4PTBA

Crystal structure of human sp100 phd-bromodomain in the free state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
NSNICEVCNKWGRLFCCDTCPRSFHEHCHIPSVEANKNPWSCIFCRIKTIQERCPESQSGHQESEVLMRQMLPEEQLKCEFLLLKVYCDSKSCFFASEPYYNREGSQGPQKPMWLNKVKTSLNEQMYTRVEGFVQDMRLIFHNHKEFYREDKFTRLGIQVQDIFEKNFRNIFAIQETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nuclear autoantigen Sp-100
publication title Crystal structure of human SP100 PHD-Bromodomain in the free state
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 59
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ptbA02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ptbA01
5FB1A 5L8TA 5FDZA 4AP4A 4QSUA 5EWWA 5DLXA 2OSSA 1IYMA 3M99A 2VNFA 4WHUA 1WESA 5EPSA 3EB6A 4HBVA 3ZNIA 4HXNA 4GB0A 5TBNA 5AMEA 2KR4A 3P1FA 2K1JA 2MNZA 4NQNA 1WEQA 3PUQA 5CPEA 3DQVR 5DBMA 5L8UA 2DKWA 2N9GA 1WE9A 3NXBA 4PCIA 4O7BA 5E3DA 5B77A 4A0CD 1FP0A 4S3OC 4C67A 4FO9A 1ZBDB 2DVSA 1WUGA 5HFRA 5LVRA 1WENA 3UVXA 4O72A 2I7KA 1X4UA 4QEWA 4B7YC 5CQTA 5TRBA 4LZ2A 2G45A 4MEOA 3ONIA 4A9EA 4TQNA 5EM3A 4LZRA 4HXKA 4OGJA 5A5NA 4HXSA 4AYCA 4UYFA 3RCWA 4CUTA 4WZ0A 5F5ZA 5DYCA 4QZSA 5I7YA 1F68A 2EA6A 2G43A 4UP0A 5LKTA 5CUCA 4YY4A 4LDFA 3IHPA 3L11A 4QF3A 5F63A 5FE6A 4ZUXU 4HBWA 5F61A 3MXFA 5AIUA 4ZW1A 5CTLA 4UYEA 5E73A 2ECTA 4BHWA 2UZGA 4QYLA 2VJFB 3SOXA 5E0RA 5HM0A 2KWOA 2DWWA 4KV1A 5G05B 4TT4A 4YYHA 2MUMA 4O77A 5EQ1A 3N9MA 3HCUA 5IGKA 2L5EA 3NG2A 3AADA 5B79A 4KCXA 4YYDA 3SOUA 4PTBA 4HBYA 4A9JA 2E7NA 3UV2A 3LXJA 2C2LA 5EYAF 4BW1A 3O37A 4YBSA 4TU6A 4Q0NA 4NYXA 2AN6A 1WEMA 1WEOA 5I80A 4QY4A 5A82A 3N9LA 4QC1A 2MJVB 2HYED 2KU3A 4O78A 4PY6A 4WHWA 2CKLA 2MNYA 3IU5A 5FE0A 3LQJA 5ENIA 2L0BA 5FBXA 2WP1A 4CUPA 5H9MA 5D3JA 5EWDA 5B76A 5F1HA 5EI4A 4XUBA 2GRCA 5HLSA 2ECJA 2LXPC 5LKXA 1WEPA 4BW2A 2I8NA 4O64A 3UVWA 1EQFA 1MM3A 5J3XA 1XWHA 4QR4A 5KH3A 2RNXA 3UW9A 4ZC9A 5C11A 2OUOA 4LC2A 2KIZA 4MR4A 2NXBA 4PKLA 5EICA 2YHNA 3ZPVE 2NAAA 2KE1A 3LJWA 5CUBA 5II1A 2RNWA 4ALHA 2M6MA 3O33A 5A83A 4UP5A 3P1DA 5EGUA 4UIVA 4Z1QA 2R0VA 4A4CA 2E3KA 4YBMA 4YYJA 3RPGB 5IG6A 5E9KA 3U5LA 4GNEA 1G25A 4YC9A 5DX4A 2DVVA 1JOCA 2Y1MA 5B75A 5I86A 5TABA 5D1KB 4O71A 4QC3A 3DAIA 4CUQA 4I7DA 4QSXA 4N4FA 4HXRA 4NUCA 4HXLA 1WIMA 5FE5A 2M3HA 2CSYA 5E9VA 1K2FA 3U5PA 2E6SA 3U5MA 4O7CA 5HELA 1X4JA 2VP7A 2L85A 5D7XA 2LGLA 5G0FA 4A9OA 5A7CA 2YELA 5AD3A 2DX8A 2YW8A 5EWVA 5D1LB 5A85A 5CUDA 4QSVA 5JWMA 2VJEB 4CLBA 4YADA 5LJ2A 4Z93A 4NYWA 1X4IA 4LJNA 5KU3A 4TT6A 1Z6UA 4A9LA 3N9OA 3O34A 4N4HA 5AMFA 4TTEA 5KTXA 2ECVA 4X3GA 4NR9A 3N9PA 5BT3A 4YABA 2K17A 3K2JA 4F3IA 4NN2A 5CUGA 5HRXA 2KWNA 2G6QA 2YHOA 4TZ2A 2JMDA 5HRWA 2YYNA 4NR5A 4NRCA 5DW2A 4TYLA 5FG5A 3S92A 4V3KC 2QICA 4QUTA 2H0DA 4O74A 3FL2A 2G4AA 5TCMA 3ZYUA 4ZDTA 3VK6A 4QR3A 1LDJB 3GG3A 3JVKA 4YK0A 4LK9A 5I40A 2ZETC 4LADB 2VJEA 1U6GB 5D3RA 1WEEA 3IU6A 4UYFB 2JMIA 5FFYA 5IGLA 2YSMA 4IR4A 4MVTA 5EPRA 5DINA 3MB4A 4N4GA 5FG4A 2EODA 5COIA 1X0JA 2YQDA 4CL9A 5F36A 5D3TA 5C13A 5J0DA 1WILA 2F42A 5E7DA 5JG6A 5HENA 5DKDA 2DVQA 5HQ6A 2YEKA 5DFBA 5KO4A 3JVMA 5EPBA 5EVAA 4LYWA 5LKZA 3HCSA 3MQMA 3N9NA 4R8PK 4J0SA 2YYRA 1WFKA 5LCWB 4PPEA 2YW5A 1WEWA 5E9LA 3ZPV1 4UIYA 5HFQA 2DATA 2VPBA 4CUSA 5D1MB 4XY8A 3HMFA 5I29A 4J0RA 5ENCA 5F1LA 2RO1A 5IIDA 5D26A 3O70A 5D0CA 2KWJA 5FE2A 5KTUA 3GL6A 1LDKC 5CZGA 3ASLA 1JSPB 4MENA 5DLZA 4LYSA 3G0LA 4UIXA 5FB0A 5FFWA 5L97A 5FE1A 2KREA 3DWYA 4DONA 4UYHA 5HJCA 1RMDA 2KYUA 5L99A 5L96A 5DKHA 2ECGA 1E6IA 3U5KA 4UI9B 2ECNA 4O7AA 2ECWA 5DFDA 3KNVA 1WGMA 5C87A 4PCEA 4WZ2A 2FSAA 1N72A 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 5DFCA 5C85A 2PNXA 5B78A 2XEUA 4KV4A 4GNGA 5DKCA 5E9YA 3D7CA 3SVFA 4NRAA 3PHDA 5A5OA 4QSWA 2FUIA 3KV6A 5ACYA 4E96A 4O70A 3UVDA 4GNFA 2F6NA 4LZSA 4RVRA 4MR5A 4NR6A 4N3WA 4YYGA 3RTRB 3U5JA 3UV4A 2YURA 3EB5A 4IR5A 5A5SA 3O7AA 3T6RA 5EV9A 1VFYA 4A4BA 3TLPA 4J3IA 5E9MA 2YDWA 3G0JA 5FE7A 5IBNA 4PS5A 2PUYA 5AITA 5LVQA 5HEMA 4UIUA 3ZVZB 5I3LA 1ZS5A 5CUAA 5FFVA 1N87A 5G4RA 5L98A 3M63A 2IDAA 3HCTA 2RNYA 4TZ8A 4ZQLA 1JM7B 1E4UA 4HXMA 4HXPA 2OXQC 2LXHC 2YU4A 4A9KA 2M1RA 4A9MA 3C6WA 2KTBB 2RS9B 5H1TA 4YATA 3RPGC 4FK5A 4QUUA 5A5PA 4YH4A 3U5OA 2YQLA 5D3NA 1VD4A 4B86C 5CQ6A 5ENGA 4OGIA 2MA5A 2F6JA 4YYIA 5LKUA 4MEPA 5FH7A 5TDWA 2QIZA 2R0YA 4QEVA 5E74A 5I83A 4XYAA 3T7LA 3SOWA 4O7FA 5LUUA 5HRVA 5A81A 2JMJA 4V3LC 2H0DB 3ZYQA 3Q2FA 4NXJA 4UYDA 5D3LA 4YY6A 3N9QA 4HBXA 2K4DA 4IC2A 2LDRA 2DVRA 3HMHA 5C8GA 5CRMA 5CUEA 2YT5A 2LGKA 1CHCA 5B8DA 4LR6A 4AUQB 5ENHA 5DW1A 3QZVA 3QZTA 1DVPA 4NUDA 5FE8A 2YQMA 3O36A 4QSSA 5CFWA 2RFJA 2YSJA 4S3OB 4HXOA 4XY9A 2R0SA 2JRJA 4UIZA 4C66A 4FIPA 5D25A 2H60A 4YYKA 5HCLA 5CRZA 5I88A 3C5KA 2VPEA 5IGNA 4AYCB 3PURA 4O76A 3U5NA 3FKMX 5CQ5A 2XB1A 4GNDA 2YREA 1JM4B 3ZVYA 5CS8A 4LRGA 4MR6A 4WA6A 4A9FA 2VPGA 4MSXA 2CSZA 5F25A 5CGPA 4A9HA 5HQ5A 5I89A 2KWKA 2I50A 4QYDA 2D9EA 5F2PA 4Y03A 2MT5A 4Z6IA 2MD7B 4LLBA 5I7XA 4TKPB 3MUKA 4NQMA 4CUUA 2L80A 2RSDA 3HTKC 4GPJA 2E6RA 3MB3A 5DYXA 4O7EA 5EWHA 4QEUA 5DYUA 3UV5A 5CQAA 1VYXA 4P5OB 4WIVA 4NUEA 5LJ0A 4BW4A 4MR3A 2L5UA 2L75A 5FH8A 4IOQA 4O75A 5BT5A 4FJCA 4Q6FA 4QSPA 3DPLR 4TS8A 4MEQA 2D82A 4TU4A 5EU1A 5F60A 5CQ8A 2CKLB 2VPDA 4I7BA 3MULA 5CY9A 2LQ6A 5F62A 4UYGA 5CP5A 4Q0OA 5ENFA 2L84A 2D8SA 2FUUA 5AD2A 3P1CA 4CFKA 2VJFA 4QF2A 5F3AA 2E7OA 4BJXA 5D3HA 3SVGA 2BAYA 2WP2A 3Q2EA 2OO1A 3JVLA 5E3GA 4QBMA 3I3JA 5ETBA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 4YYMA 5CQ4A 5A5RA 5FE3A 5KTWA 2EGPA 4CCGX 4NS5A 4YBTA 3O35A 4QSRA 5FE4A 1MM2A 1FBVA 2M85A 3V43A 5BT4A 4UIWA 4YYNA 3ZTGA 5D3PA 4CURA 2LN0A 5H85A 4J1PA 4IC3A 4NR8A 3SVHA 3AQAA 4XI1A 5II2A 2R10A 3JVJA 3MHHA 3MHSA 5H1VA 3I2DA 3UVYA 5FEYA 4L7XA 2HDPA 3GV4A 3SHBA 2MA6A 4BW3A 4NR4A 4NYVA 5EK9A 4LYIA 5C4QA 5KH9A 5CQ3A 5IGMA 1F62A 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4W4UA 4A49A 2KGGA 5JI8A 5DYAA 1BORA 5D3SA 5A5QA 4QB3A 2YUCA 5DKAA 4R7EA 5DY7A 1V87A 4A9NA 2LGGA 3P5OA 4BBQA 4NR7A 5TB6A 2LSPB 4YH3A 5LJ1A 4UITA 4IOOA 2C2VS 5FG6A 4AKNA 4Z6HA 2KGIA 3KQIA 4N4IA 2Y1NA 2Y43A 4QSQA 1WUMA 4IR6A 3S91A 4C9ZA 5CU8A 5C89A 3L1XA 1HYIA 4NRBA 1T1HA 5EA1A 2CT2A 4IR3A 2LRIC 5EWCA 5I1QA 4IORA 4QSTA 3QZSA 4XUAA 5EP7A 5HQ7A 4CFLA 2L43A 4Z1SA 4X2IA 2MD8C 2YEMA 5KHMA 5CQ7A 5ENEA 4A9IA 5D24A 4L58A 5C7NA 4ALGA 5K29A 1WEUA 5ETDA 3M62A 3HMEA 4AVXA 5G4SA 1Z2QA 4QR5A 5EISA 4OUFA 1JM7A 5FH6A 2ECIA 4TT2A 4WZ3B 5ENBA 2LGVA 5FE9A 4QNSA 2QJ0A 5H1UA 5KH7A 3P1EA 4CA1A 4I7CA 2KFTA 1WEVA 4FLPA 5E9IA 2LV9A 5ENJA 3LRQA
