4PTBA

Crystal structure of human sp100 phd-bromodomain in the free state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
NSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Nuclear autoantigen Sp-100
publication title Crystal structure of human SP100 PHD-Bromodomain in the free state
rcsb
source organism Homo sapiens
total genus 59
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ptbA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ptbA01
4LYSA 5LKXA 5C4QA 4R7EA 4YBTA 4YAXA 4LZRA 5CY9A 2LQ6A 4A9EA 4LK9A 5C13A 4NRBA 4LDFA 4ZW1A 2YYRA 3LQHA 4N3WA 5I86A 2DWWA 2K16A 4YY6A 2OXQC 3I2DA 5D3NA 5FE2A 4OGIA 2JMDA 5FFVA 4R8PK 5A5NA 5I7YA 4Z6HA 5C7NA 2VJFB 3L1XA 3N9NA 3O7AA 4HXRA 4I7BA 2I50A 4FJCA 5L98A 4E96A 4CURA 2R0SA 4YYMA 3G0JA 5DYXA 1XWHA 2MUMA 5CUCA 4QF3A 5ENJA 3SOUA 5FE6A 4Z93A 4UYFB 4NUEA 4NQMA 4NXJA 4Y03A 5TCMA 5B76A 2L5UA 5B75A 4QC1A 4LYWA 4YY4A 5HM0A 4UP5A 4L7XA 3MB3A 5CUGA 4Q0OA 2RFJA 4TU6A 4PTBA 5FFYA 3MHHA 4QEVA 2ECGA 2G45A 3KV5A 4GB0A 4LLBA 3SVHA 5D26A 5CUBA 4J3IA 4HXKA 5F36A 3D7CA 2OO1A 4QR5A 5D1LB 4TS8A 1WENA 4FLPA 2M6MA 5LCWB 3ASLA 4TYLA 2E6SA 4LZ2A 3M62A 4LJNA 4N4GA 3PUQA 5I83A 5J3XA 3MXFA 4MEOA 3SVFA 1LDKC 2MIQA 5J0DA 1V87A 4F52B 3ZTGA 3U5LA 2KU3A 4IR6A 2YDWA 1WEUA 2AN6A 4LZSA 4BW1A 5EM3A 5HEMA 4NUCA 4WA6A 4NUDA 5ENBA 3UVXA 4I7CA 2VP7A 5FERA 4O7FA 5TABA 3M63A 5DBMA 1X4JA 5K29A 1ZS5A 3ONIA 1Z60A 3KNVA 3UW9A 3RPGC 1F68A 2L43A 5DLXA 3O36A 5CQ8A 4ZQLA 5ENCA 2L84A 3Q2FA 5L97A 5LKUA 1JM4B 5HLSA 4ALGA 3P1FA 3N9LA 4N4HA 4UIUA 4O71A 2KE1A 5EK9A 1WUMA 4O78A 4QY4A 4UIXA 4CLBA 5IGNA 5FH8A 3NG2A 2LDRA 2XB1A 2CT2A 1MM2A 4HBXA 4CUTA 2ECJA 3AADA 5LJ0A 3L1ZB 2Y1MA 5B77A 2H0DB 4O77A 4AP4A 4N4FA 4YADA 3S92A 3HCUA 5DYAA 5II1A 5COIA 2YREA 5FE8A 5FE9A 4A9NA 1X4UA 5A5OA 2K4DA 2DVQA 4YH4A 5A5PA 2LXPC 3ZNIA 2DVRA 4CFLA 4BBQA 3SOWA 5DYUA 5KTXA 5HELA 3RCWA 4LRGA 1WILA 3UV5A 4ZDTA 2M1RA 1LDJB 3O70A 2BAYA 4IR4A 5G4SA 4CCGX 3P1DA 3JVKA 4TZ2A 3DQVR 5G4RA 2JMJA 4O7EA 1K2FA 5I1QA 4BW2A 5FB0A 2ECVA 4UYHA 2LXHC 5E7DA 5CQ5A 2CSZA 4GNFA 3KV6A 3O33A 4OGJA 1IYMA 4YATA 4A9LA 2KIZA 5C11A 4TT2A 4HXOA 3JVJA 2YURA 4O7CA 5E73A 3N9OA 1HYIA 2H60A 4CUSA 3UVDA 5CQ3A 5AD3A 5D0CA 2I8NA 4DONA 3U5KA 4P5OB 5EICA 5D1KB 4MVTA 4KV1A 3RPGB 4TKPB 4NRCA 5DKCA 5EYAF 5D1MB 4QSTA 5HENA 5KO4A 1WEEA 2C2LA 5FG4A 1U6GB 3LQJA 3P1EA 3MB4A 4QEUA 4AUQB 2DKWA 2KWOA 4XY8A 4BJXA 4HBVA 4KV4A 4RVRA 2DATA 2M3HA 3DAIA 5KH3A 2FUUA 4Z6IA 2YSMA 2R10A 4S3OC 4WZ3B 3S91A 5D24A 3VK6A 5EPSA 4XYAA 2UZGA 3UVYA 4AYCA 5DW1A 5A7CA 2YQMA 4HBWA 4J0SA 3O35A 5IG6A 2RNXA 4C67A 4A9JA 4A4BA 4CUUA 5EWHA 1FP0A 3AQAA 2E3KA 5EU1A 5IGMA 1EQFA 4TU4A 4YYHA 5I3LA 5F5ZA 2YT5A 4QF2A 2RI7A 5ETDA 2CSYA 5KU3A 2MD7B 2L5EA 5ETBA 4FK5A 5IIDA 2KWKA 4XUBA 3JVMA 5DLZA 1N87A 2G6QA 3ZVYA 5ENEA 4A49A 2LSPB 3PHDA 3N9MA 2DVSA 3ZYUA 2L0BA 4Z1QA 2G4AA 4WIVA 3FL2A 4NYWA 4NR9A 5D3HA 3U5OA 4A9FA 3HMFA 5KHMA 3U5NA 2G43A 2ZETC 1Z6UA 3Q2EA 2RNWA 5I89A 4UIVA 4NYXA 4AYCB 5D3JA 5CUEA 1WEQA 5E3GA 4QEWA 4UP0A 3T7LA 4C66A 3MUKA 5I80A 2YHOA 4YBSA 3QZVA 2ECTA 5I7XA 2H0DA 2Y1NA 4NR8A 4YYIA 5L8UA 5HRWA 3FKMX 2RNYA 4O74A 2ECWA 4QSSA 5EGUA 4QSRA 5D25A 4CUPA 2KREA 3LRQA 4V3KC 4A4CA 2OSSA 3P5OA 2KR4A 2VPEA 2VPDA 4IORA 5DFDA 5E9LA 5A5QA 2KTBB 5D3LA 5EWDA 5L99A 5JG6A 4IC2A 5CGPA 5JWMA 3U5MA 1WEVA 5CRZA 4UYDA 5CFWA 4S3OB 5DW2A 5CQ4A 4KCXA 4QSPA 2YSJA 5B79A 2MJVB 4BW4A 5F3AA 4F3IA 2L85A 2FUIA 2PUYA 5EP7A 2QJ0A 3GL6A 5DINA 1BORA 3O34A 4QYLA 5DFBA 5E9KA 4YC9A 2D82A 2HDPA 5JI8A 4TZ8A 1N72A 2L75A 1VFYA 5DYCA 3IU5A 4YYKA 5FH7A 3T6RA 5DX4A 5EV9A 2D8SA 2OUOA 5H1UA 1WFKA 5II2A 2EODA 5FG6A 2VPGA 5CUDA 4YH3A 2K1JA 4OUFA 5F1LA 1G25A 5D3SA 2MA6A 2KGGA 4PCEA 5B8DA 3O37A 5A81A 4LR6A 5E74A 5DKAA 4NN2A 5DFCA 2MT5A 1X4IA 3EB5A 4TT4A 1X0JA 5FFWA 5BT3A 3ZYQA 4AVXA 4O64A 4QUTA 5CP5A 4MSXA 5F62A 4I7DA 2ECNA 1JM7A 2LV9A 5F1HA 4UIWA 3V43A 2YEKA 5I40A 3MHSA 4IOOA 2NAAA 2YELA 4HXPA 5H1VA 5CQ6A 5D3PA 4R2YA 5EWCA 2LRIC 4HXLA 2E6RA 5CQAA 5LVQA 2Y43A 2WP2A 5CQTA 3GV4A 4PY6A 2MNZA 3ZPVE 4QSWA 5EA1A 4BHWA 2VPBA 3EB6A 3MQMA 5A82A 4AKNA 2LGKA 4QR3A 5HRXA 3LXJA 4QR4A 5EISA 5L8TA 1JSPB 2VJEA 2F6JA 4QZSA 2EA6A 5D3RA 4A9IA 5G0FA 4IC3A 4UIYA 4A9MA 4V3LC 5HCLA 5TDRA 2PNXA 4MR3A 2RSDA 5HQ6A 4WHUA 5FE3A 4QB3A 2QIZA 2KWNA 4MEQA 3C5KA 3I3JA 5AMFA 4J0RA 1VYXA 4QYDA 4TTEA 5HFQA 3UV2A 4GNGA 3ZVZB 4ZUXU 1JM7B 5E3DA 3G0LA 5G04B 2YQDA 5TRBA 4MEPA 3UV4A 2YW5A 5A5SA 5I88A 2N9GA 5FE4A 2ECIA 3QZSA 5C89A 1CHCA 5CUAA 5HQ7A 5FE0A 1DVPA 5FE5A 5AMEA 1WEMA 4BW3A 5EI4A 1Z2QA 3HCTA 4UYEA 2I7KA 5IBNA 4A9KA 4HXNA 4WZ0A 5AITA 2GRCA 4UITA 4WHWA 5KTWA 3TLPA 3SHBA 4YYNA 4YABA 2KYUA 1WESA 5D7XA 3HMHA 4NR4A 4QNSA 4O76A 2VJEB 4HXSA 5A85A 5H85A 4O72A 4PCIA 2YU4A 4FO9A 5L96A 4NS5A 2M85A 1T1HA 4NR6A 4X2IA 4NQNA 4QSVA 5FE1A 5EPRA 4UYGA 4LKAA 5G05B 4YK0A 2YUCA 4CFKA 3DWYA 2DVVA 3P1CA 4XUAA 5IGKA 2WP1A 1WEWA 4X3GA 5FH6A 5E0RA 5EVAA 2EGPA 5LJ1A 4L58A 4UI9B 5HQ5A 3PURA 4WZ2A 5LKTA 4A9HA 5AD2A 4TQNA 2E7NA 4PS5A 5ENHA 3N9PA 4O75A 1WE9A 5ACYA 3NXBA 4O70A 2MD8C 2FSAA 1E4UA 5F25A 2LN0A 3IU6A 4MR5A 5CTLA 4IOQA 1WIMA 4QSQA 3IHPA 5E9YA 5BT4A 1RMDA 5C8GA 5CPEA 1WGMA 2NXBA 5LKZA 1ZBDB 3N9QA 4UIZA 4GNEA 5C87A 3HTKC 1WEOA 5H1TA 4YYGA 4O7BA 5LUUA 1VD4A 2YQLA 2RS9B 4NR7A 5CQ7A 2KFTA 4QBMA 4XI1A 3ZPV1 2HYED 3JVLA 5H9MA 5FBXA 5E9IA 2XEUA 5E9VA 4PKLA 4NRAA 5LJ2A 2KWJA 5DKDA 5E9MA 2RO1A 4MR4A 4A9OA 4NYVA 4ALHA 1JOCA 4PPEA 2L80A 4O7AA 2LGLA 2R0YA 5CU8A 3HCSA 5DY7A 5BT5A 2C2VS 4Q6FA 3LJWA 4YYDA 2F6NA 5F61A 4W4UA 5TBNA 2YW8A 5AIUA 2K17A 3LQIA 4CL9A 5EWVA 4LC2A 3U5PA 3KQIA 5D3TA 4NR5A 5ENGA 5FE7A 2YYNA 5F63A 3UVWA 3U5JA 2IDAA 5CS8A 5F2PA 4QSUA 4QSXA 4LADB 2YHNA 2QICA 5KH7A 1HYJA 3QZTA 5F60A 4MENA 5IGLA 5TDWA 5EPBA 4J1PA 4Q0NA 4C9ZA 4MR6A 4N4IA 1F62A 4HBYA 5CZGA 4IR5A 2DX8A 3MULA 5FEYA 4QUUA 5KH9A 1FBVA 2LGGA 1WEPA 2CKLA 4ZC9A 5A83A 2MNYA 2F42A 4QC3A 1MM3A 4HXMA 5FDZA 2LGVA 2R0VA 4YYJA 3RTRB 4CA1A 3SVGA 4GPJA 4XY9A 5DKHA 4TT6A 5C85A 2D9EA 3M99A 2YEMA 5HFRA 4CUQA 3K2JA 2VNFA 1WUGA 3GG3A 3HMEA 4B86C 2JMIA 5EWWA 5LVRA 5CRMA 2VJFA 5I29A 4YBMA 2MA5A 5ENIA 4FIPA 5EQ1A 3C6WA 2KGIA 5FG5A 4A0CD 5ENFA 1E6IA 4UYFA 4B7YC 5TB6A 5HJCA 3L11A 5FB1A 5KTUA 3DPLR 4IR3A 2JRJA 4Z1SA 5B78A 2E7OA 5A5RA 4GNDA 5HRVA 4LYIA 3SOXA 2CKLB
