 A;  1WEN A;  2PNX A;  4QR4 A;  5HQ7 A;  5LJ1 A;  5KO4 A;  4AKN A;  2MUM A;  4O64 A;  5FH8 A;  2VJE A;  5JG6 A;  4J0R A;  3UVW A;  4O72 A;  4Z6H A;  4XUB A;  1WIM A;  5DIN A;  4NRC A;  3HMF A;  4UIU A;  2QJ0 A;  4QBM A;  4YYJ A;  5E9V A;  5EGU A;  5FBX A;  5FE4 A;  4ALH A;  4L7X A;  4TU6 A;  2D8S A;  2YU4 A;  3N9N A;  4J1P A;  4LK9 A;  4IR3 A;  5FE2 A;  2BAY A;  4F3I A;  1MM2 A;  4MR6 A;  4NYX A;  4ALG A;  3LJW A;  4NR4 A;  5CQA A;  5A5O A;  5H9M A;  5CY9 A;  4KV1 A;  2YW8 A;  5FER A;  5L8U A;  2F42 A;  2KRE A;  3L1Z B;  4NR5 A;  4PKL A;  3ONI A;  3AQA A;  3L1X A;  4AYC A;  4OGI A;  3U5N A;  2YQD A;  4Q6F A;  4Q0N A;  5D1L B;  2MD7 B;  4A4B A;  5FB1 A;  4OGJ A;  2E3K A;  4LJN A;  4TZ2 A;  2EOD A;  3HCS A;  3N9M A;  1E6I A;  5K29 A;  5F1H A;  2KIZ A;  5D26 A;  2LV9 A;  5J3X A;  2VJE B;  3SOU A;  4NS5 A;  5IID A;  4LR6 A;  4AVX A;  1JM7 B;  2LN0 A;  3G0L A;  4NR6 A;  2AN6 A;  1N72 A;  3RPG C;  5H85 A;  2YHO A;  5KH9 A;  5L97 A;  4CCG X;  4NYW A;  5HJC A;  4NRA A;  2D9E A;  4BJX A;  5FE0 A;  4XYA A;  4DON A;  5AD2 A;  3U5J A;  3MXF A;  1N87 A;  5TDW A;  5AME A;  5LKZ A;  1X4I A;  4XY9 A;  1F62 A;  2R10 A;  3I2D A;  4LAD B;  1WEO A;  3FKM X;  2MIQ A;  5DLZ A;  5ENI A;  5IG6 A;  2YRE A;  4N3W A;  1U6G B;  5IGM A;  4LDF A;  1IYM A;  3NG2 A;  4QEW A;  3O34 A;  5B78 A;  3M62 A;  5I29 A;  3DPL R;  3N9L A;  3MUK A;  4QR3 A;  4MR3 A;  4UYG A;  4HXO A;  4LZ2 A;  5LUU A;  2FSA A;  4CA1 A;  4QUU A;  4MVT A;  4CUU A;  5DKA A;  3T7L A;  5B8D A;  4BHW A;  4YYH A;  1HYJ A;  5DY7 A;  3C5K A;  3N9Q A;  4QUT A;  4CUR A;  4IOR A;  4MR4 A;  3IU5 A;  5DFC A;  3Q2F A;  1WE9 A;  2GRC A;  2DAT A;  5E9Y A;  5B79 A;  2ZET C;  2DKW A;  2KGI A;  5DX4 A;  4CUT A;  4QNS A;  4WIV A;  4J3I A;  4X2I A;  5HFQ A;  2L5E A;  5CQ3 A;  5DYU A;  5L98 A;  3SVF A;  2VPD A;  2MD8 C;  4LYS A;  5CQ7 A;  5DKH A;  4CL9 A;  2VPG A;  2JMI A;  2C2V S;  5DW1 A;  4MSX A;  3KQI A;  4NXJ A;  4PTB A;  5EU1 A;  4NR9 A;  3GL6 A;  5FFV A;  1DVP A;  2KTB B;  1WIL A;  2LDR A;  4PPE A;  5ENH A;  1V87 A;  4QYL A;  3MQM A;  4PCI A;  5D3J A;  4YAX A;  2I50 A;  5E73 A;  5EIS A;  4UIV A;  3ASL A;  4AUQ B;  