chains in the Genus database with same CATH superfamily
5FB1A 5L8TA 5FDZA 4AP4A 4QSUA 5EWWA 5DLXA 2OSSA 1IYMA 3M99A 2VNFA 4WHUA 1WESA 5EPSA 3EB6A 4HBVA 3ZNIA 3FAOA 4HXNA 4GB0A 5TBNA 5AMEA 2KR4A 3P1FA 2K1JA 2MNZA 4NQNA 1WEQA 3PUQA 5CPEA 3DQVR 5DBMA 5L8UA 2DKWA 2N9GA 1WE9A 3NXBA 4PCIA 4O7BA 5E3DA 5B77A 4A0CD 1FP0A 2JUNA 4S3OC 4C67A 4FO9A 1ZBDB 2DVSA 1WUGA 5HFRA 5LVRA 3DWDA 1WENA 3UVXA 4O72A 2I7KA 1X4UA 4QEWA 4B7YC 2EXUA 5CQTA 5TRBA 4LZ2A 2G45A 4MEOA 3ONIA 4A9EA 4TQNA 5EM3A 4LZRA 4HXKA 4OGJA 5A5NA 4HXSA 4AYCA 4UYFA 3RCWA 4CUTA 4WZ0A 5F5ZA 5DYCA 4QZSA 5I7YA 1F68A 2EA6A 2G43A 4UP0A 5LKTA 5CUCA 4YY4A 4LDFA 2XOZA 3IHPA 3L11A 4QF3A 5F63A 5FE6A 4ZUXU 4HBWA 5F61A 3MXFA 5AIUA 4ZW1A 5CTLA 4UYEA 4Z0OA 5E73A 2ECTA 4BHWA 2UZGA 4QYLA 2VJFB 3SOXA 5E0RA 5HM0A 2KWOA 2DWWA 4KV1A 5G05B 4TT4A 4YYHA 2MUMA 4O77A 5EQ1A 3N9MA 3HCUA 5IGKA 2L5EA 3LVQE 3NG2A 3AADA 5B79A 4KCXA 4YYDA 4OGEA 3SOUA 4PTBA 4HBYA 4A9JA 2E7NA 3UV2A 3LXJA 2C2LA 5EYAF 4BW1A 3O37A 4YBSA 4TU6A 4Q0NA 4NYXA 2AN6A 1WEMA 1WEOA 5I80A 4QY4A 5A82A 3N9LA 4QC1A 2MJVB 2HYED 2KU3A 4O78A 4PY6A 4WHWA 2CKLA 2MNYA 3IU5A 5FE0A 3LQJA 5ENIA 2L0BA 2CRWA 5FBXA 2WP1A 4CUPA 5H9MA 5D3JA 5EWDA 5B76A 5F1HA 5EI4A 4XUBA 2GRCA 5HLSA 4AI6A 2ECJA 5LKXA 1WEPA 2LXPC 2M13A 4BW2A 2I8NA 4O64A 3UVWA 1MBMA 1EQFA 1MM3A 3D1DA 1XWHA 4QR4A 5J3XA 2RNXA 5KH3A 3UW9A 4ZC9A 5C11A 2OUOA 4LC2A 2KIZA 4MR4A 2NXBA 4PKLA 5EICA 2YHNA 2CRRA 3ZPVE 2NAAA 2KE1A 3LJWA 5CUBA 5II1A 2RNWA 4ALHA 2M6MA 3O33A 5A83A 4UP5A 3P1DA 5EGUA 4UIVA 4Z1QA 2R0VA 3LJUX 4A4CA 2E3KA 4YBMA 4YYJA 2DJAA 3RPGB 5IG6A 5E9KA 3U5LA 4GNEA 1G25A 3H7HA 4YC9A 2KKXA 5DX4A 2DVVA 1JOCA 2Y1MA 5B75A 5I86A 5TABA 5D1KB 4O71A 4QC3A 3DAIA 4CUQA 4I7DA 4QSXA 4N4FA 4HXRA 4NUCA 4HXLA 1WIMA 5FE5A 2M3HA 2CSYA 5E9VA 1K2FA 3U5PA 2E6SA 3U5MA 4O7CA 5HELA 1X4JA 2VP7A 2L85A 5D7XA 2LGLA 2CSVA 5G0FA 4A9OA 2D8UA 5A7CA 2YELA 5AD3A 2DX8A 2YW8A 5EWVA 5D1LB 5A85A 5CUDA 4QSVA 5JWMA 2VJEB 4CLBA 4YADA 5LJ2A 3FJUB 4Z93A 3VKGA 4NYWA 1X4IA 2MKEA 5KU3A 4TT6A 1Z6UA 2L7PA 4LJNA 4A9LA 3N9OA 3O34A 4N4HA 5AMFA 3D1BA 4TTEA 5KTXA 2ECVA 4X3GA 4NR9A 3N9PA 5BT3A 4YABA 2K17A 3K2JA 4F3IA 4NN2A 5CUGA 5HRXA 2KWNA 2G6QA 2YHOA 4TZ2A 2JMDA 5HRWA 2YYNA 4NR5A 4NRCA 5DW2A 4TYLA 5FG5A 3S92A 4V3KC 2QICA 4QUTA 2H0DA 4O74A 3FL2A 2G4AA 5TCMA 3ZYUA 4ZDTA 3VK6A 4QR3A 1LDJB 3GG3A 3JVKA 4YK0A 4LK9A 5I40A 3M7KA 2ZETC 4LADB 2VJEA 1U6GB 5D3RA 1WEEA 3IU6A 4UYFB 2JMIA 5FFYA 5IGLA 2YSMA 4IR4A 4MVTA 5EPRA 5DINA 3MB4A 4N4GA 5FG4A 2EODA 3KDEC 5COIA 1X0JA 2YQDA 4CL9A 5F36A 5D3TA 5C13A 5J0DA 1WILA 2F42A 5E7DA 5JG6A 5HENA 3ERRA 5DKDA 2DVQA 5HQ6A 2YEKA 5DFBA 5KO4A 3JVMA 5EPBA 5EVAA 4LYWA 4AKGA 3PLWA 5LKZA 3HCSA 3MQMA 3N9NA 4R8PK 4J0SA 2YYRA 1WFKA 3FM8C 4PPEA 5LCWB 2YW5A 1WEWA 5E9LA 3ZPV1 4UIYA 5HFQA 2DATA 2VPBA 4CUSA 5D1MB 4XY8A 3HMFA 5I29A 4J0RA 5ENCA 5F1LA 2RO1A 5SVIA 5IIDA 5D26A 3O70A 5D0CA 2FFWA 2KWJA 5FE2A 5KTUA 3GL6A 1LDKC 5CZGA 3ASLA 1JSPB 4MENA 5DLZA 4LYSA 3G0LA 4UIXA 5FB0A 5FFWA 5L97A 5FE1A 2KREA 3DWYA 4DONA 4UYHA 5HJCA 1RMDA 2KYUA 5L99A 5L96A 5DKHA 2ECGA 1E6IA 3U5KA 4UI9B 2ECNA 4O7AA 2ECWA 5DFDA 3KNVA 1WGMA 5C87A 4PCEA 4WZ2A 2FSAA 1N72A 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 5DFCA 5C85A 2PNXA 2XOCA 5B78A 2XEUA 3LDYA 4KV4A 4GNGA 5DKCA 5E9YA 3D7CA 3SVFA 4NRAA 3PHDA 5A5OA 4QSWA 2FUIA 3KV6A 5ACYA 4E96A 4O70A 3UVDA 4GNFA 2F6NA 4LZSA 4RVRA 3VKHA 4MR5A 4NR6A 2E61A 4N3WA 3JUEA 4YYGA 3RTRB 3U5JA 3UV4A 2YURA 3EB5A 2XP0A 4IR5A 5A5SA 3O7AA 3T6RA 1PUOA 5EV9A 1VFYA 4A4BA 3TLPA 4J3IA 5E9MA 2YDWA 3G0JA 5FE7A 5IBNA 4PS5A 2PUYA 5AITA 5LVQA 5HEMA 4UIUA 3ZVZB 5I3LA 1ZS5A 5CUAA 5FFVA 1N87A 3Q1DA 5G4RA 5L98A 3DDTA 3M63A 2IDAA 3HCTA 2RNYA 4TZ8A 4ZQLA 1JM7B 1E4UA 4HXMA 4HXPA 2OXQC 2LXHC 2YU4A 4A9KA 2M1RA 2XOYA 4A9MA 3C6WA 2KTBB 2RS9B 5H1TA 4YATA 3RPGC 4FK5A 4QUUA 5A5PA 4YH4A 3U5OA 2YQLA 5D3NA 1VD4A 2FD4A 5CQ6A 5ENGA 4OGIA 2MA5A 2EJNA 2F6JA 4YYIA 4MEPA 5LKUA 5FH7A 5TDWA 2QIZA 2R0YA 4QEVA 5E74A 5I83A 3MDBC 4XYAA 3T7LA 3SOWA 4O7FA 5K3QA 5LUUA 5HRVA 5A81A 2JMJA 2KKYA 2H0DB 4V3LC 3ZYQA 3Q2FA 4NXJA 4UYDA 5D3LA 4YY6A 3N9QA 4HBXA 2K4DA 4IC2A 2LDRA 2OWAA 2DVRA 3HMHA 5C8GA 5CRMA 5CUEA 2YT5A 2LGKA 1CHCA 5B8DA 4LR6A 4AUQB 5ENHA 5DW1A 3QZVA 3QZTA 1DVPA 4NUDA 5FE8A 2YQMA 3O36A 4QSSA 5CFWA 2RFJA 2YSJA 4S3OB 4HXOA 4XY9A 2R0SA 2JRJA 4UIZA 4C66A 4O62A 4FIPA 5D25A 2H60A 4YYKA 5HCLA 5CRZA 5I88A 3C5KA 2VPEA 5IGNA 4AYCB 3PURA 4O76A 3U5NA 3FKMX 5CQ5A 2XB1A 4GNDA 2YREA 1JM4B 3ZVYA 5CS8A 4LRGA 4MR6A 4WA6A 4A9FA 2VPGA 4MSXA 4AKIA 2CSZA 5F25A 5CGPA 4A9HA 5HQ5A 5I89A 2KWKA 2I50A 4QYDA 2D9EA 5F2PA 4Y03A 4AKHA 2DSMA 2MT5A 4Z6IA 2MD7B 2YVRA 4LLBA 5I7XA 4TKPB 3MUKA 4NQMA 4CUUA 2L80A 2RSDA 3HTKC 4GPJA 2E6RA 3MB3A 5DYXA 4O7EA 5EWHA 4QEUA 5DYUA 3UV5A 5CQAA 1VYXA 4P5OB 4WIVA 4NUEA 5LJ0A 4BW4A 5SVIB 4MR3A 2L5UA 2L75A 5FH8A 4IOQA 4O75A 5BT5A 4FJCA 4Q6FA 4QSPA 3DPLR 4TS8A 4MEQA 2IQJA 2D82A 4TU4A 2JM3A 5EU1A 3E2DA 5F60A 5CQ8A 2CKLB 2VPDA 4I7BA 3MULA 