chains in the Genus database with same CATH superfamily
4LYSA 5LKXA 5C4QA 3LJUX 4O62A 4R7EA 4YBTA 4YAXA 4LZRA 5CY9A 2LQ6A 4A9EA 4LK9A 5C13A 4NRBA 4LDFA 4ZW1A 2YYRA 3LQHA 4N3WA 5I86A 2DWWA 2K16A 4YY6A 2OXQC 3I2DA 5D3NA 5FE2A 4OGIA 2JMDA 5FFVA 4R8PK 5A5NA 5I7YA 4Z6HA 5C7NA 2VJFB 3L1XA 3N9NA 3O7AA 4HXRA 4I7BA 2I50A 4FJCA 5L98A 4E96A 4CURA 2R0SA 4YYMA 3G0JA 5DYXA 1XWHA 2MUMA 5CUCA 4QF3A 5ENJA 3SOUA 5FE6A 4Z93A 4UYFB 4NUEA 4NQMA 4NXJA 4Y03A 5TCMA 5B76A 2MKEA 2L5UA 5B75A 4QC1A 4LYWA 4YY4A 5HM0A 4UP5A 2CSVA 3MB3A 5CUGA 4Q0OA 2RFJA 4TU6A 4PTBA 5FFYA 3MHHA 4L7XA 4QEVA 2ECGA 2G45A 3KV5A 4GB0A 4LLBA 2EJNA 3SVHA 5D26A 5CUBA 2P57A 4J3IA 4HXKA 5F36A 3D7CA 2LAUA 2OO1A 4QR5A 5D1LB 4TS8A 1WENA 4FLPA 2M6MA 5LCWB 3ASLA 4TYLA 2E6SA 4LZ2A 3M62A 4LJNA 4N4GA 3PUQA 5I83A 5J3XA 3MXFA 4MEOA 3SVFA 1LDKC 2MIQA 5J0DA 3DWDA 1V87A 4F52B 3ZTGA 3U5LA 2KU3A 4IR6A 2YDWA 1WEUA 2AN6A 4LZSA 4BW1A 5EM3A 5HEMA 4NUCA 4WA6A 4NUDA 5ENBA 3UVXA 4I7CA 2VP7A 4OGEA 5FERA 4O7FA 5TABA 5SVIA 3M63A 5DBMA 1X4JA 5K29A 1ZS5A 3ONIA 4AKGA 1Z60A 2FFWA 3KNVA 3UW9A 3RPGC 1F68A 2L43A 5DLXA 3O36A 5CQ8A 4ZQLA 5ENCA 2L84A 3Q2FA 5L97A 5LKUA 1JM4B 5HLSA 4ALGA 3P1FA 2XP0A 4N4HA 3N9LA 4UIUA 3ERRA 4O71A 2CONA 2KE1A 5EK9A 1WUMA 4O78A 4QY4A 4UIXA 4CLBA 5IGNA 5FH8A 3FM8C 3NG2A 2LDRA 2XB1A 2CT2A 1MM2A 4HBXA 3E2DA 4CUTA 2ECJA 3AADA 5LJ0A 3L1ZB 2Y1MA 5B77A 2H0DB 4O77A 4AP4A 4N4FA 4YADA 3S92A 3HCUA 5DYAA 5II1A 5COIA 2YREA 5FE8A 4AKHA 5FE9A 4A9NA 1X4UA 5A5OA 2K4DA 2DVQA 4YH4A 5A5PA 2LXPC 4Z0RA 3ZNIA 2DVRA 4CFLA 4BBQA 3SOWA 3FEHA 5K3QA 5DYUA 5KTXA 5HELA 3RCWA 3VKHA 4LRGA 1WILA 3UV5A 4ZDTA 2M1RA 1LDJB 3O70A 2BAYA 4IR4A 5G4SA 4CCGX 3P1DA 3JVKA 4TZ2A 3DQVR 3FJUB 5G4RA 2JMJA 4O7EA 1K2FA 5I1QA 4BW2A 5FB0A 2ECVA 3VKGA 4UYHA 2LXHC 5E7DA 5CQ5A 2CSZA 4GNFA 3KV6A 3O33A 4OGJA 1IYMA 4YATA 4A9LA 2KIZA 5C11A 4TT2A 4HXOA 3JVJA 2YURA 4O7CA 5E73A 3N9OA 1HYIA 2H60A 4CUSA 3UVDA 5CQ3A 5AD3A 5D0CA 2I8NA 4DONA 3U5KA 4P5OB 5EICA 5D1KB 3M7KA 4MVTA 4KV1A 3RPGB 4TKPB 4NRCA 5DKCA 5EYAF 5D1MB 4QSTA 5HENA 5KO4A 1WEEA 2C2LA 5FG4A 1U6GB 3LQJA 2FD4A 3P1EA 3MB4A 4QEUA 4AUQB 3FANA 2DKWA 2KWOA 4XY8A 4BJXA 4HBVA 4KV4A 4RVRA 2DATA 2M3HA 3DAIA 5KH3A 2FUUA 4Z6IA 2YSMA 2R10A 4S3OC 4WZ3B 3S91A 5D24A 3VK6A 5EPSA 3MDBC 4XYAA 2UZGA 3UVYA 4AYCA 5DW1A 5A7CA 2YQMA 4HBWA 4J0SA 3O35A 5IG6A 2RNXA 4C67A 4A9JA 4Z0OA 4A4BA 4CUUA 1PUOA 5EWHA 1FP0A 3AQAA 2E3KA 5EU1A 5IGMA 1EQFA 4TU4A 4YYHA 5I3LA 2D8UA 5F5ZA 2YT5A 4QF2A 2RI7A 5ETDA 2CSYA 5KU3A 2MD7B 2L5EA 5ETBA 4FK5A 5IIDA 2KWKA 4XUBA 3JVMA 5DLZA 1N87A 2G6QA 3ZVYA 5ENEA 4A49A 2LSPB 3PHDA 3N9MA 2DVSA 3ZYUA 2L0BA 4Z1QA 2G4AA 4WIVA 3FL2A 4NYWA 4NR9A 3FAOA 5D3HA 3U5OA 1ZKRA 4A9FA 3HMFA 5KHMA 3U5NA 2G43A 2ZETC 3O47A 1Z6UA 3Q2EA 2RNWA 3LDYA 5I89A 4QQ4A 4UIVA 4NYXA 2KKXA 4AYCB 5D3JA 5CUEA 1WEQA 5E3GA 4QEWA 4UP0A 3T7LA 4C66A 3MUKA 5I80A 2YHOA 4YBSA 3QZVA 2ECTA 5I7XA 2H0DA 2Y1NA 4NR8A 4YYIA 5L8UA 5HRWA 3FKMX 2RNYA 4O74A 2ECWA 4QSSA 5EGUA 4QSRA 5D25A 4CUPA 2KREA 3LRQA 4V3KC 4A4CA 2OSSA 3D1BA 3P5OA 2KR4A 2VPEA 2VPDA 4IORA 5DFDA 5E9LA 5A5QA 2KTBB 5D3LA 5EWDA 5L99A 5JG6A 4IC2A 5CGPA 5JWMA 3U5MA 1WEVA 5SVYA 5CRZA 4UYDA 5CFWA 4S3OB 5DW2A 5CQ4A 4KCXA 4QSPA 2YSJA 5B79A 2MJVB 4BW4A 5F3AA 4F3IA 2L85A 2FUIA 2PUYA 5EP7A 2QJ0A 3GL6A 5DINA 1BORA 3O34A 4QYLA 5DFBA 5E9KA 4YC9A 2D82A 2HDPA 5JI8A 4TZ8A 1N72A 2L75A 1VFYA 5DYCA 3IU5A 4YYKA 5FH7A 3T6RA 5DX4A 5EV9A 2D8SA 2OUOA 5H1UA 1WFKA 5II2A 2EODA 5FG6A 4OGCA 2VPGA 5CUDA 4AKIA 4YH3A 2K1JA 4OUFA 5F1LA 1G25A 5D3SA 2MA6A 2KGGA 3T9KA 4PCEA 5B8DA 3O37A 5A81A 4LR6A 5E74A 5DKAA 4NN2A 5DFCA 2MT5A 1X4IA 3EB5A 4TT4A 1X0JA 5FFWA 4F1PA 5BT3A 3ZYQA 4AVXA 4O64A 4QUTA 5CP5A 4MSXA 5F62A 4I7DA 2ECNA 1DCQA 1JM7A 2LV9A 5F1HA 4UIWA 3V43A 2YEKA 5I40A 3MHSA 3Q1DA 4IOOA 2NAAA 2YELA 4HXPA 5H1VA 5CQ6A 5D3PA 4R2YA 5EWCA 2LRIC 4HXLA 2E6RA 5CQAA 5LVQA 2Y43A 2WP2A 5CQTA 3GV4A 4PY6A 2MNZA 1MBMA 3ZPVE 4QSWA 5EA1A 4BHWA 2VPBA 3EB6A 3MQMA 5A82A 4AKNA 2LGKA 4QR3A 5HRXA 3LXJA 4QR4A 5EISA 5L8TA 1JSPB 2VJEA 2F6JA 4QZSA 2EA6A 5D3RA 4A9IA 5G0FA 4IC3A 4UIYA 4A9MA 4V3LC 5HCLA 5TDRA 2PNXA 4MR3A 2RSDA 5HQ6A 4WHUA 3SUBA 5FE3A 4QB3A 2QIZA 2KWNA 4MEQA 2JM3A 3C5KA 3I3JA 5AMFA 4J0RA 1VYXA 4QYDA 4TTEA 5HFQA 3UV2A 4GNGA 3ZVZB 4ZUXU 1JM7B 5E3DA 3G0LA 5G04B 2YQDA 5TRBA 4MEPA 3UV4A 2YW5A 5A5SA 5I88A 2N9GA 5FE4A 2ECIA 3QZSA 5C89A 2KKYA 1CHCA 5CUAA 5HQ7A 5FE0A 1DVPA 5FE5A 5AMEA 1WEMA 4BW3A 5EI4A 1Z2QA 3HCTA 2DSMA 2B0OE 4UYEA 2I7KA 5IBNA 4A9KA 2CRWA 4HXNA 4WZ0A 5AITA 2GRCA 4UITA 4WHWA 5KTWA 3TLPA 3SHBA 4YYNA 4YABA 2KYUA 1WESA 5D7XA 3HMHA 4NR4A 4QNSA 4O76A 2VJEB 4HXSA 5A85A 5H85A 2OWAA 4O72A 4PCIA 2YU4A 4FO9A 5L96A 4NS5A 2M85A 1T1HA 4NR6A 4X2IA 4NQNA 3JUEA 2JUNA 4QSVA 5FE1A 5EPRA 4UYGA 4LKAA 5G05B 4YK0A 2YUCA 4CFKA 3DWYA 2DVVA 3P1CA 4XUAA 5IGKA 2WP1A 1WEWA 4X3GA 4AI6A 5FH6A 5E0RA 5EVAA 2EGPA 5LJ1A 4L58A 4UI9B 5HQ5A 3PURA 4WZ2A 5LKTA 4A9HA 2E61A 5AD2A 4TQNA 2E7NA 4PS5A 5ENHA 3N9PA 4O75A 1WE9A 5ACYA 3NXBA 2L7PA 4O70A 3LVQE 2FSAA 2MD8C 1E4UA 5F25A 2LN0A 3IU6A 3LVRE 4MR5A 5CTLA 4IOQA 1WIMA 4QSQA 3IHPA 5E9YA 5BT4A 1RMDA 