5ETD A;  4Z1Q A;  3LQH A;  4KCX A;  1WEM A;  3MB4 A;  4QB3 A;  2YSJ A;  3PUR A;  5DYX A;  2LXH C;  2R0S A;  5CGP A;  4F52 B;  4O7A A;  5L99 A;  2KWK A;  4A9I A;  5EPR A;  5I3L A;  3MB3 A;  4ZC9 A;  4E96 A;  4O75 A;  3PHD A;  4TS8 A;  4BW1 A;  4I7C A;  2N9G A;  4TZ8 A;  4O76 A;  4UIZ A;  4O71 A;  2JRJ A;  5C11 A;  2E7O A;  5ENC A;  2MNY A;  4P5O B;  5FB0 A;  2C2L A;  3KV6 A;  2L84 A;  2LGK A;  2WP2 A;  5A82 A;  2RFJ A;  5F1L A;  1LDK C;  2OSS A;  4QYD A;  1JSP B;  4XY8 A;  3ZTG A;  2DVV A;  1G25 A;  4B7Y C;  2YEK A;  3HCT A;  2R0Y A;  2RNY A;  4QSV A;  1FBV A;  5HM0 A;  5I86 A;  3UW9 A;  2CKL A;  5DFD A;  5G4S A;  4O7F A;  4UP0 A;  4MEN A;  2LQ6 A;  2M3H A;  5A5S A;  2OXQ C;  2KR4 A;  2YYN A;  5FE8 A;  4FO9 A;  2MJV B;  5DW2 A;  5E3G A;  5HRV A;  4UIY A;  5D1M B;  5FFW A;  5KH3 A;  4HXL A;  2L43 A;  5TAB A;  4XI1 A;  5CRZ A;  1WEW A;  4FLP A;  3U5L A;  4HXK A;  5HRW A;  4GNG A;  1VD4 A;  3ZPV 1;  3O36 A;  3S91 A;  5IGL A;  3JVJ A;  2KU3 A;  2ECI A;  5AMF A;  4N4G A;  4WZ0 A;  5FE6 A;  3U5K A;  4YH4 A;  5I80 A;  1LDJ B;  4LLB A;  2VJF B;  4LZR A;  4MEO A;  5C85 A;  2L5U A;  3Q2E A;  5EPS A;  4FK5 A;  5C7N A;  5LKT A;  1T1H A;  4HBW A;  5KTU A;  4GNE A;  4WA6 A;  5L96 A;  5A5R A;  5EIC A;  5EI4 A;  4HBX A;  1X4U A;  5DLX A;  5ENE A;  5G04 B;  4CLB A;  2H0D A;  5CQ4 A;  4TU4 A;  2LGV A;  5KTW A;  5IGK A;  3P1F A;  2RSD A;  5HEM A;  3L11 A;  5F62 A;  4A9J A;  5G4R A;  3IU6 A;  2VPB A;  5CUB A;  5I1Q A;  5CUC A;  3UVY A;  4ZUX U;  4UI9 B;  1WEQ A;  4FIP A;  5ACY A;  4UIT A;  4UYH A;  4YAD A;  2R0V A;  2F6N A;  5DYA A;  5F63 A;  4HXP A;  4L58 A;  5I83 A;  5FE3 A;  5EPB A;  5EWD A;  3SHB A;  4TT6 A;  2JMD A;  2KWO A;  5C4Q A;  3P1E A;  4LYI A;  5F60 A;  5TRB A;  5BT4 A;  5FE5 A;  2XB1 A;  5I7X A;  3ZYU A;  4CFL A;  4I7D A;  2YHN A;  3T6R A;  1BOR A;  2I7K A;  5FE1 A;  2KWN A;  2L75 A;  3RPG B;  4A4C A;  2K16 A;  5CS8 A;  2LGL A;  4OUF A;  3N9P A;  4HXN A;  2OO1 A;  5E9L A;  4R2Y A;  5FEY A;  5CU8 A;  4IR4 A;  2H0D B;  3D7C A;  2YUC A;  4AYC B;  4N4H A;  4O77 A;  1JM4 B;  2MA6 A;  5DBM A;  3ZNI A;  2FUI A;  4O7E A;  4UP5 A;  4QSU A;  3KNV A;  4UYF