1E4UA

N-terminal ring finger domain of human not-4
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the C4C4 Ring Finger of Human not4 Reveals Features Distinct from Those of C3Hc4 Ring Fingers
pubmed doi rcsb
molecule keywords TRANSCRIPTIONAL REPRESSOR NOT4
molecule tags Gene regulation
source organism Homo sapiens
total genus 4
structure length 78
sequence length 78
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14570 zf-RING_4 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1e4uA00
3ZPV1 2JRJA 5D1MB 2YQLA 2M85A 1K2FA 3U5MA 2KGIA 2FUUA 4L7XA 2PNXA 3U5NA 4PPEA 2L0BA 4YC9A 3ZNIA 2L43A 2MNYA 5KH3A 1RMDA 2XB1A 1MM3A 2VJFB 2L5UA 2H0DB 2ECNA 2IDAA 1Z2QA 3HCUA 5LKTA 5EYAF 3IHPA 3O36A 2CKLA 4UI9B 5LKZA 4FJCA 5FB1A 1WEEA 2YQMA 1JM7B 3V43A 4GNDA 3SOXA 2VJEA 3U5PA 1WEOA 5H9MA 3N9MA 3ZTGA 5B8DA 2MA6A 4AYCA 2E6RA 2VPDA 1WGMA 5G04B 1WFKA 2YW8A 5TDRA 4WZ0A 2LQ6A 1X4UA 2KYUA 4O64A 2G43A 4MSXA 5G0FA 3M63A 2K1JA 2JMIA 2NAAA 2M1RA 2HDPA 2KWNA 5H1VA 4YADA 1WEMA 2I50A 4FO9A 1Z6UA 2YU4A 2KFTA 2LXPC 4CA1A 5D1LB 4WA6A 2LGKA 2L80A 3GV4A 4PTBA 2QJ0A 2LGLA 5I3LA 2VPEA 4WZ3B 5TABA 5DKAA 4IC3A 5KH7A 1BORA 4Q6FA 3RPGB 2KR4A 3ZVYA 5FERA 2LV9A 3N9LA 1U6GB 1WENA 1WEPA 1X4IA 3O34A 1WEQA 4NN2A 5J3XA 4LK9A 4AVXA 2YUCA 2LDRA 5KH9A 2MUMA 4YABA 4I7DA 1ZBDB 2ECJA 1LDKC 4A4CA 3EB5A 4UP0A 5H1UA 3GL6A 2F6NA 4R8PK 3HTKC 4LADB 2VPBA 2VJFA 2MIQA 2H0DA 4A49A 3FL2A 2ECIA 4R7EA 2Y43A 2YURA 2HYED 3NG2A 4W4UA 5TDWA 3O70A 2E6SA 3T7LA 2K16A 3O37A 5JG6A 2CSYA 1JM7A 4YBMA 4ZQLA 3N9QA 2YREA 4C9ZA 3RTRB 3N9PA 3VK6A 1WEWA 1WILA 4MVTA 2YSMA 2UZGA 2AN6A 4S3OB 2EA6A 3N9NA 4FIPA 1HYIA 2F42A 5TRBA 1WESA 3ASLA 4QF2A 1T1HA 1WEVA 4L58A 3LQJA 5AIUA 5DINA 2CT2A 2M3HA 3L1ZB 3HCSA 2Y1MA 2MD7B 3L1XA 1WIMA 1FBVA 2KGGA 1JOCA 2JMJA 2PUYA 4ZDTA 2KWJA 4AP4A 3C5KA 4I7CA 4UP5A 2MT5A 1DVPA 4A4BA 2D8SA 2C2VS 2YSJA 2YHNA 3DQVR 1HYJA 3EB6A 3U5OA 2QIZA 4YAXA 2LRIC 4GNFA 4B7YC 2YHOA 5B78A 5FB0A 4N3WA 5TBNA 4F52B 2F6JA 2EODA 2LXHC 2LGVA 2BAYA 3RPGC 4IC2A 2FUIA 2MA5A 2G6QA 3C6WA 1VD4A 2JMDA 3I2DA 1E4UA 2ECVA 1CHCA 2K4DA 3O33A 1FP0A 5FEYA 3M99A 3O35A 