5C8GA 5CPEA 1WGMA 2NXBA 5LKZA 1ZBDB 2XOZA 3N9QA 4UIZA 4GNEA 5C87A 3HTKC 1WEOA 5H1TA 4YYGA 4O7BA 5LUUA 1VD4A 2YQLA 2RS9B 4NR7A 5CQ7A 2EXUA 2KFTA 4QBMA 3H7HA 4XI1A 3ZPV1 2HYED 3JVLA 5H9MA 5FBXA 5E9IA 2XEUA 5E9VA 4PKLA 4NRAA 5LJ2A 2KWJA 5DKDA 5E9MA 2YVRA 2RO1A 4MR4A 4A9OA 4NYVA 4ALHA 1JOCA 4PPEA 2L80A 4O7AA 2LGLA 2R0YA 5CU8A 3HCSA 5DY7A 5BT5A 2C2VS 4Q6FA 2XOYA 3LJWA 4YYDA 2F6NA 3PLWA 5F61A 4W4UA 5TBNA 2YW8A 3DDTA 5AIUA 2K17A 3LQIA 4CL9A 5EWVA 4LC2A 3U5PA 3KQIA 3D1DA 5D3TA 4NR5A 5ENGA 2XOCA 2DJAA 5FE7A 2YYNA 5F63A 3UVWA 3U5JA 2IDAA 5CS8A 5F2PA 4QSUA 4QSXA 4LADB 2YHNA 2QICA 5KH7A 1HYJA 3QZTA 5F60A 5SVIB 4MENA 5IGLA 5TDWA 5EPBA 4J1PA 4Q0NA 4H9DA 4C9ZA 4MR6A 4N4IA 1F62A 4HBYA 5CZGA 4IR5A 2DX8A 3MULA 5FEYA 4QUUA 5KH9A 1FBVA 3KDEC 2LGGA 1WEPA 2CKLA 4ZC9A 5A83A 2MNYA 2F42A 4QC3A 1MM3A 4HXMA 5FDZA 2LGVA 2R0VA 4YYJA 5SVXA 3RTRB 4CA1A 3SVGA 4GPJA 4XY9A 5DKHA 2EGMA 2M13A 4TT6A 2RR4A 5C85A 2D9EA 3M99A 2YEMA 5HFRA 4CUQA 3K2JA 2VNFA 1WUGA 3GG3A 3HMEA 4B86C 2JMIA 5EWWA 5LVRA 5CRMA 2VJFA 2IQJA 5I29A 4YBMA 2MA5A 5ENIA 4FIPA 5EQ1A 3C6WA 2KGIA 2CRRA 5FG5A 4A0CD 5ENFA 1E6IA 4UYFA 4B7YC 5TB6A 5HJCA 3L11A 5FB1A 5KTUA 3DPLR 4IR3A 2JRJA 4Z1SA 5B78A 2E7OA 5A5RA 4GNDA 5HRVA 4LYIA 3SOXA 2CKLB
chains in the Genus database with same CATH topology
4LYSA 5LKXA 5C4QA 4R7EA 4YBTA 4YAXA 4LZRA 5CY9A 2LQ6A 4A9EA 4LK9A 5C13A 4NRBA 4LDFA 4ZW1A 2YYRA 3LQHA 4N3WA 5I86A 2DWWA 2K16A 4YY6A 2OXQC 3I2DA 5D3NA 5FE2A 4OGIA 2JMDA 5FFVA 4R8PK 5A5NA 5I7YA 4Z6HA 5C7NA 2VJFB 3L1XA 3N9NA 3O7AA 4HXRA 4I7BA 2I50A 4FJCA 5L98A 4E96A 4CURA 2R0SA 4YYMA 3G0JA 5DYXA 1XWHA 2MUMA 5CUCA 4QF3A 5ENJA 3SOUA 5FE6A 4Z93A 4UYFB 4NUEA 4NQMA 4NXJA 4Y03A 5TCMA 5B76A 2L5UA 5B75A 4QC1A 4LYWA 4YY4A 5HM0A 4UP5A 4L7XA 3MB3A 5CUGA 4Q0OA 2RFJA 4TU6A 4PTBA 5FFYA 3MHHA 4QEVA 2ECGA 2G45A 3KV5A 4GB0A 4LLBA 3SVHA 5D26A 5CUBA 4J3IA 4HXKA 5F36A 3D7CA 2OO1A 4QR5A 5D1LB 4TS8A 1WENA 4FLPA 2M6MA 5LCWB 3ASLA 4TYLA 2E6SA 4LZ2A 3M62A 4LJNA 4N4GA 3PUQA 5I83A 5J3XA 3MXFA 4MEOA 3SVFA 1LDKC 2MIQA 5J0DA 1V87A 4F52B 3ZTGA 3U5LA 2KU3A 4IR6A 2YDWA 1WEUA 2AN6A 4LZSA 4BW1A 5EM3A 5HEMA 4NUCA 4WA6A 4NUDA 5ENBA 3UVXA 4I7CA 2VP7A 5FERA 4O7FA 5TABA 3M63A 5DBMA 1X4JA 5K29A 1ZS5A 3ONIA 1Z60A 3KNVA 3UW9A 3RPGC 1F68A 2L43A 5DLXA 3O36A 5CQ8A 4ZQLA 5ENCA 2L84A 3Q2FA 5L97A 5LKUA 1JM4B 5HLSA 4ALGA 3P1FA 3N9LA 4N4HA 4UIUA 4O71A 2KE1A 5EK9A 1WUMA 4O78A 4QY4A 4UIXA 4CLBA 5IGNA 5FH8A 3NG2A 2LDRA 2XB1A 2CT2A 1MM2A 4HBXA 4CUTA 2ECJA 3AADA 5LJ0A 3L1ZB 2Y1MA 5B77A 2H0DB 4O77A 4AP4A 4N4FA 4YADA 3S92A 3HCUA 5DYAA 5II1A 5COIA 2YREA 5FE8A 5FE9A 4A9NA 1X4UA 5A5OA 2K4DA 2DVQA 4YH4A 5A5PA 2LXPC 3ZNIA 2DVRA 4CFLA 4BBQA 3SOWA 5DYUA 5KTXA 5HELA 3RCWA 4LRGA 1WILA 3UV5A 4ZDTA 2M1RA 1LDJB 3O70A 2BAYA 4IR4A 5G4SA 4CCGX 3P1DA 3JVKA 4TZ2A 3DQVR 5G4RA 2JMJA 4O7EA 1K2FA 5I1QA 4BW2A 5FB0A 2ECVA 4UYHA 2LXHC 5E7DA 5CQ5A 2CSZA 4GNFA 3KV6A 3O33A 4OGJA 1IYMA 4YATA 4A9LA 2KIZA 5C11A 4TT2A 4HXOA 3JVJA 2YURA 4O7CA 5E73A 3N9OA 1HYIA 2H60A 4CUSA 3UVDA 5CQ3A 5AD3A 5D0CA 2I8NA 4DONA 3U5KA 4P5OB 5EICA 5D1KB 4MVTA 4KV1A 3RPGB 4TKPB 4NRCA 5DKCA 5EYAF 5D1MB 4QSTA 5HENA 5KO4A 1WEEA 2C2LA 5FG4A 1U6GB 3LQJA 3P1EA 3MB4A 4QEUA 4AUQB 2DKWA 2KWOA 4XY8A 4BJXA 4HBVA 4KV4A 4RVRA 2DATA 2M3HA 3DAIA 5KH3A 2FUUA 4Z6IA 2YSMA 2R10A 4S3OC 4WZ3B 3S91A 5D24A 3VK6A 5EPSA 4XYAA 2UZGA 3UVYA 4AYCA 5DW1A 5A7CA 2YQMA 4HBWA 4J0SA 3O35A 5IG6A 2RNXA 4C67A 4A9JA 4A4BA 4CUUA 5EWHA 1FP0A 3AQAA 2E3KA 5EU1A 5IGMA 1EQFA 4TU4A 4YYHA 5I3LA 5F5ZA 2YT5A 4QF2A 2RI7A 5ETDA 2CSYA 5KU3A 2MD7B 2L5EA 5ETBA 4FK5A 5IIDA 2KWKA 4XUBA 3JVMA 5DLZA 1N87A 2G6QA 3ZVYA 5ENEA 4A49A 2LSPB 3PHDA 3N9MA 2DVSA 3ZYUA 2L0BA 4Z1QA 2G4AA 4WIVA 3FL2A 4NYWA 4NR9A 5D3HA 3U5OA 4A9FA 3HMFA 5KHMA 3U5NA 2G43A 2ZETC 1Z6UA 3Q2EA 2RNWA 5I89A 4UIVA 4NYXA 4AYCB 5D3JA 5CUEA 1WEQA 5E3GA 4QEWA 4UP0A 3T7LA 4C66A 3MUKA 5I80A 2YHOA 4YBSA 3QZVA 2ECTA 5I7XA 2H0DA 2Y1NA 4NR8A 4YYIA 5L8UA 5HRWA 3FKMX 2RNYA 4O74A 2ECWA 4QSSA 5EGUA 4QSRA 5D25A 4CUPA 2KREA 3LRQA 4V3KC 4A4CA 2OSSA 3P5OA 2KR4A 2VPEA 2VPDA 4IORA 5DFDA 5E9LA 5A5QA 2KTBB 5D3LA 5EWDA 5L99A 5JG6A 4IC2A 5CGPA 5JWMA 3U5MA 1WEVA 5CRZA 4UYDA 5CFWA 4S3OB 5DW2A 5CQ4A 4KCXA 4QSPA 2YSJA 5B79A 2MJVB 4BW4A 5F3AA 4F3IA 2L85A 2FUIA 2PUYA 5EP7A 2QJ0A 3GL6A 5DINA 1BORA 3O34A 4QYLA 5DFBA 5E9KA 4YC9A 2D82A 2HDPA 5JI8A 4TZ8A 1N72A 2L75A 1VFYA 5DYCA 3IU5A 4YYKA 5FH7A 3T6RA 5DX4A 5EV9A 2D8SA 2OUOA 5H1UA 1WFKA 5II2A 2EODA 5FG6A 2VPGA 5CUDA 4YH3A 2K1JA 4OUFA 5F1LA 1G25A 5D3SA 2MA6A 2KGGA 4PCEA 5B8DA 3O37A 5A81A 4LR6A 5E74A 5DKAA 4NN2A 5DFCA 2MT5A 1X4IA 3EB5A 4TT4A 1X0JA 5FFWA 5BT3A 3ZYQA 4AVXA 4O64A 4QUTA 5CP5A 4MSXA 5F62A 4I7DA 2ECNA 1JM7A 2LV9A 5F1HA 4UIWA 3V43A 2YEKA 5I40A 3MHSA 4IOOA 2NAAA 2YELA 4HXPA 5H1VA 5CQ6A 5D3PA 4R2YA 5EWCA 2LRIC 4HXLA 2E6RA 5CQAA 5LVQA 2Y43A 2WP2A 5CQTA 3GV4A 4PY6A 2MNZA 3ZPVE 4QSWA 5EA1A 4BHWA 2VPBA 3EB6A 3MQMA 5A82A 4AKNA 2LGKA 4QR3A 5HRXA 3LXJA 4QR4A 5EISA 5L8TA 1JSPB 2VJEA 2F6JA 4QZSA 2EA6A 5D3RA 4A9IA 5G0FA 4IC3A 4UIYA 4A9MA 4V3LC 5HCLA 5TDRA 2PNXA 4MR3A 2RSDA 5HQ6A 4WHUA 5FE3A 4QB3A 2QIZA 2KWNA 4MEQA 3C5KA 3I3JA 5AMFA 4J0RA 1VYXA 4QYDA 4TTEA 5HFQA 3UV2A 4GNGA 3ZVZB 4ZUXU 1JM7B 5E3DA 3G0LA 5G04B 2YQDA 5TRBA 4MEPA 3UV4A 2YW5A 5A5SA 5I88A 2N9GA 5FE4A 2ECIA 3QZSA 5C89A 1CHCA 5CUAA 5HQ7A 5FE0A 1DVPA 5FE5A 5AMEA 1WEMA 4BW3A 5EI4A 1Z2QA 3HCTA 4UYEA 2I7KA 5IBNA 4A9KA 4HXNA 4WZ0A 5AITA 2GRCA 4UITA 4WHWA 5KTWA 3TLPA 3SHBA 4YYNA 4YABA 2KYUA 1WESA 5D7XA 3HMHA 4NR4A 4QNSA 4O76A 2VJEB 4HXSA 5A85A 5H85A 4O72A 4PCIA 2YU4A 4FO9A 5L96A 4NS5A 2M85A 1T1HA 4NR6A 4X2IA 4NQNA 4QSVA 5FE1A 5EPRA 4UYGA 4LKAA 5G05B 4YK0A 2YUCA 4CFKA 3DWYA 2DVVA 3P1CA 