5CY9A 2LQ6A 5F62A 4UYGA 5CP5A 4Q0OA 5ENFA 2L84A 2D8SA 2FUUA 5AD2A 3P1CA 4CFKA 2VJFA 4QF2A 5F3AA 2EGMA 1ZKRA 2E7OA 4BJXA 5D3HA 3SVGA 2BAYA 2WP2A 3Q2EA 2OO1A 3JVLA 5E3GA 4QBMA 3I3JA 5ETBA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 4YYMA 5CQ4A 5A5RA 5FE3A 5KTWA 2EGPA 4CCGX 4NS5A 4YBTA 3O35A 4QSRA 5FE4A 1MM2A 1FBVA 2M85A 3V43A 5BT4A 4UIWA 4YYNA 3ZTGA 5D3PA 4CURA 2LN0A 5SVYA 5H85A 4J1PA 4B86C 4IC3A 4NR8A 3SVHA 3AQAA 4XI1A 3SUBA 5II2A 2R10A 3JVJA 3MHHA 3MHSA 5H1VA 3I2DA 3UVYA 5FEYA 4L7XA 2HDPA 3GV4A 4Z0RA 3SHBA 2MA6A 4BW3A 4NR4A 4NYVA 5EK9A 4LYIA 5C4QA 5KH9A 5CQ3A 5IGMA 1F62A 3FANA 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4OGCA 4W4UA 5SVXA 4H9DA 4A49A 2KGGA 5JI8A 5DYAA 1BORA 5D3SA 5A5QA 4QB3A 4F1PA 2YUCA 5DKAA 4R7EA 5DY7A 1V87A 2CONA 4A9NA 1DCQA 2LGGA 3P5OA 4BBQA 3LVRE 4NR7A 5TB6A 4QQ4A 2LSPB 3FEHA 4YH3A 5LJ1A 4UITA 4IOOA 2C2VS 5FG6A 4AKNA 4Z6HA 2KGIA 3KQIA 4N4IA 2Y1NA 2Y43A 4QSQA 2P57A 1WUMA 4IR6A 2RR4A 3S91A 4C9ZA 5CU8A 5C89A 3L1XA 3T9KA 1HYIA 4NRBA 1T1HA 5EA1A 2CT2A 2LAUA 4IR3A 2LRIC 5EWCA 5I1QA 4IORA 4QSTA 3QZSA 4XUAA 5EP7A 5HQ7A 4CFLA 2L43A 4Z1SA 4X2IA 2MD8C 2YEMA 5KHMA 5CQ7A 5ENEA 4A9IA 5D24A 4L58A 5C7NA 4ALGA 5K29A 1WEUA 5ETDA 3M62A 3HMEA 4AVXA 5G4SA 1Z2QA 4QR5A 5EISA 4OUFA 1JM7A 5FH6A 3O47A 2ECIA 4TT2A 4WZ3B 5ENBA 2LGVA 5FE9A 4QNSA 2QJ0A 2B0OE 5H1UA 5KH7A 3P1EA 4CA1A 4I7CA 2KFTA 1WEVA 4FLPA 5E9IA 2LV9A 5ENJA 3LRQA
chains in the Genus database with same CATH topology
5FB1A 5L8TA 5FDZA 4AP4A 4QSUA 5EWWA 5DLXA 2OSSA 1IYMA 3M99A 2VNFA 4WHUA 1WESA 5EPSA 3EB6A 4HBVA 3ZNIA 4HXNA 4GB0A 5TBNA 5AMEA 2KR4A 3P1FA 2K1JA 2MNZA 4NQNA 1WEQA 3PUQA 5CPEA 3DQVR 5DBMA 5L8UA 2DKWA 2N9GA 1WE9A 3NXBA 4PCIA 4O7BA 5E3DA 5B77A 4A0CD 1FP0A 4S3OC 4C67A 4FO9A 1ZBDB 2DVSA 1WUGA 5HFRA 5LVRA 1WENA 3UVXA 4O72A 2I7KA 1X4UA 4QEWA 4B7YC 5CQTA 5TRBA 4LZ2A 2G45A 4MEOA 3ONIA 4A9EA 4TQNA 5EM3A 4LZRA 4HXKA 4OGJA 5A5NA 4HXSA 4AYCA 4UYFA 3RCWA 4CUTA 4WZ0A 5F5ZA 5DYCA 4QZSA 5I7YA 1F68A 2EA6A 2G43A 4UP0A 5LKTA 5CUCA 4YY4A 4LDFA 3IHPA 3L11A 4QF3A 5F63A 5FE6A 4ZUXU 4HBWA 5F61A 3MXFA 5AIUA 4ZW1A 5CTLA 4UYEA 5E73A 2ECTA 4BHWA 2UZGA 4QYLA 2VJFB 3SOXA 5E0RA 5HM0A 2KWOA 2DWWA 4KV1A 5G05B 4TT4A 4YYHA 2MUMA 4O77A 5EQ1A 3N9MA 3HCUA 5IGKA 2L5EA 3NG2A 3AADA 5B79A 4KCXA 4YYDA 3SOUA 4PTBA 4HBYA 4A9JA 2E7NA 3UV2A 3LXJA 2C2LA 5EYAF 4BW1A 3O37A 4YBSA 4TU6A 4Q0NA 4NYXA 2AN6A 1WEMA 1WEOA 5I80A 4QY4A 5A82A 3N9LA 4QC1A 2MJVB 2HYED 2KU3A 4O78A 4PY6A 4WHWA 2CKLA 2MNYA 3IU5A 5FE0A 3LQJA 5ENIA 2L0BA 5FBXA 2WP1A 4CUPA 5H9MA 5D3JA 5EWDA 5B76A 5F1HA 5EI4A 4XUBA 2GRCA 5HLSA 2ECJA 2LXPC 5LKXA 1WEPA 4BW2A 2I8NA 4O64A 3UVWA 1EQFA 1MM3A 5J3XA 1XWHA 4QR4A 5KH3A 2RNXA 3UW9A 4ZC9A 5C11A 2OUOA 4LC2A 2KIZA 4MR4A 2NXBA 4PKLA 5EICA 2YHNA 3ZPVE 2NAAA 2KE1A 3LJWA 5CUBA 5II1A 2RNWA 4ALHA 2M6MA 3O33A 5A83A 4UP5A 3P1DA 5EGUA 4UIVA 4Z1QA 2R0VA 4A4CA 2E3KA 4YBMA 4YYJA 3RPGB 5IG6A 5E9KA 3U5LA 4GNEA 1G25A 4YC9A 5DX4A 2DVVA 1JOCA 2Y1MA 5B75A 5I86A 5TABA 5D1KB 4O71A 4QC3A 3DAIA 4CUQA 4I7DA 4QSXA 4N4FA 4HXRA 4NUCA 4HXLA 1WIMA 5FE5A 2M3HA 2CSYA 5E9VA 1K2FA 3U5PA 2E6SA 3U5MA 4O7CA 5HELA 1X4JA 2VP7A 2L85A 5D7XA 2LGLA 5G0FA 4A9OA 5A7CA 2YELA 5AD3A 2DX8A 2YW8A 5EWVA 5D1LB 5A85A 5CUDA 4QSVA 5JWMA 2VJEB 4CLBA 4YADA 5LJ2A 4Z93A 4NYWA 1X4IA 4LJNA 5KU3A 4TT6A 1Z6UA 4A9LA 3N9OA 3O34A 4N4HA 5AMFA 4TTEA 5KTXA 2ECVA 4X3GA 4NR9A 3N9PA 5BT3A 4YABA 2K17A 3K2JA 4F3IA 4NN2A 5CUGA 5HRXA 2KWNA 2G6QA 2YHOA 4TZ2A 2JMDA 5HRWA 2YYNA 4NR5A 4NRCA 5DW2A 4TYLA 5FG5A 3S92A 4V3KC 2QICA 4QUTA 2H0DA 4O74A 3FL2A 2G4AA 5TCMA 3ZYUA 4ZDTA 3VK6A 4QR3A 1LDJB 3GG3A 3JVKA 4YK0A 4LK9A 5I40A 2ZETC 4LADB 2VJEA 1U6GB 5D3RA 1WEEA 3IU6A 4UYFB 2JMIA 5FFYA 5IGLA 2YSMA 4IR4A 4MVTA 5EPRA 5DINA 3MB4A 4N4GA 5FG4A 2EODA 5COIA 1X0JA 2YQDA 4CL9A 5F36A 5D3TA 5C13A 5J0DA 1WILA 2F42A 5E7DA 5JG6A 5HENA 5DKDA 2DVQA 5HQ6A 2YEKA 5DFBA 5KO4A 3JVMA 5EPBA 5EVAA 4LYWA 5LKZA 3HCSA 3MQMA 3N9NA 4R8PK 4J0SA 2YYRA 1WFKA 5LCWB 4PPEA 2YW5A 1WEWA 5E9LA 3ZPV1 4UIYA 5HFQA 2DATA 2VPBA 4CUSA 5D1MB 4XY8A 3HMFA 5I29A 4J0RA 5ENCA 5F1LA 2RO1A 5IIDA 5D26A 3O70A 5D0CA 2KWJA 5FE2A 5KTUA 3GL6A 1LDKC 5CZGA 3ASLA 1JSPB 4MENA 5DLZA 4LYSA 3G0LA 4UIXA 5FB0A 5FFWA 5L97A 5FE1A 2KREA 3DWYA 4DONA 4UYHA 5HJCA 1RMDA 2KYUA 5L99A 5L96A 5DKHA 2ECGA 1E6IA 3U5KA 4UI9B 2ECNA 4O7AA 2ECWA 5DFDA 3KNVA 1WGMA 5C87A 4PCEA 4WZ2A 2FSAA 1N72A 5FERA 2K16A 3LQHA 1HYJA 4R2YA 4YAXA 5DFCA 5C85A 2PNXA 5B78A 2XEUA 4KV4A 4GNGA 5DKCA 5E9YA 3D7CA 3SVFA 4NRAA 3PHDA 5A5OA 4QSWA 2FUIA 3KV6A 5ACYA 4E96A 4O70A 3UVDA 4GNFA 2F6NA 4LZSA 4RVRA 4MR5A 4NR6A 4N3WA 4YYGA 3RTRB 3U5JA 3UV4A 2YURA 3EB5A 4IR5A 5A5SA 3O7AA 3T6RA 5EV9A 1VFYA 4A4BA 3TLPA 4J3IA 5E9MA 2YDWA 3G0JA 5FE7A 5IBNA 4PS5A 2PUYA 5AITA 5LVQA 5HEMA 4UIUA 3ZVZB 5I3LA 1ZS5A 5CUAA 5FFVA 1N87A 5G4RA 5L98A 3M63A 2IDAA 3HCTA 2RNYA 4TZ8A 4ZQLA 1JM7B 1E4UA 4HXMA 4HXPA 2OXQC 2LXHC 2YU4A 4A9KA 2M1RA 4A9MA 3C6WA 2KTBB 2RS9B 5H1TA 4YATA 3RPGC 4FK5A 4QUUA 5A5PA 4YH4A 3U5OA 2YQLA 5D3NA 1VD4A 4B86C 5CQ6A 5ENGA 4OGIA 2MA5A 2F6JA 4YYIA 5LKUA 4MEPA 5FH7A 5TDWA 2QIZA 2R0YA 4QEVA 5E74A 5I83A 4XYAA 3T7LA 3SOWA 4O7FA 5LUUA 5HRVA 5A81A 2JMJA 4V3LC 2H0DB 3ZYQA 3Q2FA 4NXJA 4UYDA 5D3LA 4YY6A 3N9QA 4HBXA 2K4DA 4IC2A 2LDRA 2DVRA 3HMHA 5C8GA 5CRMA 5CUEA 2YT5A 2LGKA 1CHCA 5B8DA 4LR6A 4AUQB 5ENHA 5DW1A 3QZVA 3QZTA 1DVPA 4NUDA 5FE8A 2YQMA 3O36A 4QSSA 5CFWA 2RFJA 2YSJA 4S3OB 4HXOA 4XY9A 2R0SA 2JRJA 4UIZA 4C66A 4FIPA 5D25A 2H60A 4YYKA 5HCLA 5CRZA 5I88A 3C5KA 2VPEA 5IGNA 4AYCB 3PURA 4O76A 3U5NA 3FKMX 5CQ5A 2XB1A 4GNDA 2YREA 1JM4B 3ZVYA 5CS8A 4LRGA 4MR6A 4WA6A 4A9FA 2VPGA 4MSXA 2CSZA 5F25A 5CGPA 4A9HA 5HQ5A 5I89A 2KWKA 2I50A 4QYDA 2D9EA 5F2PA 4Y03A 2MT5A 4Z6IA 2MD7B 4LLBA 5I7XA 4TKPB 