B;  2RS9 B;  2G43 A;  2YEM A;  5LKU A;  2VNF A;  4NUC A;  5HQ6 A;  5II2 A;  2KE1 A;  5LVR A;  5FH7 A;  2K1J A;  5HCL A;  2VJF A;  3U5M A;  4QSX A;  5DYC A;  4YYD A;  5B75 A;  4A9H A;  4ZW1 A;  3MHS A;  5EYA F;  3C6W A;  4WHU A;  4GB0 A;  3SVG A;  5HEN A;  1K2F A;  3P1D A;  4NUE A;  5ENF A;  4CFK A;  5LVQ A;  4TTE A;  5KU3 A;  4W4U A;  4TYL A;  5D1K B;  2CSZ A;  3SOW A;  5FDZ A;  3JVL A;  5LKX A;  4V3K C;  1CHC A;  1VFY A;  4MEQ A;  2RNW A;  1WEV A;  4A9F A;  1X0J A;  3DAI A;  2RI7 A;  2DVQ A;  2YQM A;  3FL2 A;  3VK6 A;  5H1T A;  5JI8 A;  1VYX A;  1WEU A;  5G0F A;  2VPE A;  2E7N A;  5A5P A;  5FE9 A;  1WEP A;  4UYE A;  5A83 A;  4A9M A;  3LQJ A;  2YUR A;  2PUY A;  2UZG A;  2LXP C;  4WZ2 A;  3QZV A;  5B76 A;  5IBN A;  5CFW A;  5I7Y A;  1WFK A;  5EM3 A;  2DVS A;  1Z60 A;  5A81 A;  2YEL A;  3O7A A;  3P1C A;  2YW5 A;  4TKP B;  5KHM A;  4QY4 A;  4A9O A;  2E6R A;  2WP1 A;  5E9I A;  3TLP A;  4YAB A;  2MT5 A;  2Y1N A;  5CZG A;  5E3D A;  5FH6 A;  1FP0 A;  4YY4 A;  5I89 A;  1Z6U A;  4O7C A;  5CUG A;  4R7E A;  5HLS A;  2K17 A;  2QIZ A;  5DKC A;  3V43 A;  2ECN A;  3G0J A;  3HTK C;  2OUO A;  4UIX A;  3O37 A;  4QC3 A;  1ZS5 A;  1WEE A;  3JVM A;  4LRG A;  3RCW A;  2MA5 A;  3ZVZ B;  4UYD A;  2I8N A;  1Z2Q A;  4QF2 A;  2CKL B;  1ZBD B;  1E4U A;  3UVX A;  3O70 A;  4O70 A;  4WHW A;  3U5O A;  5A7C A;  5ENJ A;  2LGG A;  4A9L A;  5ENB A;  2H60 A;  3P5O A;  4HXM A;  5TB6 A;  4QSQ A;  1X4J A;  2MNZ A;  3HCU A;  5AIU A;  2RO1 A;  3MHH A;  5C89 A;  5L8T A;  4LKA A;  4GPJ A;  5F61 A;  3JVK A;  2E6S A;  4YBS A;  5EQ1 A;  4NN2 A;  3HME A;  4IR6 A;  5D25 A;  2EA6 A;  2Y1M A;  4QZS A;  4YBT A;  1MM3 A;  5CQ6 A;  1WUG A;  4HXR A;  2FUU A;  4YYK A;  2LRI C;  4AP4 A;  2G6Q A;  3LQI A;  4NR7 A;  3O35 A;  5COI A;  4ZDT A;  4QSS A;  4X3G A;  2K4D A;  4QF3 A;  4B86 C;  4YYN A;  4Q0O A;  1HYI A;  4BW2 A;  2M6M A;  3M99 A;  2EGP A;  5D3S A;  5TBN A;  4YK0 A;  5D3T A;  4YBM A;  5AIT A;  5F3A A;  3AAD A;  5A5Q A;  5FG4 A;  5IGN A;  3U5P A;  2YT5 A;  1WUM A;  4PY6 A;  5HEL A;  2D82 A;  4YH3 A;  2RNX A;  2LSP B;  4RVR A;  4LC2 A;  5CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...