4XUAA 5IGKA 2WP1A 1WEWA 4X3GA 5FH6A 5E0RA 5EVAA 2EGPA 5LJ1A 4L58A 4UI9B 5HQ5A 3PURA 4WZ2A 5LKTA 4A9HA 5AD2A 4TQNA 2E7NA 4PS5A 5ENHA 3N9PA 4O75A 1WE9A 5ACYA 3NXBA 4O70A 2MD8C 2FSAA 1E4UA 5F25A 2LN0A 3IU6A 4MR5A 5CTLA 4IOQA 1WIMA 4QSQA 3IHPA 5E9YA 5BT4A 1RMDA 5C8GA 5CPEA 1WGMA 2NXBA 5LKZA 1ZBDB 3N9QA 4UIZA 4GNEA 5C87A 3HTKC 1WEOA 5H1TA 4YYGA 4O7BA 5LUUA 1VD4A 2YQLA 2RS9B 4NR7A 5CQ7A 2KFTA 4QBMA 4XI1A 3ZPV1 2HYED 3JVLA 5H9MA 5FBXA 5E9IA 2XEUA 5E9VA 4PKLA 4NRAA 5LJ2A 2KWJA 5DKDA 5E9MA 2RO1A 4MR4A 4A9OA 4NYVA 4ALHA 1JOCA 4PPEA 2L80A 4O7AA 2LGLA 2R0YA 5CU8A 3HCSA 5DY7A 5BT5A 2C2VS 4Q6FA 3LJWA 4YYDA 2F6NA 5F61A 4W4UA 5TBNA 2YW8A 5AIUA 2K17A 3LQIA 4CL9A 5EWVA 4LC2A 3U5PA 3KQIA 5D3TA 4NR5A 5ENGA 5FE7A 2YYNA 5F63A 3UVWA 3U5JA 2IDAA 5CS8A 5F2PA 4QSUA 4QSXA 4LADB 2YHNA 2QICA 5KH7A 1HYJA 3QZTA 5F60A 4MENA 5IGLA 5TDWA 5EPBA 4J1PA 4Q0NA 4C9ZA 4MR6A 4N4IA 1F62A 4HBYA 5CZGA 4IR5A 2DX8A 3MULA 5FEYA 4QUUA 5KH9A 1FBVA 2LGGA 1WEPA 2CKLA 4ZC9A 5A83A 2MNYA 2F42A 4QC3A 1MM3A 4HXMA 5FDZA 2LGVA 2R0VA 4YYJA 3RTRB 4CA1A 3SVGA 4GPJA 4XY9A 5DKHA 4TT6A 5C85A 2D9EA 3M99A 2YEMA 5HFRA 4CUQA 3K2JA 2VNFA 1WUGA 3GG3A 3HMEA 4B86C 2JMIA 5EWWA 5LVRA 5CRMA 2VJFA 5I29A 4YBMA 2MA5A 5ENIA 4FIPA 5EQ1A 3C6WA 2KGIA 5FG5A 4A0CD 5ENFA 1E6IA 4UYFA 4B7YC 5TB6A 5HJCA 3L11A 5FB1A 5KTUA 3DPLR 4IR3A 2JRJA 4Z1SA 5B78A 2E7OA 5A5RA 4GNDA 5HRVA 4LYIA 3SOXA 2CKLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYS A;  5LKX A;  5C4Q A;  4R7E A;  4YBT A;  4YAX A;  4LZR A;  5CY9 A;  2LQ6 A;  4A9E A;  4LK9 A;  5C13 A;  4NRB A;  4LDF A;  4ZW1 A;  2YYR A;  3LQH A;  4N3W A;  5I86 A;  2DWW A;  2K16 A;  4YY6 A;  2OXQ C;  3I2D A;  5D3N A;  5FE2 A;  4OGI A;  2JMD A;  5FFV A;  4R8P K;  5A5N A;  5I7Y A;  4Z6H A;  5C7N A;  2VJF B;  3L1X A;  3N9N A;  3O7A A;  4HXR A;  4I7B A;  2I50 A;  4FJC A;  5L98 A;  4E96 A;  4CUR A;  2R0S A;  4YYM A;  3G0J A;  5DYX A;  1XWH A;  2MUM A;  5CUC A;  4QF3 A;  5ENJ A;  3SOU A;  5FE6 A;  4Z93 A;  4UYF B;  4NUE A;  4NQM A;  4NXJ A;  4Y03 A;  5TCM A;  5B76 A;  2L5U A;  5B75 A;  4QC1 A;  4LYW A;  4YY4 A;  5HM0 A;  4UP5 A;  4L7X A;  3MB3 A;  5CUG A;  4Q0O A;  2RFJ A;  4TU6 A;  4PTB A;  5FFY A;  3MHH A;  4QEV A;  2ECG A;  2G45 A;  3KV5 A;  4GB0 A;  4LLB A;  3SVH A;  5D26 A;  5CUB A;  4J3I A;  4HXK A;  5F36 A;  3D7C A;  2OO1 A;  4QR5 A;  5D1L B;  4TS8 A;  1WEN A;  4FLP A;  2M6M A;  5LCW B;  3ASL A;  4TYL A;  2E6S A;  4LZ2 A;  3M62 A;  4LJN A;  4N4G A;  3PUQ A;  5I83 A;  5J3X A;  3MXF A;  4MEO A;  3SVF A;  1LDK C;  2MIQ A;  5J0D A;  1V87 A;  4F52 B;  3ZTG A;  3U5L A;  2KU3 A;  4IR6 A;  2YDW A;  1WEU A;  2AN6 A;  4LZS A;  4BW1 A;  5EM3 A;  5HEM A;  4NUC A;  4WA6 A;  4NUD A;  5ENB A;  3UVX A;  4I7C A;  2VP7 A;  5FER A;  4O7F A;  5TAB A;  3M63 A;  5DBM A;  1X4J A;  5K29 A;  1ZS5 A;  3ONI A;  1Z60 A;  3KNV A;  3UW9 A;  3RPG C;  1F68 A;  2L43 A;  5DLX A;  3O36 A;  5CQ8 A;  4ZQL A;  5ENC A;  2L84 A;  3Q2F A;  5L97 A;  5LKU A;  1JM4 B;  5HLS A;  4ALG A;  3P1F A;  3N9L A;  4N4H A;  4UIU A;  4O71 A;  2KE1 A;  5EK9 A;  1WUM A;  4O78 A;  4QY4 A;  4UIX A;  4CLB A;  5IGN A;  5FH8 A;  3NG2 A;  2LDR A;  2XB1 A;  2CT2 A;  1MM2 A;  4HBX A;  4CUT A;  2ECJ A;  3AAD A;  5LJ0 A;  3L1Z B;  2Y1M A;  5B77 A;  2H0D B;  4O77 A;  4AP4 A;  4N4F A;  4YAD A;  3S92 A;  3HCU A;  5DYA A;  5II1 A;  5COI A;  2YRE A;  5FE8 A;  5FE9 A;  4A9N A;  1X4U A;  5A5O A;  2K4D A;  2DVQ A;  4YH4 A;  5A5P A;  2LXP C;  3ZNI A;  2DVR A;  4CFL A;  4BBQ A;  3SOW A;  5DYU A;  5KTX A;  5HEL A;  3RCW A;  4LRG A;  1WIL A;  3UV5 A;  4ZDT A;  2M1R A;  1LDJ B;  3O70 A;  2BAY A;  4IR4 A;  5G4S A;  4CCG X;  3P1D A;  3JVK A;  4TZ2 A;  3DQV R;  5G4R A;  2JMJ A;  4O7E A;  1K2F A;  5I1Q A;  4BW2 A;  5FB0 A;  2ECV A;  4UYH A;  2LXH C;  5E7D A;  5CQ5 A;  2CSZ A;  4GNF A;  3KV6 A;  3O33 A;  4OGJ A;  1IYM A;  4YAT A;  4A9L A;  2KIZ A;  5C11 A;  4TT2 A;  4HXO A;  3JVJ A;  2YUR A;  4O7C A;  5E73 A;  3N9O A;  1HYI A;  2H60 A;  4CUS A;  3UVD A;  5CQ3 A;  5AD3 A;  5D0C A;  2I8N A;  4DON A;  3U5K A;  4P5O B;  5EIC A;  5D1K B;  4MVT A;  4KV1 A;  3RPG B;  4TKP B;  4NRC A;  5DKC A;  5EYA F;  5D1M B;  4QST A;  5HEN A;  5KO4 A;  1WEE A;  2C2L A;  5FG4 A;  1U6G B;  3LQJ A;  3P1E A;  3MB4 A;  4QEU A;  4AUQ B;  2DKW A;  2KWO A;  4XY8 A;  4BJX A;  4HBV A;  4KV4 A;  4RVR A;  2DAT A;  2M3H A;  3DAI A;  5KH3 A;  2FUU A;  4Z6I A;  2YSM A;  2R10 A;  4S3O C;  4WZ3 B;  3S91 A;  5D24 A;  3VK6 A;  5EPS A;  4XYA A;  2UZG A;  3UVY A;  4AYC A;  5DW1 A;  5A7C A;  2YQM A;  4HBW A;  4J0S A;  3O35 A;  5IG6 A;  2RNX A;  4C67 A;  4A9J A;  4A4B A;  4CUU A;  5EWH A;  1FP0 A;  3AQA A;  2E3K A;  5EU1 A;  5IGM A;  1EQF A;  4TU4 A;  4YYH A;  5I3L A;  5F5Z A;  2YT5 A;  4QF2 A;  2RI7 A;  5ETD A;  2CSY A;  5KU3 A;  2MD7 B;  2L5E A;  5ETB A;  4FK5 A;  5IID A;  2KWK A;  4XUB A;  3JVM A;  5DLZ A;  1N87 A;  2G6Q A;  3ZVY A;  5ENE A;  4A49 A;  2LSP B;  3PHD A;  3N9M A;  2DVS A;  3ZYU A;  2L0B A;  4Z1Q A;  2G4A A;  4WIV A;  3FL2 A;  4NYW A;  4NR9 A;  5D3H A;  3U5O A;  4A9F A;  3HMF A;  5KHM A;  3U5N A;  2G43 A;  2ZET C;  1Z6U A;  3Q2E A;  2RNW A;  5I89 A;  4UIV A;  4NYX A;  4AYC B;  5D3J A;  5CUE A;  1WEQ A;  5E3G A;  4QEW A;  4UP0 A;  3T7L A;  4C66 A;  3MUK A;  5I80 A;  2YHO A;  4YBS A;  3QZV A;  2ECT A;  5I7X A;  2H0D A;  2Y1N A;  4NR8 A;  4YYI A;  5L8U A;  5HRW A;  3FKM X;  2RNY A;  4O74 A;  2ECW A;  4QSS A;  5EGU A;  4QSR A;  5D25 A;  4CUP A;  2KRE A;  3LRQ A;  4V3K C;  4A4C A;  2OSS A;  3P5O A;  2KR4 A;  2VPE A;  2VPD A;  4IOR A;  5DFD A;  5E9L A;  5A5Q A;  2KTB B;  5D3L A;  5EWD A;  5L99 A;  5JG6 A;  