3MUKA 4NQMA 4CUUA 2L80A 2RSDA 3HTKC 4GPJA 2E6RA 3MB3A 5DYXA 4O7EA 5EWHA 4QEUA 5DYUA 3UV5A 5CQAA 1VYXA 4P5OB 4WIVA 4NUEA 5LJ0A 4BW4A 4MR3A 2L5UA 2L75A 5FH8A 4IOQA 4O75A 5BT5A 4FJCA 4Q6FA 4QSPA 3DPLR 4TS8A 4MEQA 2D82A 4TU4A 5EU1A 5F60A 5CQ8A 2CKLB 2VPDA 4I7BA 3MULA 5CY9A 2LQ6A 5F62A 4UYGA 5CP5A 4Q0OA 5ENFA 2L84A 2D8SA 2FUUA 5AD2A 3P1CA 4CFKA 2VJFA 4QF2A 5F3AA 2E7OA 4BJXA 5D3HA 3SVGA 2BAYA 2WP2A 3Q2EA 2OO1A 3JVLA 5E3GA 4QBMA 3I3JA 5ETBA 2MIQA 4LKAA 3L1ZB 4F52B 5G04B 4YYMA 5CQ4A 5A5RA 5FE3A 5KTWA 2EGPA 4CCGX 4NS5A 4YBTA 3O35A 4QSRA 5FE4A 1MM2A 1FBVA 2M85A 3V43A 5BT4A 4UIWA 4YYNA 3ZTGA 5D3PA 4CURA 2LN0A 5H85A 4J1PA 4IC3A 4NR8A 3SVHA 3AQAA 4XI1A 5II2A 2R10A 3JVJA 3MHHA 3MHSA 5H1VA 3I2DA 3UVYA 5FEYA 4L7XA 2HDPA 3GV4A 3SHBA 2MA6A 4BW3A 4NR4A 4NYVA 5EK9A 4LYIA 5C4QA 5KH9A 5CQ3A 5IGMA 1F62A 3LQIA 5TDRA 3KV5A 2RI7A 1Z60A 4W4UA 4A49A 2KGGA 5JI8A 5DYAA 1BORA 5D3SA 5A5QA 4QB3A 2YUCA 5DKAA 4R7EA 5DY7A 1V87A 4A9NA 2LGGA 3P5OA 4BBQA 4NR7A 5TB6A 2LSPB 4YH3A 5LJ1A 4UITA 4IOOA 2C2VS 5FG6A 4AKNA 4Z6HA 2KGIA 3KQIA 4N4IA 2Y1NA 2Y43A 4QSQA 1WUMA 4IR6A 3S91A 4C9ZA 5CU8A 5C89A 3L1XA 1HYIA 4NRBA 1T1HA 5EA1A 2CT2A 4IR3A 2LRIC 5EWCA 5I1QA 4IORA 4QSTA 3QZSA 4XUAA 5EP7A 5HQ7A 4CFLA 2L43A 4Z1SA 4X2IA 2MD8C 2YEMA 5KHMA 5CQ7A 5ENEA 4A9IA 5D24A 4L58A 5C7NA 4ALGA 5K29A 1WEUA 5ETDA 3M62A 3HMEA 4AVXA 5G4SA 1Z2QA 4QR5A 5EISA 4OUFA 1JM7A 5FH6A 2ECIA 4TT2A 4WZ3B 5ENBA 2LGVA 5FE9A 4QNSA 2QJ0A 5H1UA 5KH7A 3P1EA 4CA1A 4I7CA 2KFTA 1WEVA 4FLPA 5E9IA 2LV9A 5ENJA 3LRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FB1 A;  5L8T A;  5FDZ A;  4AP4 A;  4QSU A;  5EWW A;  5DLX A;  2OSS A;  1IYM A;  3M99 A;  2VNF A;  4WHU A;  1WES A;  5EPS A;  3EB6 A;  4HBV A;  3ZNI A;  4HXN A;  4GB0 A;  5TBN A;  5AME A;  2KR4 A;  3P1F A;  2K1J A;  2MNZ A;  4NQN A;  1WEQ A;  3PUQ A;  5CPE A;  3DQV R;  5DBM A;  5L8U A;  2DKW A;  2N9G A;  1WE9 A;  3NXB A;  4PCI A;  4O7B A;  5E3D A;  5B77 A;  4A0C D;  1FP0 A;  4S3O C;  4C67 A;  4FO9 A;  1ZBD B;  2DVS A;  1WUG A;  5HFR A;  5LVR A;  1WEN A;  3UVX A;  4O72 A;  2I7K A;  1X4U A;  4QEW A;  4B7Y C;  5CQT A;  5TRB A;  4LZ2 A;  2G45 A;  4MEO A;  3ONI A;  4A9E A;  4TQN A;  5EM3 A;  4LZR A;  4HXK A;  4OGJ A;  5A5N A;  4HXS A;  4AYC A;  4UYF A;  3RCW A;  4CUT A;  4WZ0 A;  5F5Z A;  5DYC A;  4QZS A;  5I7Y A;  1F68 A;  2EA6 A;  2G43 A;  4UP0 A;  5LKT A;  5CUC A;  4YY4 A;  4LDF A;  3IHP A;  3L11 A;  4QF3 A;  5F63 A;  5FE6 A;  4ZUX U;  4HBW A;  5F61 A;  3MXF A;  5AIU A;  4ZW1 A;  5CTL A;  4UYE A;  5E73 A;  2ECT A;  4BHW A;  2UZG A;  4QYL A;  2VJF B;  3SOX A;  5E0R A;  5HM0 A;  2KWO A;  2DWW A;  4KV1 A;  5G05 B;  4TT4 A;  4YYH A;  2MUM A;  4O77 A;  5EQ1 A;  3N9M A;  3HCU A;  5IGK A;  2L5E A;  3NG2 A;  3AAD A;  5B79 A;  4KCX A;  4YYD A;  3SOU A;  4PTB A;  4HBY A;  4A9J A;  2E7N A;  3UV2 A;  3LXJ A;  2C2L A;  5EYA F;  4BW1 A;  3O37 A;  4YBS A;  4TU6 A;  4Q0N A;  4NYX A;  2AN6 A;  1WEM A;  1WEO A;  5I80 A;  4QY4 A;  5A82 A;  3N9L A;  4QC1 A;  2MJV B;  2HYE D;  2KU3 A;  4O78 A;  4PY6 A;  4WHW A;  2CKL A;  2MNY A;  3IU5 A;  5FE0 A;  3LQJ A;  5ENI A;  2L0B A;  5FBX A;  2WP1 A;  4CUP A;  5H9M A;  5D3J A;  5EWD A;  5B76 A;  5F1H A;  5EI4 A;  4XUB A;  2GRC A;  5HLS A;  2ECJ A;  2LXP C;  5LKX A;  1WEP A;  4BW2 A;  2I8N A;  4O64 A;  3UVW A;  1EQF A;  1MM3 A;  5J3X A;  1XWH A;  4QR4 A;  5KH3 A;  2RNX A;  3UW9 A;  4ZC9 A;  5C11 A;  2OUO A;  4LC2 A;  2KIZ A;  4MR4 A;  2NXB A;  4PKL A;  5EIC A;  2YHN A;  3ZPV E;  2NAA A;  2KE1 A;  3LJW A;  5CUB A;  5II1 A;  2RNW A;  4ALH A;  2M6M A;  3O33 A;  5A83 A;  4UP5 A;  3P1D A;  5EGU A;  4UIV A;  4Z1Q A;  2R0V A;  4A4C A;  2E3K A;  4YBM A;  4YYJ A;  3RPG B;  5IG6 A;  5E9K A;  3U5L A;  4GNE A;  1G25 A;  4YC9 A;  5DX4 A;  2DVV A;  1JOC A;  2Y1M A;  5B75 A;  5I86 A;  5TAB A;  5D1K B;  4O71 A;  4QC3 A;  3DAI A;  4CUQ A;  4I7D A;  4QSX A;  4N4F A;  4HXR A;  4NUC A;  4HXL A;  1WIM A;  5FE5 A;  2M3H A;  2CSY A;  5E9V A;  1K2F A;  3U5P A;  2E6S A;  3U5M A;  4O7C A;  5HEL A;  1X4J A;  2VP7 A;  2L85 A;  5D7X A;  2LGL A;  5G0F A;  4A9O A;  5A7C A;  2YEL A;  5AD3 A;  2DX8 A;  2YW8 A;  5EWV A;  5D1L B;  5A85 A;  5CUD A;  4QSV A;  5JWM A;  2VJE B;  4CLB A;  4YAD A;  5LJ2 A;  4Z93 A;  4NYW A;  1X4I A;  4LJN A;  5KU3 A;  4TT6 A;  1Z6U A;  4A9L A;  3N9O A;  3O34 A;  4N4H A;  5AMF A;  4TTE A;  5KTX A;  2ECV A;  4X3G A;  4NR9 A;  3N9P A;  5BT3 A;  4YAB A;  2K17 A;  3K2J A;  4F3I A;  4NN2 A;  5CUG A;  5HRX A;  2KWN A;  2G6Q A;  2YHO A;  4TZ2 A;  2JMD A;  5HRW A;  2YYN A;  4NR5 A;  4NRC A;  5DW2 A;  4TYL A;  5FG5 A;  3S92 A;  4V3K C;  2QIC A;  4QUT A;  2H0D A;  4O74 A;  3FL2 A;  2G4A A;  5TCM A;  3ZYU A;  4ZDT A;  3VK6 A;  4QR3 A;  1LDJ B;  3GG3 A;  3JVK A;  4YK0 A;  4LK9 A;  5I40 A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  5D3R A;  1WEE A;  3IU6 A;  4UYF B;  2JMI A;  5FFY A;  5IGL A;  2YSM A;  4IR4 A;  4MVT A;  5EPR A;  5DIN A;  3MB4 A;  4N4G A;  5FG4 A;  2EOD A;  5COI A;  1X0J A;  2YQD A;  4CL9 A;  5F36 A;  5D3T A;  5C13 A;  5J0D A;  1WIL A;  2F42 A;  5E7D A;  5JG6 A;  5HEN A;  5DKD A;  2DVQ A;  5HQ6 A;  2YEK A;  5DFB A;  5KO4 A;  3JVM A;  5EPB A;  5EVA A;  4LYW A;  5LKZ A;  3HCS A;  3MQM A;  3N9N A;  4R8P K;  4J0S A;  2YYR A;  1WFK A;  5LCW B;  4PPE A;  2YW5 A;  1WEW A;  5E9L A;  3ZPV 1;  4UIY A;  5HFQ A;  2DAT A;  2VPB A;  4CUS A;  5D1M B;  4XY8 A;  3HMF A;  5I29 A;  4J0R A;  5ENC A;  5F1L A;  2RO1 A;  5IID A;  5D26 A;  3O70 A;  5D0C A;  2KWJ A;  5FE2 A;  5KTU A;  3GL6 A;  1LDK C;  5CZG A;  3ASL A;  1JSP B;  4MEN A;  5DLZ A;  4LYS A;  3G0L A;  4UIX A;  5FB0 A;  5FFW A;  5L97 A;  5FE1 A;  2KRE A;  3DWY A;  4DON A;  4UYH A;  5HJC A;  1RMD A;  2KYU A;  5L99 A;  5L96 A;  5DKH A;  2ECG A;  1E6I A;  3U5K A;  4UI9 B;  2ECN A;  4O7A A;  2ECW A;  5DFD A;  3KNV A;  1WGM A;  5C87 A;  4PCE A;  4WZ2 A;  2FSA A;  1N72 A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  5DFC A;  5C85 A;  2PNX A;  5B78 A;  2XEU A;  4KV4 A;  4GNG A;  5DKC A;  5E9Y A;  3D7C A;  3SVF A;  4NRA A;  3PHD A;  5A5O A;  4QSW A;  2FUI A;  3KV6 A;  5ACY A;  4E96 A;  4O70 A;  3UVD A;  4GNF A;  2F6N A;  4LZS A;  4RVR A;  4MR5 A;  4NR6 A;  4N3W A;  4YYG A;  3RTR B;  3U5J A;  3UV4 A;  2YUR A;  3EB5 A;  4IR5 A;  5A5S A;  3O7A A;  3T6R A;  5EV9 A;  1VFY A;  4A4B A;  3TLP A;  4J3I A;  5E9M A;  2YDW A;  3G0J A;  5FE7 A;  5IBN A;  4PS5 A;  2PUY A;  5AIT A;  5LVQ A;  5HEM A;  4UIU A;  3ZVZ B;  5I3L A;  1ZS5 A;  5CUA A;  5FFV A;  1N87 A;  5G4R A;  5L98 A;  3M63 A;  2IDA A;  3HCT A;  2RNY A;  4TZ8 A;  4ZQL A;  1JM7 B;  1E4U A;  4HXM A;  4HXP A;  2OXQ C;  2LXH C;  2YU4 A;  4A9K A;  2M1R A;  4A9M A;  3C6W A;  2KTB B;  2RS9 B;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  4QUU A;  5A5P A;  4YH4 A;  3U5O A;  2YQL A;  5D3N A;  1VD4 A;  4B86 C;  5CQ6 A;  5ENG A;  4OGI A;  2MA5 A;  2F6J A;  4YYI A;  5LKU A;  4MEP A;  5FH7 A;  5TDW A;  2QIZ A;  2R0Y A;  4QEV A;  5E74 A;  5I83 A;  4XYA A;  3T7L A;  3SOW A;  4O7F A;  5LUU A;  5HRV A;  5A81 A;  2JMJ A;  4V3L C;  2H0D B;  3ZYQ A;  3Q2F A;  4NXJ A;  4UYD A;  5D3L A;  4YY6 A;  3N9Q A;  4HBX A;  2K4D A;  4IC2 A;  2LDR A;  2DVR A;  3HMH A;  5C8G A;  5CRM A;  5CUE A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4LR6 A;  4AUQ B;  5ENH A;  5DW1 A;  3QZV A;  3QZT A;  1DVP A;  4NUD A;  5FE8 A;  2YQM A;  3O36 A;  4QSS A;  5CFW A;  2RFJ A;  2YSJ A;  4S3O B;  4HXO A;  4XY9 A;  2R0S A;  2JRJ A;  4UIZ A;  4C66 A;  4FIP A;  5D25 A;  2H60 A;  4YYK A;  5HCL A;  5CRZ A;  5I88 A;  3C5K A;  2VPE A;  5IGN A;  4AYC B;  3PUR A;  4O76 A;  3U5N A;  3FKM X;  5CQ5 A;  2XB1 A;  4GND A;  2YRE A;  1JM4 B;  3ZVY A;  5CS8 A;  4LRG A;  4MR6 A;  4WA6 A;  4A9F A;  2VPG A;  4MSX A;  2CSZ A;  5F25 A;  5CGP A;  4A9H A;  5HQ5 A;  5I89 A;  2KWK A;  2I50 A;  4QYD A;  2D9E A;  5F2P A;  4Y03 A;  2MT5 A;  4Z6I A;  2MD7 B;  4LLB A;  5I7X A;  4TKP B;  3MUK A;  4NQM A;  4CUU A;  2L80 A;  2RSD A;  3HTK C;  4GPJ A;  2E6R A;  3MB3 A;  5DYX A;  4O7E A;  5EWH A;  4QEU A;  5DYU A;  3UV5 A;  5CQA A;  1VYX A;  4P5O B;  4WIV A;  4NUE A;  5LJ0 A;  4BW4 A;  4MR3 A;  2L5U A;  2L75 A;  5FH8 A;  4IOQ A;  4O75 A;  5BT5 A;  4FJC A;  4Q6F A;  4QSP A;  3DPL R;  4TS8 A;  4MEQ A;  2D82 A;  4TU4 A;  5EU1 A;  5F60 A;  5CQ8 A;  2CKL B;  2VPD A;  4I7B A;  3MUL A;  5CY9 A;  2LQ6 A;  5F62 A;  4UYG A;  5CP5 A;  4Q0O A;  5ENF A;  2L84 A;  2D8S A;  2FUU A;  5AD2 A;  3P1C A;  4CFK A;  2VJF A;  4QF2 A;  5F3A A;  2E7O A;  4BJX A;  5D3H A;  3SVG A;  2BAY A;  2WP2 A;  3Q2E A;  2OO1 A;  3JVL A;  5E3G A;  4QBM A;  3I3J A;  5ETB A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  4YYM A;  5CQ4 A;  5A5R A;  5FE3 A;  5KTW A;  2EGP A;  4CCG X;  4NS5 A;  4YBT A;  3O35 A;  4QSR A;  5FE4 A;  1MM2 A;  1FBV A;  2M85 A;  3V43 A;  5BT4 A;  4UIW A;  4YYN A;  3ZTG A;  5D3P A;  4CUR A;  2LN0 A;  5H85 A;  4J1P A;  4IC3 A;  4NR8 A;  3SVH A;  3AQA A;  4XI1 A;  5II2 A;  2R10 A;  3JVJ A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  3UVY A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  3SHB A;  2MA6 A;  4BW3 A;  4NR4 A;  4NYV A;  5EK9 A;  4LYI A;  5C4Q A;  5KH9 A;  5CQ3 A;  5IGM A;  1F62 A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4W4U A;  4A49 A;  2KGG A;  5JI8 A;  5DYA A;  1BOR A;  5D3S A;  5A5Q A;  4QB3 A;  2YUC A;  5DKA A;  4R7E A;  5DY7 A;  1V87 A;  4A9N A;  2LGG A;  3P5O A;  4BBQ A;  4NR7 A;  5TB6 A;  2LSP B;  4YH3 A;  5LJ1 A;  4UIT A;  4IOO A;  2C2V S;  5FG6 A;  4AKN A;  4Z6H A;  2KGI A;  3KQI A;  4N4I A;  2Y1N A;  2Y43 A;  4QSQ A;  1WUM A;  4IR6 A;  3S91 A;  4C9Z A;  5CU8 A;  5C89 A;  3L1X A;  1HYI A;  4NRB A;  1T1H A;  5EA1 A;  2CT2 A;  4IR3 A;  2LRI C;  5EWC A;  5I1Q A;  4IOR A;  4QST A;  3QZS A;  4XUA A;  5EP7 A;  5HQ7 A;  4CFL A;  2L43 A;  4Z1S A;  4X2I A;  2MD8 C;  2YEM A;  5KHM A;  5CQ7 A;  5ENE A;  4A9I A;  5D24 A;  4L58 A;  5C7N A;  4ALG A;  5K29 A;  1WEU A;  5ETD A;  3M62 A;  3HME A;  4AVX A;  5G4S A;  1Z2Q A;  4QR5 A;  5EIS A;  4OUF A;  1JM7 A;  5FH6 A;  2ECI A;  4TT2 A;  4WZ3 B;  5ENB A;  2LGV A;  5FE9 A;  4QNS A;  2QJ0 A;  5H1U A;  5KH7 A;  3P1E A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  4FLP A;  5E9I A;  2LV9 A;  5ENJ A;  3LRQ A; 
#chains in the Genus database with same CATH topology
 5FB1 A;  5L8T A;  5FDZ A;  4AP4 A;  4QSU A;  5EWW A;  5DLX A;  2OSS A;  1IYM A;  3M99 A;  2VNF A;  4WHU A;  1WES A;  5EPS A;  3EB6 A;  4HBV A;  3ZNI A;  3FAO A;  4HXN A;  4GB0 A;  5TBN A;  5AME A;  2KR4 A;  3P1F A;  2K1J A;  2MNZ A;  4NQN A;  1WEQ A;  3PUQ A;  5CPE A;  3DQV R;  5DBM A;  5L8U A;  2DKW A;  2N9G A;  1WE9 A;  3NXB A;  4PCI A;  4O7B A;  5E3D A;  5B77 A;  4A0C D;  1FP0 A;  2JUN A;  4S3O C;  4C67 A;  4FO9 A;  1ZBD B;  2DVS A;  1WUG A;  5HFR A;  5LVR A;  3DWD A;  1WEN A;  3UVX A;  4O72 A;  2I7K A;  1X4U A;  4QEW A;  4B7Y C;  2EXU A;  5CQT A;  5TRB A;  4LZ2 A;  2G45 A;  4MEO A;  3ONI A;  4A9E A;  4TQN A;  5EM3 A;  4LZR A;  4HXK A;  4OGJ A;  5A5N A;  4HXS A;  4AYC A;  4UYF A;  3RCW A;  4CUT A;  4WZ0 A;  5F5Z A;  5DYC A;  4QZS A;  5I7Y A;  1F68 A;  2EA6 A;  2G43 A;  4UP0 A;  5LKT A;  5CUC A;  4YY4 A;  4LDF A;  2XOZ A;  3IHP A;  3L11 A;  4QF3 A;  5F63 A;  5FE6 A;  4ZUX U;  4HBW A;  5F61 A;  3MXF A;  5AIU A;  4ZW1 A;  5CTL A;  4UYE A;  4Z0O A;  5E73 A;  2ECT A;  4BHW A;  2UZG A;  4QYL A;  