4ZUXU 2ECGA 4TKPB 3SOWA 2MNZA 3LQHA 2G45A 1WEUA 4N4FA 5G05B 5LKUA 3MHSA 1VFYA 4YBSA 2LGGA 3ZVZB 4B86C 5C13A 3DPLR 3L11A 1V87A 2VP7A 2MD8C 1WE9A 5B76A 5LCWB 2KIZA 4LLBA 1XWHA 1LDJB 4V3KC 2L75A 3PURA 2KWOA 1F62A 4AUQB 4X3GA 3KQIA 2Y1NA 2ECTA 1VYXA 2KREA 4LJNA 2EGPA 2CKLB 4QF3A 4BBQA 4GNGA 2QICA 2M6MA 1Z60A 4S3OC 4BHWA 2VJEB 3SHBA 2OXQC 3T6RA 4GNEA 3LQIA 3HCTA 2ECWA 2K17A 2VNFA 4I7BA 3KV5A 4AYCB 4CCGX 3MHHA 5B77A 3O7AA 3QZVA 5C11A 2ZETC 3PUQA 2DX8A 2VPGA 5B79A 3KNVA 4P5OB 1N87A 2RSDA 2C2LA 1MM2A 4YATA 4R2YA 3ZYQA 4V3LC 4A0CD 3N9OA 1X4JA 4WZ2A 5LKXA 5B75A 3ZPVE 5H1TA 4FK5A 1G25A 2FSAA 2KU3A 4GB0A 3SOUA 2RI7A 3M62A 3LRQA 2YYRA 5D1KB 2KWKA 2LN0A 2XEUA 2YT5A 3KV6A 1IYMA 4YBTA 4XI1A 2KE1A 5AITA 3PHDA 2CSZA 4LKAA
chains in the Genus database with same CATH superfamily
3ZPV1 2CSVA 2JRJA 5D1MB 2YQLA 2M85A 1K2FA 3U5MA 3LJUX 5SVYA 2KGIA 4Z0OA 4Z0RA 2FUUA 4L7XA 2PNXA 3U5NA 4PPEA 2L0BA 4YC9A 3ZNIA 2L43A 4OGCA 2MNYA 5KH3A 1RMDA 2XB1A 1MM3A 2VJFB 2L5UA 2H0DB 3DWDA 2ECNA 2IDAA 1Z2QA 2KKXA 3HCUA 5LKTA 5EYAF 3IHPA 3O36A 2CKLA 4UI9B 5LKZA 2XP0A 4FJCA 5FB1A 1WEEA 2YQMA 1JM7B 3V43A 4GNDA 3SOXA 2P57A 2VJEA 3U5PA 1WEOA 5H9MA 3N9MA 3ZTGA 3LVRE 5B8DA 2MA6A 4AYCA 2E6RA 2VPDA 1WGMA 4O62A 5G04B 1WFKA 2YW8A 5TDRA 4WZ0A 2LQ6A 1X4UA 2KYUA 4O64A 2G43A 4MSXA 5G0FA 3E2DA 3M63A 2K1JA 2JMIA 2NAAA 3O47A 2M1RA 5SVIB 2HDPA 2KWNA 5H1VA 4YADA 2RR4A 1WEMA 2I50A 4FO9A 1Z6UA 2YU4A 2KFTA 2LXPC 4CA1A 5D1LB 4WA6A 2LGKA 2L80A 3GV4A 4PTBA 2QJ0A 2LGLA 5I3LA 2VPEA 4WZ3B 5TABA 5DKAA 4IC3A 5KH7A 1BORA 4Q6FA 2E61A 3RPGB 2KR4A 3ZVYA 5FERA 2LV9A 3N9LA 1U6GB 1WENA 1WEPA 1X4IA 3O34A 2XOZA 1WEQA 4NN2A 5J3XA 2YVRA 2FD4A 4LK9A 2JUNA 4AVXA 2YUCA 2LDRA 5KH9A 3FANA 2MUMA 2D8UA 2EGMA 4YABA 4I7DA 1ZBDB 2ECJA 1LDKC 4A4CA 3EB5A 4UP0A 5H1UA 3GL6A 2F6NA 4R8PK 2DSMA 3HTKC 4LADB 2VPBA 2VJFA 2L7PA 2MIQA 2H0DA 4A49A 2IQJA 3FL2A 3H7HA 2ECIA 2CONA 4R7EA 2Y43A 2YURA 3DDTA 2HYED 3NG2A 4W4UA 5TDWA 3O70A 3M7KA 2E6SA 3T7LA 2K16A 3O37A 5JG6A 2CSYA 1JM7A 4YBMA 4ZQLA 3N9QA 3PLWA 2YREA 4C9ZA 3RTRB 3N9PA 3VK6A 1WEWA 2M13A 1WILA 2CRWA 4MVTA 2YSMA 2UZGA 2AN6A 4S3OB 2EA6A 3N9NA 