4IC2 A;  5CGP A;  5JWM A;  3U5M A;  1WEV A;  5CRZ A;  4UYD A;  5CFW A;  4S3O B;  5DW2 A;  5CQ4 A;  4KCX A;  4QSP A;  2YSJ A;  5B79 A;  2MJV B;  4BW4 A;  5F3A A;  4F3I A;  2L85 A;  2FUI A;  2PUY A;  5EP7 A;  2QJ0 A;  3GL6 A;  5DIN A;  1BOR A;  3O34 A;  4QYL A;  5DFB A;  5E9K A;  4YC9 A;  2D82 A;  2HDP A;  5JI8 A;  4TZ8 A;  1N72 A;  2L75 A;  1VFY A;  5DYC A;  3IU5 A;  4YYK A;  5FH7 A;  3T6R A;  5DX4 A;  5EV9 A;  2D8S A;  2OUO A;  5H1U A;  1WFK A;  5II2 A;  2EOD A;  5FG6 A;  2VPG A;  5CUD A;  4YH3 A;  2K1J A;  4OUF A;  5F1L A;  1G25 A;  5D3S A;  2MA6 A;  2KGG A;  4PCE A;  5B8D A;  3O37 A;  5A81 A;  4LR6 A;  5E74 A;  5DKA A;  4NN2 A;  5DFC A;  2MT5 A;  1X4I A;  3EB5 A;  4TT4 A;  1X0J A;  5FFW A;  5BT3 A;  3ZYQ A;  4AVX A;  4O64 A;  4QUT A;  5CP5 A;  4MSX A;  5F62 A;  4I7D A;  2ECN A;  1JM7 A;  2LV9 A;  5F1H A;  4UIW A;  3V43 A;  2YEK A;  5I40 A;  3MHS A;  4IOO A;  2NAA A;  2YEL A;  4HXP A;  5H1V A;  5CQ6 A;  5D3P A;  4R2Y A;  5EWC A;  2LRI C;  4HXL A;  2E6R A;  5CQA A;  5LVQ A;  2Y43 A;  2WP2 A;  5CQT A;  3GV4 A;  4PY6 A;  2MNZ A;  3ZPV E;  4QSW A;  5EA1 A;  4BHW A;  2VPB A;  3EB6 A;  3MQM A;  5A82 A;  4AKN A;  2LGK A;  4QR3 A;  5HRX A;  3LXJ A;  4QR4 A;  5EIS A;  5L8T A;  1JSP B;  2VJE A;  2F6J A;  4QZS A;  2EA6 A;  5D3R A;  4A9I A;  5G0F A;  4IC3 A;  4UIY A;  4A9M A;  4V3L C;  5HCL A;  5TDR A;  2PNX A;  4MR3 A;  2RSD A;  5HQ6 A;  4WHU A;  5FE3 A;  4QB3 A;  2QIZ A;  2KWN A;  4MEQ A;  3C5K A;  3I3J A;  5AMF A;  4J0R A;  1VYX A;  4QYD A;  4TTE A;  5HFQ A;  3UV2 A;  4GNG A;  3ZVZ B;  4ZUX U;  1JM7 B;  5E3D A;  3G0L A;  5G04 B;  2YQD A;  5TRB A;  4MEP A;  3UV4 A;  2YW5 A;  5A5S A;  5I88 A;  2N9G A;  5FE4 A;  2ECI A;  3QZS A;  5C89 A;  1CHC A;  5CUA A;  5HQ7 A;  5FE0 A;  1DVP A;  5FE5 A;  5AME A;  1WEM A;  4BW3 A;  5EI4 A;  1Z2Q A;  3HCT A;  4UYE A;  2I7K A;  5IBN A;  4A9K A;  4HXN A;  4WZ0 A;  5AIT A;  2GRC A;  4UIT A;  4WHW A;  5KTW A;  3TLP A;  3SHB A;  4YYN A;  4YAB A;  2KYU A;  1WES A;  5D7X A;  3HMH A;  4NR4 A;  4QNS A;  4O76 A;  2VJE B;  4HXS A;  5A85 A;  5H85 A;  4O72 A;  4PCI A;  2YU4 A;  4FO9 A;  5L96 A;  4NS5 A;  2M85 A;  1T1H A;  4NR6 A;  4X2I A;  4NQN A;  4QSV A;  5FE1 A;  5EPR A;  4UYG A;  4LKA A;  5G05 B;  4YK0 A;  2YUC A;  4CFK A;  3DWY A;  2DVV A;  3P1C A;  4XUA A;  5IGK A;  2WP1 A;  1WEW A;  4X3G A;  5FH6 A;  5E0R A;  5EVA A;  2EGP A;  5LJ1 A;  4L58 A;  4UI9 B;  5HQ5 A;  3PUR A;  4WZ2 A;  5LKT A;  4A9H A;  5AD2 A;  4TQN A;  2E7N A;  4PS5 A;  5ENH A;  3N9P A;  4O75 A;  1WE9 A;  5ACY A;  3NXB A;  4O70 A;  2MD8 C;  2FSA A;  1E4U A;  5F25 A;  2LN0 A;  3IU6 A;  4MR5 A;  5CTL A;  4IOQ A;  1WIM A;  4QSQ A;  3IHP A;  5E9Y A;  5BT4 A;  1RMD A;  5C8G A;  5CPE A;  1WGM A;  2NXB A;  5LKZ A;  1ZBD B;  3N9Q A;  4UIZ A;  4GNE A;  5C87 A;  3HTK C;  1WEO A;  5H1T A;  4YYG A;  4O7B A;  5LUU A;  1VD4 A;  2YQL A;  2RS9 B;  4NR7 A;  5CQ7 A;  2KFT A;  4QBM A;  4XI1 A;  3ZPV 1;  2HYE D;  3JVL A;  5H9M A;  5FBX A;  5E9I A;  2XEU A;  5E9V A;  4PKL A;  4NRA A;  5LJ2 A;  2KWJ A;  5DKD A;  5E9M A;  2RO1 A;  4MR4 A;  4A9O A;  4NYV A;  4ALH A;  1JOC A;  4PPE A;  2L80 A;  4O7A A;  2LGL A;  2R0Y A;  5CU8 A;  3HCS A;  5DY7 A;  5BT5 A;  2C2V S;  4Q6F A;  3LJW A;  4YYD A;  2F6N A;  5F61 A;  4W4U A;  5TBN A;  2YW8 A;  5AIU A;  2K17 A;  3LQI A;  4CL9 A;  5EWV A;  4LC2 A;  3U5P A;  3KQI A;  5D3T A;  4NR5 A;  5ENG A;  5FE7 A;  2YYN A;  5F63 A;  3UVW A;  3U5J A;  2IDA A;  5CS8 A;  5F2P A;  4QSU A;  4QSX A;  4LAD B;  2YHN A;  2QIC A;  5KH7 A;  1HYJ A;  3QZT A;  5F60 A;  4MEN A;  5IGL A;  5TDW A;  5EPB A;  4J1P A;  4Q0N A;  4C9Z A;  4MR6 A;  4N4I A;  1F62 A;  4HBY A;  5CZG A;  4IR5 A;  2DX8 A;  3MUL A;  5FEY A;  4QUU A;  5KH9 A;  1FBV A;  2LGG A;  1WEP A;  2CKL A;  4ZC9 A;  5A83 A;  2MNY A;  2F42 A;  4QC3 A;  1MM3 A;  4HXM A;  5FDZ A;  2LGV A;  2R0V A;  4YYJ A;  3RTR B;  4CA1 A;  3SVG A;  4GPJ A;  4XY9 A;  5DKH A;  4TT6 A;  5C85 A;  2D9E A;  3M99 A;  2YEM A;  5HFR A;  4CUQ A;  3K2J A;  2VNF A;  1WUG A;  3GG3 A;  3HME A;  4B86 C;  2JMI A;  5EWW A;  5LVR A;  5CRM A;  2VJF A;  5I29 A;  4YBM A;  2MA5 A;  5ENI A;  4FIP A;  5EQ1 A;  3C6W A;  2KGI A;  5FG5 A;  4A0C D;  5ENF A;  1E6I A;  4UYF A;  4B7Y C;  5TB6 A;  5HJC A;  3L11 A;  5FB1 A;  5KTU A;  3DPL R;  4IR3 A;  2JRJ A;  4Z1S A;  5B78 A;  2E7O A;  5A5R A;  4GND A;  5HRV A;  4LYI A;  3SOX A;  2CKL B; 
#chains in the Genus database with same CATH topology
 4LYS A;  5LKX A;  5C4Q A;  3LJU X;  4O62 A;  4R7E A;  4YBT A;  4YAX A;  4LZR A;  5CY9 A;  2LQ6 A;  4A9E A;  4LK9 A;  5C13 A;  4NRB A;  4LDF A;  4ZW1 A;  2YYR A;  3LQH A;  4N3W A;  5I86 A;  2DWW A;  2K16 A;  4YY6 A;  2OXQ C;  3I2D A;  5D3N A;  5FE2 A;  4OGI A;  2JMD A;  5FFV A;  4R8P K;  5A5N A;  5I7Y A;  4Z6H A;  5C7N A;  2VJF B;  3L1X A;  3N9N A;  3O7A A;  4HXR A;  4I7B A;  2I50 A;  4FJC A;  5L98 A;  4E96 A;  4CUR A;  2R0S A;  4YYM A;  3G0J A;  5DYX A;  1XWH A;  2MUM A;  5CUC A;  4QF3 A;  5ENJ A;  3SOU A;  5FE6 A;  4Z93 A;  4UYF B;  4NUE A;  4NQM A;  4NXJ A;  4Y03 A;  5TCM A;  5B76 A;  2MKE A;  2L5U A;  5B75 A;  4QC1 A;  4LYW A;  4YY4 A;  5HM0 A;  4UP5 A;  2CSV A;  3MB3 A;  5CUG A;  4Q0O A;  2RFJ A;  4TU6 A;  4PTB A;  5FFY A;  3MHH A;  4L7X A;  4QEV A;  2ECG A;  2G45 A;  3KV5 A;  4GB0 A;  4LLB A;  2EJN A;  3SVH A;  5D26 A;  5CUB A;  2P57 A;  4J3I A;  4HXK A;  5F36 A;  3D7C A;  2LAU A;  2OO1 A;  4QR5 A;  5D1L B;  4TS8 A;  1WEN A;  4FLP A;  2M6M A;  5LCW B;  3ASL A;  4TYL A;  2E6S A;  4LZ2 A;  3M62 A;  4LJN A;  4N4G A;  3PUQ A;  5I83 A;  5J3X A;  3MXF A;  4MEO A;  3SVF A;  1LDK C;  2MIQ A;  5J0D A;  3DWD A;  1V87 A;  4F52 B;  3ZTG A;  3U5L A;  2KU3 A;  4IR6 A;  2YDW A;  1WEU A;  2AN6 A;  4LZS A;  4BW1 A;  5EM3 A;  5HEM A;  4NUC A;  4WA6 A;  4NUD A;  5ENB A;  3UVX A;  4I7C A;  2VP7 A;  4OGE A;  5FER A;  4O7F A;  5TAB A;  5SVI A;  3M63 A;  5DBM A;  1X4J A;  5K29 A;  1ZS5 A;  3ONI A;  4AKG A;  1Z60 A;  2FFW A;  3KNV A;  3UW9 A;  3RPG C;  1F68 A;  2L43 A;  5DLX A;  3O36 A;  5CQ8 A;  4ZQL A;  5ENC A;  2L84 A;  3Q2F A;  5L97 A;  5LKU A;  1JM4 B;  5HLS A;  4ALG A;  3P1F A;  2XP0 A;  4N4H A;  3N9L A;  4UIU A;  3ERR A;  4O71 A;  2CON A;  2KE1 A;  5EK9 A;  1WUM A;  4O78 A;  4QY4 A;  4UIX A;  4CLB A;  5IGN A;  5FH8 A;  3FM8 C;  3NG2 A;  2LDR A;  2XB1 A;  2CT2 A;  1MM2 A;  4HBX A;  3E2D A;  4CUT A;  2ECJ A;  3AAD A;  5LJ0 A;  3L1Z B;  2Y1M A;  5B77 A;  2H0D B;  4O77 A;  4AP4 A;  4N4F A;  4YAD A;  3S92 A;  3HCU A;  5DYA A;  5II1 A;  5COI A;  2YRE A;  5FE8 A;  4AKH A;  5FE9 A;  4A9N A;  1X4U A;  5A5O A;  2K4D A;  2DVQ A;  4YH4 A;  5A5P A;  2LXP C;  4Z0R A;  3ZNI A;  2DVR A;  4CFL A;  4BBQ A;  3SOW A;  3FEH A;  5K3Q A;  5DYU A;  5KTX A;  5HEL A;  3RCW A;  3VKH A;  4LRG A;  1WIL A;  3UV5 A;  4ZDT A;  2M1R A;  1LDJ B;  3O70 A;  2BAY A;  4IR4 A;  5G4S A;  4CCG X;  3P1D A;  3JVK A;  4TZ2 A;  3DQV R;  3FJU B;  5G4R A;  2JMJ A;  4O7E A;  1K2F A;  5I1Q A;  4BW2 A;  5FB0 A;  2ECV A;  3VKG A;  4UYH A;  2LXH C;  5E7D A;  5CQ5 A;  2CSZ A;  4GNF A;  3KV6 A;  3O33 A;  4OGJ A;  1IYM A;  4YAT A;  4A9L A;  2KIZ A;  5C11 A;  4TT2 A;  4HXO A;  3JVJ A;  2YUR A;  4O7C A;  5E73 A;  3N9O A;  1HYI A;  2H60 A;  4CUS A;  3UVD A;  5CQ3 A;  5AD3 A;  5D0C A;  2I8N A;  4DON A;  3U5K A;  4P5O B;  5EIC A;  5D1K B;  3M7K A;  4MVT A;  4KV1 A;  3RPG B;  4TKP B;  4NRC A;  5DKC A;  5EYA F;  5D1M B;  4QST A;  5HEN A;  5KO4 A;  1WEE A;  2C2L A;  5FG4 A;  1U6G B;  3LQJ A;  2FD4 A;  3P1E A;  3MB4 A;  4QEU A;  4AUQ B;  3FAN A;  2DKW A;  2KWO A;  4XY8 A;  4BJX A;  4HBV A;  4KV4 A;  4RVR A;  2DAT A;  2M3H A;  3DAI A;  5KH3 A;  2FUU A;  4Z6I A;  2YSM A;  2R10 A;  4S3O C;  4WZ3 B;  3S91 A;  5D24 A;  3VK6 A;  5EPS A;  3MDB C;  4XYA A;  2UZG A;  3UVY A;  4AYC A;  5DW1 A;  5A7C A;  2YQM A;  4HBW A;  4J0S A;  3O35 A;  5IG6 A;  2RNX A;  4C67 A;  4A9J A;  4Z0O A;  4A4B A;  4CUU A;  1PUO A;  5EWH A;  1FP0 A;  3AQA A;  2E3K A;  5EU1 A;  5IGM A;  1EQF A;  4TU4 A;  4YYH A;  5I3L A;  2D8U A;  5F5Z A;  2YT5 A;  4QF2 A;  2RI7 A;  5ETD A;  2CSY A;  5KU3 A;  2MD7 B;  2L5E A;  5ETB A;  4FK5 A;  5IID A;  2KWK A;  4XUB A;  3JVM A;  5DLZ A;  1N87 A;  2G6Q A;  3ZVY A;  5ENE A;  4A49 A;  2LSP B;  3PHD A;  3N9M A;  2DVS A;  3ZYU A;  2L0B A;  4Z1Q A;  2G4A A;  4WIV A;  3FL2 A;  4NYW A;  4NR9 A;  3FAO A;  5D3H A;  3U5O A;  1ZKR A;  4A9F A;  3HMF A;  5KHM A;  3U5N A;  2G43 A;  2ZET C;  3O47 A;  1Z6U A;  3Q2E A;  2RNW A;  3LDY A;  5I89 A;  4QQ4 A;  4UIV A;  4NYX A;  2KKX A;  4AYC B;  5D3J A;  5CUE A;  1WEQ A;  5E3G A;  4QEW A;  4UP0 A;  3T7L A;  4C66 A;  3MUK A;  5I80 A;  2YHO A;  4YBS A;  3QZV A;  2ECT A;  5I7X A;  2H0D A;  2Y1N A;  4NR8 A;  4YYI A;  5L8U A;  5HRW A;  3FKM X;  2RNY A;  4O74 A;  2ECW A;  4QSS A;  5EGU A;  4QSR A;  5D25 A;  4CUP A;  2KRE A;  3LRQ A;  4V3K C;  4A4C A;  2OSS A;  3D1B A;  3P5O A;  2KR4 A;  2VPE A;  2VPD A;  4IOR A;  5DFD A;  5E9L A;  5A5Q A;  2KTB B;  5D3L A;  5EWD A;  5L99 A;  5JG6 A;  4IC2 A;  5CGP A;  5JWM A;  3U5M A;  1WEV A;  5SVY A;  5CRZ A;  4UYD A;  5CFW A;  4S3O B;  5DW2 A;  5CQ4 A;  4KCX A;  4QSP A;  2YSJ A;  5B79 A;  2MJV B;  4BW4 A;  5F3A A;  4F3I A;  2L85 A;  2FUI A;  2PUY A;  5EP7 A;  2QJ0 A;  3GL6 A;  5DIN A;  1BOR A;  3O34 A;  4QYL A;  5DFB A;  5E9K A;  4YC9 A;  2D82 A;  2HDP A;  5JI8 A;  4TZ8 A;  1N72 A;  2L75 A;  1VFY A;  5DYC A;  3IU5 A;  4YYK A;  5FH7 A;  3T6R A;  5DX4 A;  5EV9 A;  2D8S A;  2OUO A;  5H1U A;  1WFK A;  5II2 A;  2EOD A;  5FG6 A;  4OGC A;  2VPG A;  5CUD A;  4AKI A;  4YH3 A;  2K1J A;  4OUF A;  5F1L A;  1G25 A;  5D3S A;  2MA6 A;  2KGG A;  3T9K A;  4PCE A;  5B8D A;  3O37 A;  5A81 A;  4LR6 A;  5E74 A;  5DKA A;  4NN2 A;  5DFC A;  2MT5 A;  1X4I A;  3EB5 A;  4TT4 A;  1X0J A;  5FFW A;  4F1P A;  5BT3 A;  3ZYQ A;  4AVX A;  4O64 A;  4QUT A;  5CP5 A;  4MSX A;  5F62 A;  4I7D A;  2ECN A;  1DCQ A;  1JM7 A;  2LV9 A;  5F1H A;  4UIW A;  3V43 A;  2YEK A;  5I40 A;  3MHS A;  3Q1D A;  4IOO A;  2NAA A;  2YEL A;  4HXP A;  5H1V A;  5CQ6 A;  5D3P A;  4R2Y A;  5EWC A;  2LRI C;  4HXL A;  2E6R A;  5CQA A;  5LVQ A;  2Y43 A;  2WP2 A;  5CQT A;  3GV4 A;  4PY6 A;  2MNZ A;  1MBM A;  3ZPV E;  4QSW A;  5EA1 A;  4BHW A;  2VPB A;  3EB6 A;  3MQM A;  5A82 A;  4AKN A;  2LGK A;  4QR3 A;  5HRX A;  3LXJ A;  4QR4 A;  5EIS A;  5L8T A;  1JSP B;  2VJE A;  2F6J A;  4QZS A;  2EA6 A;  5D3R A;  4A9I A;  5G0F A;  4IC3 A;  4UIY A;  4A9M A;  4V3L C;  5HCL A;  5TDR A;  2PNX A;  4MR3 A;  2RSD A;  5HQ6 A;  4WHU A;  3SUB A;  5FE3 A;  4QB3 A;  2QIZ A;  2KWN A;  4MEQ A;  2JM3 A;  3C5K A;  3I3J A;  5AMF A;  4J0R A;  1VYX A;  4QYD A;  4TTE A;  5HFQ A;  3UV2 A;  4GNG A;  3ZVZ B;  4ZUX U;  1JM7 B;  5E3D A;  3G0L A;  5G04 B;  2YQD A;  5TRB A;  4MEP A;  3UV4 A;  2YW5 A;  5A5S A;  5I88 A;  2N9G A;  5FE4 A;  2ECI A;  3QZS A;  5C89 A;  2KKY A;  1CHC A;  5CUA A;  5HQ7 A;  5FE0 A;  1DVP A;  5FE5 A;  5AME A;  1WEM A;  4BW3 A;  5EI4 A;  1Z2Q A;  3HCT A;  2DSM A;  2B0O E;  4UYE A;  2I7K A;  5IBN A;  4A9K A;  2CRW A;  4HXN A;  4WZ0 A;  5AIT A;  2GRC A;  4UIT A;  4WHW A;  5KTW A;  3TLP A;  3SHB A;  4YYN A;  4YAB A;  2KYU A;  1WES A;  5D7X A;  3HMH A;  4NR4 A;  4QNS A;  4O76 A;  2VJE B;  4HXS A;  5A85 A;  5H85 A;  2OWA A;  4O72 