2VJF B;  3SOX A;  5E0R A;  5HM0 A;  2KWO A;  2DWW A;  4KV1 A;  5G05 B;  4TT4 A;  4YYH A;  2MUM A;  4O77 A;  5EQ1 A;  3N9M A;  3HCU A;  5IGK A;  2L5E A;  3LVQ E;  3NG2 A;  3AAD A;  5B79 A;  4KCX A;  4YYD A;  4OGE A;  3SOU A;  4PTB A;  4HBY A;  4A9J A;  2E7N A;  3UV2 A;  3LXJ A;  2C2L A;  5EYA F;  4BW1 A;  3O37 A;  4YBS A;  4TU6 A;  4Q0N A;  4NYX A;  2AN6 A;  1WEM A;  1WEO A;  5I80 A;  4QY4 A;  5A82 A;  3N9L A;  4QC1 A;  2MJV B;  2HYE D;  2KU3 A;  4O78 A;  4PY6 A;  4WHW A;  2CKL A;  2MNY A;  3IU5 A;  5FE0 A;  3LQJ A;  5ENI A;  2L0B A;  2CRW A;  5FBX A;  2WP1 A;  4CUP A;  5H9M A;  5D3J A;  5EWD A;  5B76 A;  5F1H A;  5EI4 A;  4XUB A;  2GRC A;  5HLS A;  4AI6 A;  2ECJ A;  5LKX A;  1WEP A;  2LXP C;  2M13 A;  4BW2 A;  2I8N A;  4O64 A;  3UVW A;  1MBM A;  1EQF A;  1MM3 A;  3D1D A;  1XWH A;  4QR4 A;  5J3X A;  2RNX A;  5KH3 A;  3UW9 A;  4ZC9 A;  5C11 A;  2OUO A;  4LC2 A;  2KIZ A;  4MR4 A;  2NXB A;  4PKL A;  5EIC A;  2YHN A;  2CRR A;  3ZPV E;  2NAA A;  2KE1 A;  3LJW A;  5CUB A;  5II1 A;  2RNW A;  4ALH A;  2M6M A;  3O33 A;  5A83 A;  4UP5 A;  3P1D A;  5EGU A;  4UIV A;  4Z1Q A;  2R0V A;  3LJU X;  4A4C A;  2E3K A;  4YBM A;  4YYJ A;  2DJA A;  3RPG B;  5IG6 A;  5E9K A;  3U5L A;  4GNE A;  1G25 A;  3H7H A;  4YC9 A;  2KKX A;  5DX4 A;  2DVV A;  1JOC A;  2Y1M A;  5B75 A;  5I86 A;  5TAB A;  5D1K B;  4O71 A;  4QC3 A;  3DAI A;  4CUQ A;  4I7D A;  4QSX A;  4N4F A;  4HXR A;  4NUC A;  4HXL A;  1WIM A;  5FE5 A;  2M3H A;  2CSY A;  5E9V A;  1K2F A;  3U5P A;  2E6S A;  3U5M A;  4O7C A;  5HEL A;  1X4J A;  2VP7 A;  2L85 A;  5D7X A;  2LGL A;  2CSV A;  5G0F A;  4A9O A;  2D8U A;  5A7C A;  2YEL A;  5AD3 A;  2DX8 A;  2YW8 A;  5EWV A;  5D1L B;  5A85 A;  5CUD A;  4QSV A;  5JWM A;  2VJE B;  4CLB A;  4YAD A;  5LJ2 A;  3FJU B;  4Z93 A;  3VKG A;  4NYW A;  1X4I A;  2MKE A;  5KU3 A;  4TT6 A;  1Z6U A;  2L7P A;  4LJN A;  4A9L A;  3N9O A;  3O34 A;  4N4H A;  5AMF A;  3D1B A;  4TTE A;  5KTX A;  2ECV A;  4X3G A;  4NR9 A;  3N9P A;  5BT3 A;  4YAB A;  2K17 A;  3K2J A;  4F3I A;  4NN2 A;  5CUG A;  5HRX A;  2KWN A;  2G6Q A;  2YHO A;  4TZ2 A;  2JMD A;  5HRW A;  2YYN A;  4NR5 A;  4NRC A;  5DW2 A;  4TYL A;  5FG5 A;  3S92 A;  4V3K C;  2QIC A;  4QUT A;  2H0D A;  4O74 A;  3FL2 A;  2G4A A;  5TCM A;  3ZYU A;  4ZDT A;  3VK6 A;  4QR3 A;  1LDJ B;  3GG3 A;  3JVK A;  4YK0 A;  4LK9 A;  5I40 A;  3M7K A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  5D3R A;  1WEE A;  3IU6 A;  4UYF B;  2JMI A;  5FFY A;  5IGL A;  2YSM A;  4IR4 A;  4MVT A;  5EPR A;  5DIN A;  3MB4 A;  4N4G A;  5FG4 A;  2EOD A;  3KDE C;  5COI A;  1X0J A;  2YQD A;  4CL9 A;  5F36 A;  5D3T A;  5C13 A;  5J0D A;  1WIL A;  2F42 A;  5E7D A;  5JG6 A;  5HEN A;  3ERR A;  5DKD A;  2DVQ A;  5HQ6 A;  2YEK A;  5DFB A;  5KO4 A;  3JVM A;  5EPB A;  5EVA A;  4LYW A;  4AKG A;  3PLW A;  5LKZ A;  3HCS A;  3MQM A;  3N9N A;  4R8P K;  4J0S A;  2YYR A;  1WFK A;  3FM8 C;  4PPE A;  5LCW B;  2YW5 A;  1WEW A;  5E9L A;  3ZPV 1;  4UIY A;  5HFQ A;  2DAT A;  2VPB A;  4CUS A;  5D1M B;  4XY8 A;  3HMF A;  5I29 A;  4J0R A;  5ENC A;  5F1L A;  2RO1 A;  5SVI A;  5IID A;  5D26 A;  3O70 A;  5D0C A;  2FFW A;  2KWJ A;  5FE2 A;  5KTU A;  3GL6 A;  1LDK C;  5CZG A;  3ASL A;  1JSP B;  4MEN A;  5DLZ A;  4LYS A;  3G0L A;  4UIX A;  5FB0 A;  5FFW A;  5L97 A;  5FE1 A;  2KRE A;  3DWY A;  4DON A;  4UYH A;  5HJC A;  1RMD A;  2KYU A;  5L99 A;  5L96 A;  5DKH A;  2ECG A;  1E6I A;  3U5K A;  4UI9 B;  2ECN A;  4O7A A;  2ECW A;  5DFD A;  3KNV A;  1WGM A;  5C87 A;  4PCE A;  4WZ2 A;  2FSA A;  1N72 A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  5DFC A;  5C85 A;  2PNX A;  2XOC A;  5B78 A;  2XEU A;  3LDY A;  4KV4 A;  4GNG A;  5DKC A;  5E9Y A;  3D7C A;  3SVF A;  4NRA A;  3PHD A;  5A5O A;  4QSW A;  2FUI A;  3KV6 A;  5ACY A;  4E96 A;  4O70 A;  3UVD A;  4GNF A;  2F6N A;  4LZS A;  4RVR A;  3VKH A;  4MR5 A;  4NR6 A;  2E61 A;  4N3W A;  3JUE A;  4YYG A;  3RTR B;  3U5J A;  3UV4 A;  2YUR A;  3EB5 A;  2XP0 A;  4IR5 A;  5A5S A;  3O7A A;  3T6R A;  1PUO A;  5EV9 A;  1VFY A;  4A4B A;  3TLP A;  4J3I A;  5E9M A;  2YDW A;  3G0J A;  5FE7 A;  5IBN A;  4PS5 A;  2PUY A;  5AIT A;  5LVQ A;  5HEM A;  4UIU A;  3ZVZ B;  5I3L A;  1ZS5 A;  5CUA A;  5FFV A;  1N87 A;  3Q1D A;  5G4R A;  5L98 A;  3DDT A;  3M63 A;  2IDA A;  3HCT A;  2RNY A;  4TZ8 A;  4ZQL A;  1JM7 B;  1E4U A;  4HXM A;  4HXP A;  2OXQ C;  2LXH C;  2YU4 A;  4A9K A;  2M1R A;  2XOY A;  4A9M A;  3C6W A;  2KTB B;  2RS9 B;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  4QUU A;  5A5P A;  4YH4 A;  3U5O A;  2YQL A;  5D3N A;  1VD4 A;  2FD4 A;  5CQ6 A;  5ENG A;  4OGI A;  2MA5 A;  2EJN A;  2F6J A;  4YYI A;  4MEP A;  5LKU A;  5FH7 A;  5TDW A;  2QIZ A;  2R0Y A;  4QEV A;  5E74 A;  5I83 A;  3MDB C;  4XYA A;  3T7L A;  3SOW A;  4O7F A;  5K3Q A;  5LUU A;  5HRV A;  5A81 A;  2JMJ A;  2KKY A;  2H0D B;  4V3L C;  3ZYQ A;  3Q2F A;  4NXJ A;  4UYD A;  5D3L A;  4YY6 A;  3N9Q A;  4HBX A;  2K4D A;  4IC2 A;  2LDR A;  2OWA A;  2DVR A;  3HMH A;  5C8G A;  5CRM A;  5CUE A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4LR6 A;  4AUQ B;  5ENH A;  5DW1 A;  3QZV A;  3QZT A;  1DVP A;  4NUD A;  5FE8 A;  2YQM A;  3O36 A;  4QSS A;  5CFW A;  2RFJ A;  2YSJ A;  4S3O B;  4HXO A;  4XY9 A;  2R0S A;  2JRJ A;  4UIZ A;  4C66 A;  4O62 A;  4FIP A;  5D25 A;  2H60 A;  4YYK A;  5HCL A;  5CRZ A;  5I88 A;  3C5K A;  2VPE A;  5IGN A;  4AYC B;  3PUR A;  4O76 A;  3U5N A;  3FKM X;  5CQ5 A;  2XB1 A;  4GND A;  2YRE A;  1JM4 B;  3ZVY A;  5CS8 A;  4LRG A;  4MR6 A;  4WA6 A;  4A9F A;  2VPG A;  4MSX A;  4AKI A;  2CSZ A;  5F25 A;  5CGP A;  4A9H A;  5HQ5 A;  5I89 A;  2KWK A;  2I50 A;  4QYD A;  2D9E A;  5F2P