4FIPA 1HYIA 2F42A 5TRBA 1WESA 3ASLA 4QF2A 1T1HA 1WEVA 4L58A 2EXUA 3LQJA 5AIUA 5DINA 2CT2A 2M3HA 3L1ZB 3HCSA 2Y1MA 2MD7B 4H9DA 3L1XA 1WIMA 1FBVA 3LVQE 2KGGA 1JOCA 2JMJA 2CRRA 2PUYA 4ZDTA 2KWJA 5SVIA 4AP4A 3C5KA 4I7CA 4UP5A 2MT5A 3JUEA 1DVPA 4A4BA 2D8SA 2C2VS 2YSJA 2YHNA 3DQVR 2DJAA 3Q1DA 3KDEC 1HYJA 3EB6A 3U5OA 2QIZA 4YAXA 2B0OE 2LRIC 4GNFA 4B7YC 2YHOA 5B78A 5FB0A 4N3WA 5TBNA 4F52B 2F6JA 3FM8C 2EODA 2LXHC 2LGVA 2BAYA 2MKEA 3RPGC 4IC2A 2FUIA 2MA5A 2G6QA 3C6WA 1VD4A 2JMDA 2XOCA 3I2DA 1E4UA 2ECVA 1CHCA 2K4DA 3O33A 2XOYA 1FP0A 5FEYA 3M99A 3O35A 4ZUXU 2ECGA 4TKPB 3SOWA 2MNZA 3LQHA 2G45A 1WEUA 4N4FA 5G05B 5LKUA 3MHSA 1VFYA 4YBSA 2LGGA 3ZVZB 4B86C 5C13A 3DPLR 3L11A 1V87A 2VP7A 2MD8C 5K3QA 1WE9A 5B76A 5LCWB 2KIZA 4LLBA 3SUBA 1XWHA 1LDJB 1DCQA 4V3KC 2L75A 3PURA 2KWOA 1F62A 4AUQB 1MBMA 2KKYA 4X3GA 3KQIA 2Y1NA 2ECTA 1VYXA 2KREA 4LJNA 2EGPA 2CKLB 4QF3A 4BBQA 2JM3A 4QQ4A 4F1PA 4GNGA 2QICA 2M6MA 1Z60A 4S3OC 4OGEA 4BHWA 2OWAA 2VJEB 3SHBA 2OXQC 3T6RA 4GNEA 3LQIA 3HCTA 2ECWA 2K17A 2VNFA 4I7BA 3KV5A 4AYCB 4CCGX 3MHHA 5B77A 3FEHA 3O7AA 3QZVA 5C11A 2ZETC 3PUQA 2DX8A 2VPGA 3MDBC 5B79A 5SVXA 3KNVA 4P5OB 1N87A 2RSDA 2C2LA 1MM2A 4YATA 4R2YA 3ZYQA 4V3LC 4A0CD 3N9OA 1X4JA 4WZ2A 5LKXA 3T9KA 5B75A 3ZPVE 5H1TA 4FK5A 1G25A 2LAUA 2FSAA 2KU3A 4GB0A 3SOUA 2RI7A 3M62A 3LDYA 3LRQA 2YYRA 5D1KB 2KWKA 2LN0A 2XEUA 2YT5A 3KV6A 1IYMA 4YBTA 4XI1A 2KE1A 2FFWA 5AITA 3FJUB 3PHDA 2CSZA 4LKAA 3FAOA
chains in the Genus database with same CATH topology
3ZPV1 2JRJA 5D1MB 2YQLA 2M85A 1K2FA 3U5MA 2KGIA 2FUUA 4L7XA 2PNXA 3U5NA 4PPEA 2L0BA 4YC9A 3ZNIA 2L43A 2MNYA 5KH3A 1RMDA 2XB1A 1MM3A 2VJFB 2L5UA 2H0DB 2ECNA 2IDAA 1Z2QA 3HCUA 5LKTA 5EYAF 3IHPA 3O36A 2CKLA 4UI9B 5LKZA 4FJCA 5FB1A 1WEEA 2YQMA 1JM7B 3V43A 4GNDA 3SOXA 2VJEA 3U5PA 1WEOA 5H9MA 3N9MA 3ZTGA 5B8DA 2MA6A 4AYCA 2E6RA 2VPDA 1WGMA 5G04B 1WFKA 2YW8A 5TDRA 4WZ0A 2LQ6A 1X4UA 2KYUA 4O64A 2G43A 4MSXA 5G0FA 3M63A 2K1JA 2JMIA 2NAAA 2M1RA 2HDPA 2KWNA 5H1VA 4YADA 1WEMA 2I50A 4FO9A 1Z6UA 2YU4A 2KFTA 2LXPC 4CA1A 5D1LB 4WA6A 2LGKA 2L80A 3GV4A 4PTBA 2QJ0A 2LGLA 5I3LA 2VPEA 4WZ3B 5TABA 5DKAA 