A;  4PCI A;  2YU4 A;  4FO9 A;  5L96 A;  4NS5 A;  2M85 A;  1T1H A;  4NR6 A;  4X2I A;  4NQN A;  3JUE A;  2JUN A;  4QSV A;  5FE1 A;  5EPR A;  4UYG A;  4LKA A;  5G05 B;  4YK0 A;  2YUC A;  4CFK A;  3DWY A;  2DVV A;  3P1C A;  4XUA A;  5IGK A;  2WP1 A;  1WEW A;  4X3G A;  4AI6 A;  5FH6 A;  5E0R A;  5EVA A;  2EGP A;  5LJ1 A;  4L58 A;  4UI9 B;  5HQ5 A;  3PUR A;  4WZ2 A;  5LKT A;  4A9H A;  2E61 A;  5AD2 A;  4TQN A;  2E7N A;  4PS5 A;  5ENH A;  3N9P A;  4O75 A;  1WE9 A;  5ACY A;  3NXB A;  2L7P A;  4O70 A;  3LVQ E;  2FSA A;  2MD8 C;  1E4U A;  5F25 A;  2LN0 A;  3IU6 A;  3LVR E;  4MR5 A;  5CTL A;  4IOQ A;  1WIM A;  4QSQ A;  3IHP A;  5E9Y A;  5BT4 A;  1RMD A;  5C8G A;  5CPE A;  1WGM A;  2NXB A;  5LKZ A;  1ZBD B;  2XOZ A;  3N9Q A;  4UIZ A;  4GNE A;  5C87 A;  3HTK C;  1WEO A;  5H1T A;  4YYG A;  4O7B A;  5LUU A;  1VD4 A;  2YQL A;  2RS9 B;  4NR7 A;  5CQ7 A;  2EXU A;  2KFT A;  4QBM A;  3H7H A;  4XI1 A;  3ZPV 1;  2HYE D;  3JVL A;  5H9M A;  5FBX A;  5E9I A;  2XEU A;  5E9V A;  4PKL A;  4NRA A;  5LJ2 A;  2KWJ A;  5DKD A;  5E9M A;  2YVR A;  2RO1 A;  4MR4 A;  4A9O A;  4NYV A;  4ALH A;  1JOC A;  4PPE A;  2L80 A;  4O7A A;  2LGL A;  2R0Y A;  5CU8 A;  3HCS A;  5DY7 A;  5BT5 A;  2C2V S;  4Q6F A;  2XOY A;  3LJW A;  4YYD A;  2F6N A;  3PLW A;  5F61 A;  4W4U A;  5TBN A;  2YW8 A;  3DDT A;  5AIU A;  2K17 A;  3LQI A;  4CL9 A;  5EWV A;  4LC2 A;  3U5P A;  3KQI A;  3D1D A;  5D3T A;  4NR5 A;  5ENG A;  2XOC A;  2DJA A;  5FE7 A;  2YYN A;  5F63 A;  3UVW A;  3U5J A;  2IDA A;  5CS8 A;  5F2P A;  4QSU A;  4QSX A;  4LAD B;  2YHN A;  2QIC A;  5KH7 A;  1HYJ A;  3QZT A;  5F60 A;  5SVI B;  4MEN A;  5IGL A;  5TDW A;  5EPB A;  4J1P A;  4Q0N A;  4H9D A;  4C9Z A;  4MR6 A;  4N4I A;  1F62 A;  4HBY A;  5CZG A;  4IR5 A;  2DX8 A;  3MUL A;  5FEY A;  4QUU A;  5KH9 A;  1FBV A;  3KDE C;  2LGG A;  1WEP A;  2CKL A;  4ZC9 A;  5A83 A;  2MNY A;  2F42 A;  4QC3 A;  1MM3 A;  4HXM A;  5FDZ A;  2LGV A;  2R0V A;  4YYJ A;  5SVX A;  3RTR B;  4CA1 A;  3SVG A;  4GPJ A;  4XY9 A;  5DKH A;  2EGM A;  2M13 A;  4TT6 A;  2RR4 A;  5C85 A;  2D9E A;  3M99 A;  2YEM A;  5HFR A;  4CUQ A;  3K2J A;  2VNF A;  1WUG A;  3GG3 A;  3HME A;  4B86 C;  2JMI A;  5EWW A;  5LVR A;  5CRM A;  2VJF A;  2IQJ A;  5I29 A;  4YBM A;  2MA5 A;  5ENI A;  4FIP A;  5EQ1 A;  3C6W A;  2KGI A;  2CRR A;  5FG5 A;  4A0C D;  5ENF A;  1E6I A;  4UYF A;  4B7Y C;  5TB6 A;  5HJC A;  3L11 A;  5FB1 A;  5KTU A;  3DPL R;  4IR3 A;  2JRJ A;  4Z1S A;  5B78 A;  2E7O A;  5A5R A;  4GND A;  5HRV A;  4LYI A;  3SOX A;  2CKL B; 
#chains in the Genus database with same CATH homology
 4LYS A;  5LKX A;  5C4Q A;  4R7E A;  4YBT A;  4YAX A;  4LZR A;  5CY9 A;  2LQ6 A;  4A9E A;  4LK9 A;  5C13 A;  4NRB A;  4LDF A;  4ZW1 A;  2YYR A;  3LQH A;  4N3W A;  5I86 A;  2DWW A;  2K16 A;  4YY6 A;  2OXQ C;  3I2D A;  5D3N A;  5FE2 A;  4OGI A;  2JMD A;  5FFV A;  4R8P K;  5A5N A;  5I7Y A;  4Z6H A;  5C7N A;  2VJF B;  3L1X A;  3N9N A;  3O7A A;  4HXR A;  4I7B A;  2I50 A;  4FJC A;  5L98 A;  4E96 A;  4CUR A;  2R0S A;  4YYM A;  3G0J A;  5DYX A;  1XWH A;  2MUM A;  5CUC A;  4QF3 A;  5ENJ A;  3SOU A;  5FE6 A;  4Z93 A;  4UYF B;  4NUE A;  4NQM A;  4NXJ A;  4Y03 A;  5TCM A;  5B76 A;  2L5U A;  5B75 A;  4QC1 A;  4LYW A;  4YY4 A;  5HM0 A;  4UP5 A;  4L7X A;  3MB3 A;  5CUG A;  4Q0O A;  2RFJ A;  4TU6 A;  4PTB A;  5FFY A;  3MHH A;  4QEV A;  2ECG A;  2G45 A;  3KV5 A;  4GB0 A;  4LLB A;  3SVH A;  5D26 A;  5CUB A;  4J3I A;  4HXK A;  5F36 A;  3D7C A;  2OO1 A;  4QR5 A;  5D1L B;  4TS8 A;  1WEN A;  4FLP A;  2M6M A;  5LCW B;  3ASL A;  4TYL A;  2E6S A;  4LZ2 A;  3M62 A;  4LJN A;  4N4G A;  3PUQ A;  5I83 A;  5J3X A;  3MXF A;  4MEO A;  3SVF A;  1LDK C;  2MIQ A;  5J0D A;  1V87 A;  4F52 B;  3ZTG A;  3U5L A;  2KU3 A;  4IR6 A;  2YDW A;  1WEU A;  2AN6 A;  4LZS A;  4BW1 A;  5EM3 A;  5HEM A;  4NUC A;  4WA6 A;  4NUD A;  5ENB A;  3UVX A;  4I7C A;  2VP7 A;  5FER A;  4O7F A;  5TAB A;  3M63 A;  5DBM A;  1X4J A;  5K29 A;  1ZS5 A;  3ONI A;  1Z60 A;  3KNV A;  3UW9 A;  3RPG C;  1F68 A;  2L43 A;  5DLX A;  3O36 A;  5CQ8 A;  4ZQL A;  5ENC A;  2L84 A;  3Q2F A;  5L97 A;  5LKU A;  1JM4 B;  5HLS A;  4ALG A;  3P1F A;  3N9L A;  4N4H A;  4UIU A;  4O71 A;  2KE1 A;  5EK9 A;  1WUM A;  4O78 A;  4QY4 A;  4UIX A;  4CLB A;  5IGN A;  5FH8 A;  3NG2 A;  2LDR A;  2XB1 A;  2CT2 A;  1MM2 A;  4HBX A;  4CUT A;  2ECJ A;  3AAD A;  5LJ0 A;  3L1Z B;  2Y1M A;  5B77 A;  2H0D B;  4O77 A;  4AP4 A;  4N4F A;  4YAD A;  3S92 A;  3HCU A;  5DYA A;  5II1 A;  5COI A;  2YRE A;  5FE8 A;  5FE9 A;  4A9N A;  1X4U A;  5A5O A;  2K4D A;  2DVQ A;  4YH4 A;  5A5P A;  2LXP C;  3ZNI A;  2DVR A;  4CFL A;  4BBQ A;  3SOW A;  5DYU A;  5KTX A;  5HEL A;  3RCW A;  4LRG A;  1WIL A;  3UV5 A;  4ZDT A;  2M1R A;  1LDJ B;  3O70 A;  2BAY A;  4IR4 A;  5G4S A;  4CCG X;  3P1D A;  3JVK A;  4TZ2 A;  3DQV R;  5G4R A;  2JMJ A;  4O7E A;  1K2F A;  5I1Q A;  4BW2 A;  5FB0 A;  2ECV A;  4UYH A;  2LXH C;  5E7D A;  5CQ5 A;  2CSZ A;  4GNF A;  3KV6 A;  3O33 A;  4OGJ A;  1IYM A;  4YAT A;  4A9L A;  2KIZ A;  5C11 A;  4TT2 A;  4HXO A;  3JVJ A;  2YUR A;  4O7C A;  5E73 A;  3N9O A;  1HYI A;  2H60 A;  4CUS A;  3UVD A;  5CQ3 A;  5AD3 A;  5D0C A;  2I8N A;  4DON A;  3U5K A;  4P5O B;  5EIC A;  5D1K B;  4MVT A;  4KV1 A;  3RPG B;  4TKP B;  4NRC A;  5DKC A;  5EYA F;  5D1M B;  4QST A;  5HEN A;  5KO4 A;  1WEE A;  2C2L A;  5FG4 A;  1U6G B;  3LQJ A;  3P1E A;  3MB4 A;  4QEU A;  4AUQ B;  2DKW A;  2KWO A;  4XY8 A;  4BJX A;  4HBV A;  4KV4 A;  4RVR A;  2DAT A;  2M3H A;  3DAI A;  5KH3 A;  2FUU A;  4Z6I A;  2YSM A;  2R10 A;  4S3O C;  4WZ3 B;  3S91 A;  5D24 A;  3VK6 A;  5EPS