A;  4Y03 A;  4AKH A;  2DSM A;  2MT5 A;  4Z6I A;  2MD7 B;  2YVR A;  4LLB A;  5I7X A;  4TKP B;  3MUK A;  4NQM A;  4CUU A;  2L80 A;  2RSD A;  3HTK C;  4GPJ A;  2E6R A;  3MB3 A;  5DYX A;  4O7E A;  5EWH A;  4QEU A;  5DYU A;  3UV5 A;  5CQA A;  1VYX A;  4P5O B;  4WIV A;  4NUE A;  5LJ0 A;  4BW4 A;  5SVI B;  4MR3 A;  2L5U A;  2L75 A;  5FH8 A;  4IOQ A;  4O75 A;  5BT5 A;  4FJC A;  4Q6F A;  4QSP A;  3DPL R;  4TS8 A;  4MEQ A;  2IQJ A;  2D82 A;  4TU4 A;  2JM3 A;  5EU1 A;  3E2D A;  5F60 A;  5CQ8 A;  2CKL B;  2VPD A;  4I7B A;  3MUL A;  5CY9 A;  2LQ6 A;  5F62 A;  4UYG A;  5CP5 A;  4Q0O A;  5ENF A;  2L84 A;  2D8S A;  2FUU A;  5AD2 A;  3P1C A;  4CFK A;  2VJF A;  4QF2 A;  5F3A A;  2EGM A;  1ZKR A;  2E7O A;  4BJX A;  5D3H A;  3SVG A;  2BAY A;  2WP2 A;  3Q2E A;  2OO1 A;  3JVL A;  5E3G A;  4QBM A;  3I3J A;  5ETB A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  4YYM A;  5CQ4 A;  5A5R A;  5FE3 A;  5KTW A;  2EGP A;  4CCG X;  4NS5 A;  4YBT A;  3O35 A;  4QSR A;  5FE4 A;  1MM2 A;  1FBV A;  2M85 A;  3V43 A;  5BT4 A;  4UIW A;  4YYN A;  3ZTG A;  5D3P A;  4CUR A;  2LN0 A;  5SVY A;  5H85 A;  4J1P A;  4B86 C;  4IC3 A;  4NR8 A;  3SVH A;  3AQA A;  4XI1 A;  3SUB A;  5II2 A;  2R10 A;  3JVJ A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  3UVY A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  4Z0R A;  3SHB A;  2MA6 A;  4BW3 A;  4NR4 A;  4NYV A;  5EK9 A;  4LYI A;  5C4Q A;  5KH9 A;  5CQ3 A;  5IGM A;  1F62 A;  3FAN A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4OGC A;  4W4U A;  5SVX A;  4H9D A;  4A49 A;  2KGG A;  5JI8 A;  5DYA A;  1BOR A;  5D3S A;  5A5Q A;  4QB3 A;  4F1P A;  2YUC A;  5DKA A;  4R7E A;  5DY7 A;  1V87 A;  2CON A;  4A9N A;  1DCQ A;  2LGG A;  3P5O A;  4BBQ A;  3LVR E;  4NR7 A;  5TB6 A;  4QQ4 A;  2LSP B;  3FEH A;  4YH3 A;  5LJ1 A;  4UIT A;  4IOO A;  2C2V S;  5FG6 A;  4AKN A;  4Z6H A;  2KGI A;  3KQI A;  4N4I A;  2Y1N A;  2Y43 A;  4QSQ A;  2P57 A;  1WUM A;  4IR6 A;  2RR4 A;  3S91 A;  4C9Z A;  5CU8 A;  5C89 A;  3L1X A;  3T9K A;  1HYI A;  4NRB A;  1T1H A;  5EA1 A;  2CT2 A;  2LAU A;  4IR3 A;  2LRI C;  5EWC A;  5I1Q A;  4IOR A;  4QST A;  3QZS A;  4XUA A;  5EP7 A;  5HQ7 A;  4CFL A;  2L43 A;  4Z1S A;  4X2I A;  2MD8 C;  2YEM A;  5KHM A;  5CQ7 A;  5ENE A;  4A9I A;  5D24 A;  4L58 A;  5C7N A;  4ALG A;  5K29 A;  1WEU A;  5ETD A;  3M62 A;  3HME A;  4AVX A;  5G4S A;  1Z2Q A;  4QR5 A;  5EIS A;  4OUF A;  1JM7 A;  5FH6 A;  3O47 A;  2ECI A;  4TT2 A;  4WZ3 B;  5ENB A;  2LGV A;  5FE9 A;  4QNS A;  2QJ0 A;  2B0O E;  5H1U A;  5KH7 A;  3P1E A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  4FLP A;  5E9I A;  2LV9 A;  5ENJ A;  3LRQ A; 
#chains in the Genus database with same CATH homology
 5FB1 A;  5L8T A;  5FDZ A;  4AP4 A;  4QSU A;  5EWW A;  5DLX A;  2OSS A;  1IYM A;  3M99 A;  2VNF A;  4WHU A;  1WES A;  5EPS A;  3EB6 A;  4HBV A;  3ZNI A;  4HXN A;  4GB0 A;  5TBN A;  5AME A;  2KR4 A;  3P1F A;  2K1J A;  2MNZ A;  4NQN A;  1WEQ A;  3PUQ A;  5CPE A;  3DQV R;  5DBM A;  5L8U A;  2DKW A;  2N9G A;  1WE9 A;  3NXB A;  4PCI A;  4O7B A;  5E3D A;  5B77 A;  4A0C D;  1FP0 A;  4S3O C;  4C67 A;  4FO9 A;  1ZBD B;  2DVS A;  1WUG A;  5HFR A;  5LVR A;  1WEN A;  3UVX A;  4O72 A;  2I7K A;  1X4U A;  4QEW A;  4B7Y C;  5CQT A;  5TRB A;  4LZ2 A;  2G45 A;  4MEO A;  3ONI A;  4A9E A;  4TQN A;  5EM3 A;  4LZR A;  4HXK A;  4OGJ A;  5A5N A;  4HXS A;  4AYC A;  4UYF A;  3RCW A;  4CUT A;  4WZ0 A;  5F5Z A;  5DYC A;  4QZS A;  5I7Y A;  1F68 A;  2EA6 A;  2G43 A;  4UP0 A;  5LKT A;  5CUC A;  4YY4 A;  4LDF A;  3IHP A;  3L11 A;  4QF3 A;  5F63 A;  5FE6 A;  4ZUX U;  4HBW A;  5F61 A;  3MXF A;  5AIU A;  4ZW1 A;  5CTL A;  4UYE A;  5E73 A;  2ECT A;  4BHW A;  2UZG A;  4QYL A;  2VJF B;  3SOX A;  5E0R A;  5HM0 A;  2KWO A;  2DWW A;  4KV1 A;  5G05 B;  4TT4 A;  4YYH A;  2MUM A;  4O77 A;  5EQ1 A;  3N9M A;  3HCU A;  5IGK A;  2L5E A;  3NG2 A;  3AAD A;  5B79 A;  4KCX A;  4YYD A;  3SOU A;  4PTB A;  4HBY A;  4A9J A;  2E7N A;  3UV2 A;  3LXJ A;  2C2L A;  5EYA F;  4BW1 A;  3O37 A;  4YBS A;  4TU6 A;  4Q0N A;  4NYX A;  2AN6 A;  1WEM A;  1WEO A;  5I80 A;  4QY4 A;  5A82 A;  3N9L A;  4QC1 A;  2MJV B;  2HYE D;  2KU3 A;  4O78 A;  4PY6 A;  4WHW A;  2CKL A;  2MNY A;  3IU5 A;  5FE0 A;  3LQJ A;  5ENI A;  2L0B A;  5FBX A;  2WP1 A;  4CUP A;  5H9M A;  5D3J A;  5EWD A;  5B76 A;  5F1H A;  5EI4 A;  4XUB A;  2GRC A;  5HLS A;  2ECJ A;  2LXP C;  5LKX A;  1WEP A;  4BW2 A;  2I8N A;  4O64 A;  3UVW A;  1EQF A;  1MM3 A;  5J3X A;  1XWH A;  4QR4 A;  5KH3 A;  2RNX A;  3UW9 A;  4ZC9 A;  5C11 A;  2OUO A;  4LC2 A;  2KIZ A;  4MR4 A;  2NXB A;  4PKL A;  5EIC A;  2YHN A;  3ZPV E;  2NAA A;  2KE1 A;  3LJW A;  5CUB A;  5II1 A;  2RNW A;  4ALH A;  2M6M A;  3O33 A;  5A83 A;  4UP5 A;  3P1D A;  5EGU A;  4UIV A;  4Z1Q A;  2R0V A;  4A4C A;  2E3K A;  4YBM A;  4YYJ A;  3RPG B;  5IG6 A;  5E9K A;  3U5L A;  4GNE A;  1G25 A;  4YC9 A;  5DX4 A;  2DVV A;  1JOC A;  2Y1M A;  5B75 A;  5I86 A;  5TAB A;  5D1K B;  4O71 A;  4QC3 A;  3DAI A;  4CUQ A;  4I7D A;  4QSX A;  4N4F A;  4HXR A;  4NUC A;  4HXL A;  1WIM A;  5FE5 A;  2M3H A;  2CSY A;  5E9V A;  1K2F A;  3U5P A;  2E6S A;  3U5M A;  4O7C A;  5HEL A;  1X4J A;  2VP7 A;  2L85 A;  5D7X A;  2LGL A;  5G0F A;  4A9O A;  5A7C A;  2YEL A;  5AD3 A;  2DX8 A;  2YW8 A;  5EWV A;  5D1L B;  5A85 A;  5CUD A;  4QSV A;  5JWM A;  2VJE B;  4CLB A;  4YAD A;  5LJ2 A;  4Z93 A;  4NYW A;  1X4I A;  4LJN A;  5KU3 A;  4TT6 A;  1Z6U A;  4A9L A;  3N9O A;  3O34 A;  4N4H A;  5AMF A;  4TTE A;  5KTX A;  2ECV A;  4X3G A;  4NR9 A;  3N9P A;  5BT3 A;  4YAB A;  2K17 A;  3K2J A;  4F3I A;  4NN2 A;  5CUG A;  5HRX A;  2KWN A;  2G6Q A;  2YHO A;  4TZ2 A;  