4IC3A 5KH7A 1BORA 4Q6FA 3RPGB 2KR4A 3ZVYA 5FERA 2LV9A 3N9LA 1U6GB 1WENA 1WEPA 1X4IA 3O34A 1WEQA 4NN2A 5J3XA 4LK9A 4AVXA 2YUCA 2LDRA 5KH9A 2MUMA 4YABA 4I7DA 1ZBDB 2ECJA 1LDKC 4A4CA 3EB5A 4UP0A 5H1UA 3GL6A 2F6NA 4R8PK 3HTKC 4LADB 2VPBA 2VJFA 2MIQA 2H0DA 4A49A 3FL2A 2ECIA 4R7EA 2Y43A 2YURA 2HYED 3NG2A 4W4UA 5TDWA 3O70A 2E6SA 3T7LA 2K16A 3O37A 5JG6A 2CSYA 1JM7A 4YBMA 4ZQLA 3N9QA 2YREA 4C9ZA 3RTRB 3N9PA 3VK6A 1WEWA 1WILA 4MVTA 2YSMA 2UZGA 2AN6A 4S3OB 2EA6A 3N9NA 4FIPA 1HYIA 2F42A 5TRBA 1WESA 3ASLA 4QF2A 1T1HA 1WEVA 4L58A 3LQJA 5AIUA 5DINA 2CT2A 2M3HA 3L1ZB 3HCSA 2Y1MA 2MD7B 3L1XA 1WIMA 1FBVA 2KGGA 1JOCA 2JMJA 2PUYA 4ZDTA 2KWJA 4AP4A 3C5KA 4I7CA 4UP5A 2MT5A 1DVPA 4A4BA 2D8SA 2C2VS 2YSJA 2YHNA 3DQVR 1HYJA 3EB6A 3U5OA 2QIZA 4YAXA 2LRIC 4GNFA 4B7YC 2YHOA 5B78A 5FB0A 4N3WA 5TBNA 4F52B 2F6JA 2EODA 2LXHC 2LGVA 2BAYA 3RPGC 4IC2A 2FUIA 2MA5A 2G6QA 3C6WA 1VD4A 2JMDA 3I2DA 1E4UA 2ECVA 1CHCA 2K4DA 3O33A 1FP0A 5FEYA 3M99A 3O35A 4ZUXU 2ECGA 4TKPB 3SOWA 2MNZA 3LQHA 2G45A 1WEUA 4N4FA 5G05B 5LKUA 3MHSA 1VFYA 4YBSA 2LGGA 3ZVZB 4B86C 5C13A 3DPLR 3L11A 1V87A 2VP7A 2MD8C 1WE9A 5B76A 5LCWB 2KIZA 4LLBA 1XWHA 1LDJB 4V3KC 2L75A 3PURA 2KWOA 1F62A 4AUQB 4X3GA 3KQIA 2Y1NA 2ECTA 1VYXA 2KREA 4LJNA 2EGPA 2CKLB 4QF3A 4BBQA 4GNGA 2QICA 2M6MA 1Z60A 4S3OC 4BHWA 2VJEB 3SHBA 2OXQC 3T6RA 4GNEA 3LQIA 3HCTA 2ECWA 2K17A 2VNFA 4I7BA 3KV5A 4AYCB 4CCGX 3MHHA 5B77A 3O7AA 3QZVA 5C11A 2ZETC 3PUQA 2DX8A 2VPGA 5B79A 3KNVA 4P5OB 1N87A 2RSDA 2C2LA 1MM2A 4YATA 4R2YA 3ZYQA 4V3LC 4A0CD 3N9OA 1X4JA 4WZ2A 5LKXA 5B75A 3ZPVE 5H1TA 4FK5A 1G25A 2FSAA 2KU3A 4GB0A 3SOUA 2RI7A 3M62A 3LRQA 2YYRA 5D1KB 2KWKA 2LN0A 2XEUA 2YT5A 3KV6A 1IYMA 4YBTA 4XI1A 2KE1A 5AITA 3PHDA 2CSZA 4LKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZPV 1;  2JRJ A;  5D1M B;  2YQL A;  2M85 A;  1K2F A;  3U5M A;  2KGI A;  2FUU A;  4L7X A;  2PNX A;  3U5N A;  4PPE A;  2L0B A;  4YC9 A;  3ZNI A;  2L43 A;  2MNY A;  5KH3 A;  1RMD A;  2XB1 A;  1MM3 A;  2VJF B;  2L5U A;  2H0D B;  2ECN A;  2IDA A;  1Z2Q A;  3HCU A;  5LKT A;  5EYA F;  3IHP A;  3O36 A;  2CKL A;  4UI9 B;  5LKZ A;  4FJC A;  