A;  4XYA A;  2UZG A;  3UVY A;  4AYC A;  5DW1 A;  5A7C A;  2YQM A;  4HBW A;  4J0S A;  3O35 A;  5IG6 A;  2RNX A;  4C67 A;  4A9J A;  4A4B A;  4CUU A;  5EWH A;  1FP0 A;  3AQA A;  2E3K A;  5EU1 A;  5IGM A;  1EQF A;  4TU4 A;  4YYH A;  5I3L A;  5F5Z A;  2YT5 A;  4QF2 A;  2RI7 A;  5ETD A;  2CSY A;  5KU3 A;  2MD7 B;  2L5E A;  5ETB A;  4FK5 A;  5IID A;  2KWK A;  4XUB A;  3JVM A;  5DLZ A;  1N87 A;  2G6Q A;  3ZVY A;  5ENE A;  4A49 A;  2LSP B;  3PHD A;  3N9M A;  2DVS A;  3ZYU A;  2L0B A;  4Z1Q A;  2G4A A;  4WIV A;  3FL2 A;  4NYW A;  4NR9 A;  5D3H A;  3U5O A;  4A9F A;  3HMF A;  5KHM A;  3U5N A;  2G43 A;  2ZET C;  1Z6U A;  3Q2E A;  2RNW A;  5I89 A;  4UIV A;  4NYX A;  4AYC B;  5D3J A;  5CUE A;  1WEQ A;  5E3G A;  4QEW A;  4UP0 A;  3T7L A;  4C66 A;  3MUK A;  5I80 A;  2YHO A;  4YBS A;  3QZV A;  2ECT A;  5I7X A;  2H0D A;  2Y1N A;  4NR8 A;  4YYI A;  5L8U A;  5HRW A;  3FKM X;  2RNY A;  4O74 A;  2ECW A;  4QSS A;  5EGU A;  4QSR A;  5D25 A;  4CUP A;  2KRE A;  3LRQ A;  4V3K C;  4A4C A;  2OSS A;  3P5O A;  2KR4 A;  2VPE A;  2VPD A;  4IOR A;  5DFD A;  5E9L A;  5A5Q A;  2KTB B;  5D3L A;  5EWD A;  5L99 A;  5JG6 A;  4IC2 A;  5CGP A;  5JWM A;  3U5M A;  1WEV A;  5CRZ A;  4UYD A;  5CFW A;  4S3O B;  5DW2 A;  5CQ4 A;  4KCX A;  4QSP A;  2YSJ A;  5B79 A;  2MJV B;  4BW4 A;  5F3A A;  4F3I A;  2L85 A;  2FUI A;  2PUY A;  5EP7 A;  2QJ0 A;  3GL6 A;  5DIN A;  1BOR A;  3O34 A;  4QYL A;  5DFB A;  5E9K A;  4YC9 A;  2D82 A;  2HDP A;  5JI8 A;  4TZ8 A;  1N72 A;  2L75 A;  1VFY A;  5DYC A;  3IU5 A;  4YYK A;  5FH7 A;  3T6R A;  5DX4 A;  5EV9 A;  2D8S A;  2OUO A;  5H1U A;  1WFK A;  5II2 A;  2EOD A;  5FG6 A;  2VPG A;  5CUD A;  4YH3 A;  2K1J A;  4OUF A;  5F1L A;  1G25 A;  5D3S A;  2MA6 A;  2KGG A;  4PCE A;  5B8D A;  3O37 A;  5A81 A;  4LR6 A;  5E74 A;  5DKA A;  4NN2 A;  5DFC A;  2MT5 A;  1X4I A;  3EB5 A;  4TT4 A;  1X0J A;  5FFW A;  5BT3 A;  3ZYQ A;  4AVX A;  4O64 A;  4QUT A;  5CP5 A;  4MSX A;  5F62 A;  4I7D A;  2ECN A;  1JM7 A;  2LV9 A;  5F1H A;  4UIW A;  3V43 A;  2YEK A;  5I40 A;  3MHS A;  4IOO A;  2NAA A;  2YEL A;  4HXP A;  5H1V A;  5CQ6 A;  5D3P A;  4R2Y A;  5EWC A;  2LRI C;  4HXL A;  2E6R A;  5CQA A;  5LVQ A;  2Y43 A;  2WP2 A;  5CQT A;  3GV4 A;  4PY6 A;  2MNZ A;  3ZPV E;  4QSW A;  5EA1 A;  4BHW A;  2VPB A;  3EB6 A;  3MQM A;  5A82 A;  4AKN A;  2LGK A;  4QR3 A;  5HRX A;  3LXJ A;  4QR4 A;  5EIS A;  5L8T A;  1JSP B;  2VJE A;  2F6J A;  4QZS A;  2EA6 A;  5D3R A;  4A9I A;  5G0F A;  4IC3 A;  4UIY A;  4A9M A;  4V3L C;  5HCL A;  5TDR A;  2PNX A;  4MR3 A;  2RSD A;  5HQ6 A;  4WHU A;  5FE3 A;  4QB3 A;  2QIZ A;  2KWN A;  4MEQ A;  3C5K A;  3I3J A;  5AMF A;  4J0R A;  1VYX A;  4QYD A;  4TTE A;  5HFQ A;  3UV2 A;  4GNG A;  3ZVZ B;  4ZUX U;  1JM7 B;  5E3D A;  3G0L A;  5G04 B;  2YQD A;  5TRB A;  4MEP A;  3UV4 A;  2YW5 A;  5A5S A;  5I88 A;  2N9G A;  5FE4 A;  2ECI A;  3QZS A;  5C89 A;  1CHC A;  5CUA A;  5HQ7 A;  5FE0 A;  1DVP A;  5FE5 A;  5AME A;  1WEM A;  4BW3 A;  5EI4 A;  1Z2Q A;  3HCT A;  4UYE A;  2I7K A;  5IBN A;  4A9K A;  4HXN A;  4WZ0 A;  5AIT A;  2GRC A;  4UIT A;  4WHW A;  5KTW A;  3TLP A;  3SHB A;  4YYN A;  4YAB A;  2KYU A;  1WES A;  5D7X A;  3HMH A;  4NR4 A;  4QNS A;  4O76 A;  2VJE B;  4HXS A;  5A85 A;  5H85 A;  4O72 A;  4PCI A;  2YU4 A;  4FO9 A;  5L96 A;  4NS5 A;  2M85 A;  1T1H A;  4NR6 A;  4X2I A;  4NQN A;  4QSV A;  5FE1 A;  5EPR A;  4UYG A;  4LKA A;  5G05 B;  4YK0 A;  2YUC A;  4CFK A;  3DWY A;  2DVV A;  3P1C A;  4XUA A;  5IGK A;  2WP1 A;  1WEW A;  4X3G A;  5FH6 A;  5E0R A;  5EVA A;  2EGP A;  5LJ1 A;  4L58 A;  4UI9 B;  5HQ5 A;  3PUR A;  4WZ2 A;  5LKT A;  4A9H A;  5AD2 A;  4TQN A;  2E7N A;  4PS5 A;  5ENH A;  3N9P A;  4O75 A;  1WE9 A;  5ACY A;  3NXB A;  4O70 A;  2MD8 C;  2FSA A;  1E4U A;  5F25 A;  2LN0 A;  3IU6 A;  4MR5 A;  5CTL A;  4IOQ A;  1WIM A;  4QSQ A;  3IHP A;  5E9Y A;  5BT4 A;  1RMD A;  5C8G A;  5CPE A;  1WGM A;  2NXB A;  5LKZ A;  1ZBD B;  3N9Q A;  4UIZ A;  4GNE A;  5C87 A;  3HTK C;  1WEO A;  5H1T A;  4YYG A;  4O7B A;  5LUU A;  1VD4 A;  2YQL A;  2RS9 B;  4NR7 A;  5CQ7 A;  2KFT A;  4QBM A;  4XI1 A;  3ZPV 1;  2HYE D;  3JVL A;  5H9M A;  5FBX A;  5E9I A;  2XEU A;  5E9V A;  4PKL A;  4NRA A;  5LJ2 A;  2KWJ A;  5DKD A;  5E9M A;  2RO1 A;  4MR4 A;  4A9O A;  4NYV A;  4ALH A;  1JOC A;  4PPE A;  2L80 A;  4O7A A;  2LGL A;  2R0Y A;  5CU8 A;  3HCS A;  5DY7 A;  5BT5 A;  2C2V S;  4Q6F A;  3LJW A;  4YYD A;  2F6N A;  5F61 A;  4W4U A;  5TBN A;  2YW8 A;  5AIU A;  2K17 A;  3LQI A;  4CL9 A;  5EWV A;  4LC2 A;  3U5P A;  3KQI A;  5D3T A;  4NR5 A;  5ENG A;  5FE7 A;  2YYN A;  5F63 A;  3UVW A;  3U5J A;  2IDA A;  5CS8 A;  5F2P A;  4QSU A;  4QSX A;  4LAD B;  2YHN A;  2QIC A;  5KH7 A;  1HYJ A;  3QZT A;  5F60 A;  4MEN A;  5IGL A;  5TDW A;  5EPB A;  4J1P A;  4Q0N A;  4C9Z A;  4MR6 A;  4N4I A;  1F62 A;  4HBY A;  5CZG A;  4IR5 A;  2DX8 A;  3MUL A;  5FEY A;  4QUU A;  5KH9 A;  1FBV A;  2LGG A;  1WEP A;  2CKL A;  4ZC9 A;  5A83 A;  2MNY A;  2F42 A;  4QC3 A;  1MM3 A;  4HXM A;  5FDZ A;  2LGV A;  2R0V A;  4YYJ A;  3RTR B;  4CA1 A;  3SVG A;  4GPJ A;  4XY9 A;  5DKH A;  4TT6 A;  5C85 A;  2D9E A;  3M99 A;  2YEM A;  5HFR A;  4CUQ A;  3K2J A;  2VNF A;  1WUG A;  3GG3 A;  3HME A;  4B86 C;  2JMI A;  5EWW A;  5LVR A;  5CRM A;  2VJF A;  5I29 A;  4YBM A;  2MA5 A;  5ENI A;  4FIP A;  5EQ1 A;  3C6W A;  2KGI A;  5FG5 A;  4A0C D;  5ENF A;  1E6I A;  4UYF A;  4B7Y C;  5TB6 A;  5HJC A;  3L11 A;  5FB1 A;  5KTU A;  3DPL R;  4IR3 A;  2JRJ A;  4Z1S A;  5B78 A;  2E7O A;  5A5R A;  4GND A;  5HRV A;  4LYI A;  3SOX A;  2CKL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...