2JMD A;  5HRW A;  2YYN A;  4NR5 A;  4NRC A;  5DW2 A;  4TYL A;  5FG5 A;  3S92 A;  4V3K C;  2QIC A;  4QUT A;  2H0D A;  4O74 A;  3FL2 A;  2G4A A;  5TCM A;  3ZYU A;  4ZDT A;  3VK6 A;  4QR3 A;  1LDJ B;  3GG3 A;  3JVK A;  4YK0 A;  4LK9 A;  5I40 A;  2ZET C;  4LAD B;  2VJE A;  1U6G B;  5D3R A;  1WEE A;  3IU6 A;  4UYF B;  2JMI A;  5FFY A;  5IGL A;  2YSM A;  4IR4 A;  4MVT A;  5EPR A;  5DIN A;  3MB4 A;  4N4G A;  5FG4 A;  2EOD A;  5COI A;  1X0J A;  2YQD A;  4CL9 A;  5F36 A;  5D3T A;  5C13 A;  5J0D A;  1WIL A;  2F42 A;  5E7D A;  5JG6 A;  5HEN A;  5DKD A;  2DVQ A;  5HQ6 A;  2YEK A;  5DFB A;  5KO4 A;  3JVM A;  5EPB A;  5EVA A;  4LYW A;  5LKZ A;  3HCS A;  3MQM A;  3N9N A;  4R8P K;  4J0S A;  2YYR A;  1WFK A;  5LCW B;  4PPE A;  2YW5 A;  1WEW A;  5E9L A;  3ZPV 1;  4UIY A;  5HFQ A;  2DAT A;  2VPB A;  4CUS A;  5D1M B;  4XY8 A;  3HMF A;  5I29 A;  4J0R A;  5ENC A;  5F1L A;  2RO1 A;  5IID A;  5D26 A;  3O70 A;  5D0C A;  2KWJ A;  5FE2 A;  5KTU A;  3GL6 A;  1LDK C;  5CZG A;  3ASL A;  1JSP B;  4MEN A;  5DLZ A;  4LYS A;  3G0L A;  4UIX A;  5FB0 A;  5FFW A;  5L97 A;  5FE1 A;  2KRE A;  3DWY A;  4DON A;  4UYH A;  5HJC A;  1RMD A;  2KYU A;  5L99 A;  5L96 A;  5DKH A;  2ECG A;  1E6I A;  3U5K A;  4UI9 B;  2ECN A;  4O7A A;  2ECW A;  5DFD A;  3KNV A;  1WGM A;  5C87 A;  4PCE A;  4WZ2 A;  2FSA A;  1N72 A;  5FER A;  2K16 A;  3LQH A;  1HYJ A;  4R2Y A;  4YAX A;  5DFC A;  5C85 A;  2PNX A;  5B78 A;  2XEU A;  4KV4 A;  4GNG A;  5DKC A;  5E9Y A;  3D7C A;  3SVF A;  4NRA A;  3PHD A;  5A5O A;  4QSW A;  2FUI A;  3KV6 A;  5ACY A;  4E96 A;  4O70 A;  3UVD A;  4GNF A;  2F6N A;  4LZS A;  4RVR A;  4MR5 A;  4NR6 A;  4N3W A;  4YYG A;  3RTR B;  3U5J A;  3UV4 A;  2YUR A;  3EB5 A;  4IR5 A;  5A5S A;  3O7A A;  3T6R A;  5EV9 A;  1VFY A;  4A4B A;  3TLP A;  4J3I A;  5E9M A;  2YDW A;  3G0J A;  5FE7 A;  5IBN A;  4PS5 A;  2PUY A;  5AIT A;  5LVQ A;  5HEM A;  4UIU A;  3ZVZ B;  5I3L A;  1ZS5 A;  5CUA A;  5FFV A;  1N87 A;  5G4R A;  5L98 A;  3M63 A;  2IDA A;  3HCT A;  2RNY A;  4TZ8 A;  4ZQL A;  1JM7 B;  1E4U A;  4HXM A;  4HXP A;  2OXQ C;  2LXH C;  2YU4 A;  4A9K A;  2M1R A;  4A9M A;  3C6W A;  2KTB B;  2RS9 B;  5H1T A;  4YAT A;  3RPG C;  4FK5 A;  4QUU A;  5A5P A;  4YH4 A;  3U5O A;  2YQL A;  5D3N A;  1VD4 A;  4B86 C;  5CQ6 A;  5ENG A;  4OGI A;  2MA5 A;  2F6J A;  4YYI A;  5LKU A;  4MEP A;  5FH7 A;  5TDW A;  2QIZ A;  2R0Y A;  4QEV A;  5E74 A;  5I83 A;  4XYA A;  3T7L A;  3SOW A;  4O7F A;  5LUU A;  5HRV A;  5A81 A;  2JMJ A;  4V3L C;  2H0D B;  3ZYQ A;  3Q2F A;  4NXJ A;  4UYD A;  5D3L A;  4YY6 A;  3N9Q A;  4HBX A;  2K4D A;  4IC2 A;  2LDR A;  2DVR A;  3HMH A;  5C8G A;  5CRM A;  5CUE A;  2YT5 A;  2LGK A;  1CHC A;  5B8D A;  4LR6 A;  4AUQ B;  5ENH A;  5DW1 A;  3QZV A;  3QZT A;  1DVP A;  4NUD A;  5FE8 A;  2YQM A;  3O36 A;  4QSS A;  5CFW A;  2RFJ A;  2YSJ A;  4S3O B;  4HXO A;  4XY9 A;  2R0S A;  2JRJ A;  4UIZ A;  4C66 A;  4FIP A;  5D25 A;  2H60 A;  4YYK A;  5HCL A;  5CRZ A;  5I88 A;  3C5K A;  2VPE A;  5IGN A;  4AYC B;  3PUR A;  4O76 A;  3U5N A;  3FKM X;  5CQ5 A;  2XB1 A;  4GND A;  2YRE A;  1JM4 B;  3ZVY A;  5CS8 A;  4LRG A;  4MR6 A;  4WA6 A;  4A9F A;  2VPG A;  4MSX A;  2CSZ A;  5F25 A;  5CGP A;  4A9H A;  5HQ5 A;  5I89 A;  2KWK A;  2I50 A;  4QYD A;  2D9E A;  5F2P A;  4Y03 A;  2MT5 A;  4Z6I A;  2MD7 B;  4LLB A;  5I7X A;  4TKP B;  3MUK A;  4NQM A;  4CUU A;  2L80 A;  2RSD A;  3HTK C;  4GPJ A;  2E6R A;  3MB3 A;  5DYX A;  4O7E A;  5EWH A;  4QEU A;  5DYU A;  3UV5 A;  5CQA A;  1VYX A;  4P5O B;  4WIV A;  4NUE A;  5LJ0 A;  4BW4 A;  4MR3 A;  2L5U A;  2L75 A;  5FH8 A;  4IOQ A;  4O75 A;  5BT5 A;  4FJC A;  4Q6F A;  4QSP A;  3DPL R;  4TS8 A;  4MEQ A;  2D82 A;  4TU4 A;  5EU1 A;  5F60 A;  5CQ8 A;  2CKL B;  2VPD A;  4I7B A;  3MUL A;  5CY9 A;  2LQ6 A;  5F62 A;  4UYG A;  5CP5 A;  4Q0O A;  5ENF A;  2L84 A;  2D8S A;  2FUU A;  5AD2 A;  3P1C A;  4CFK A;  2VJF A;  4QF2 A;  5F3A A;  2E7O A;  4BJX A;  5D3H A;  3SVG A;  2BAY A;  2WP2 A;  3Q2E A;  2OO1 A;  3JVL A;  5E3G A;  4QBM A;  3I3J A;  5ETB A;  2MIQ A;  4LKA A;  3L1Z B;  4F52 B;  5G04 B;  4YYM A;  5CQ4 A;  5A5R A;  5FE3 A;  5KTW A;  2EGP A;  4CCG X;  4NS5 A;  4YBT A;  3O35 A;  4QSR A;  5FE4 A;  1MM2 A;  1FBV A;  2M85 A;  3V43 A;  5BT4 A;  4UIW A;  4YYN A;  3ZTG A;  5D3P A;  4CUR A;  2LN0 A;  5H85 A;  4J1P A;  4IC3 A;  4NR8 A;  3SVH A;  3AQA A;  4XI1 A;  5II2 A;  2R10 A;  3JVJ A;  3MHH A;  3MHS A;  5H1V A;  3I2D A;  3UVY A;  5FEY A;  4L7X A;  2HDP A;  3GV4 A;  3SHB A;  2MA6 A;  4BW3 A;  4NR4 A;  4NYV A;  5EK9 A;  4LYI A;  5C4Q A;  5KH9 A;  5CQ3 A;  5IGM A;  1F62 A;  3LQI A;  5TDR A;  3KV5 A;  2RI7 A;  1Z60 A;  4W4U A;  4A49 A;  2KGG A;  5JI8 A;  5DYA A;  1BOR A;  5D3S A;  5A5Q A;  4QB3 A;  2YUC A;  5DKA A;  4R7E A;  5DY7 A;  1V87 A;  4A9N A;  2LGG A;  3P5O A;  4BBQ A;  4NR7 A;  5TB6 A;  2LSP B;  4YH3 A;  5LJ1 A;  4UIT A;  4IOO A;  2C2V S;  5FG6 A;  4AKN A;  4Z6H A;  2KGI A;  3KQI A;  4N4I A;  2Y1N A;  2Y43 A;  4QSQ A;  1WUM A;  4IR6 A;  3S91 A;  4C9Z A;  5CU8 A;  5C89 A;  3L1X A;  1HYI A;  4NRB A;  1T1H A;  5EA1 A;  2CT2 A;  4IR3 A;  2LRI C;  5EWC A;  5I1Q A;  4IOR A;  4QST A;  3QZS A;  4XUA A;  5EP7 A;  5HQ7 A;  4CFL A;  2L43 A;  4Z1S A;  4X2I A;  2MD8 C;  2YEM A;  5KHM A;  5CQ7 A;  5ENE A;  4A9I A;  5D24 A;  4L58 A;  5C7N A;  4ALG A;  5K29 A;  1WEU A;  5ETD A;  3M62 A;  3HME A;  4AVX A;  5G4S A;  1Z2Q A;  4QR5 A;  5EIS A;  4OUF A;  1JM7 A;  5FH6 A;  2ECI A;  4TT2 A;  4WZ3 B;  5ENB A;  2LGV A;  5FE9 A;  4QNS A;  2QJ0 A;  5H1U A;  5KH7 A;  3P1E A;  4CA1 A;  4I7C A;  2KFT A;  1WEV A;  4FLP A;  5E9I A;  2LV9 A;  5ENJ A;  3LRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...