5FB1 A;  1WEE A;  2YQM A;  1JM7 B;  3V43 A;  4GND A;  3SOX A;  2VJE A;  3U5P A;  1WEO A;  5H9M A;  3N9M A;  3ZTG A;  5B8D A;  2MA6 A;  4AYC A;  2E6R A;  2VPD A;  1WGM A;  5G04 B;  1WFK A;  2YW8 A;  5TDR A;  4WZ0 A;  2LQ6 A;  1X4U A;  2KYU A;  4O64 A;  2G43 A;  4MSX A;  5G0F A;  3M63 A;  2K1J A;  2JMI A;  2NAA A;  2M1R A;  2HDP A;  2KWN A;  5H1V A;  4YAD A;  1WEM A;  2I50 A;  4FO9 A;  1Z6U A;  2YU4 A;  2KFT A;  2LXP C;  4CA1 A;  5D1L B;  4WA6 A;  2LGK A;  2L80 A;  3GV4 A;  4PTB A;  2QJ0 A;  2LGL A;  5I3L A;  2VPE A;  4WZ3 B;  5TAB A;  5DKA A;  4IC3 A;  5KH7 A;  1BOR A;  4Q6F A;  3RPG B;  2KR4 A;  3ZVY A;  5FER A;  2LV9 A;  3N9L A;  1U6G B;  1WEN A;  1WEP A;  1X4I A;  3O34 A;  1WEQ A;  4NN2 A;  5J3X A;  4LK9 A;  4AVX A;  2YUC A;  2LDR A;  5KH9 A;  2MUM A;  4YAB A;  4I7D A;  1ZBD B;  2ECJ A;  1LDK C;  4A4C A;  3EB5 A;  4UP0 A;  5H1U A;  3GL6 A;  2F6N A;  4R8P K;  3HTK C;  4LAD B;  2VPB A;  2VJF A;  2MIQ A;  2H0D A;  4A49 A;  3FL2 A;  2ECI A;  4R7E A;  2Y43 A;  2YUR A;  2HYE D;  3NG2 A;  4W4U A;  5TDW A;  3O70 A;  2E6S A;  3T7L A;  2K16 A;  3O37 A;  5JG6 A;  2CSY A;  1JM7 A;  4YBM A;  4ZQL A;  3N9Q A;  2YRE A;  4C9Z A;  3RTR B;  3N9P A;  3VK6 A;  1WEW A;  1WIL A;  4MVT A;  2YSM A;  2UZG A;  2AN6 A;  4S3O B;  2EA6 A;  3N9N A;  4FIP A;  1HYI A;  2F42 A;  5TRB A;  1WES A;  3ASL A;  4QF2 A;  1T1H A;  1WEV A;  4L58 A;  3LQJ A;  5AIU A;  5DIN A;  2CT2 A;  2M3H A;  3L1Z B;  3HCS A;  2Y1M A;  2MD7 B;  3L1X A;  1WIM A;  1FBV A;  2KGG A;  1JOC A;  2JMJ A;  2PUY A;  4ZDT A;  2KWJ A;  4AP4 A;  3C5K A;  4I7C A;  4UP5 A;  2MT5 A;  1DVP A;  4A4B A;  2D8S A;  2C2V S;  2YSJ A;  2YHN A;  3DQV R;  1HYJ A;  3EB6 A;  3U5O A;  2QIZ A;  4YAX A;  2LRI C;  4GNF A;  4B7Y C;  2YHO A;  5B78 A;  5FB0 A;  4N3W A;  5TBN A;  4F52 B;  2F6J A;  2EOD A;  2LXH C;  2LGV A;  2BAY A;  3RPG C;  4IC2 A;  2FUI A;  2MA5 A;  2G6Q A;  3C6W A;  1VD4 A;  2JMD A;  3I2D A;  1E4U A;  2ECV A;  1CHC A;  2K4D A;  3O33 A;  1FP0 A;  5FEY A;  3M99 A;  3O35 A;  4ZUX U;  2ECG A;  4TKP B;  3SOW A;  2MNZ A;  3LQH A;  2G45 A;  1WEU A;  4N4F A;  5G05 B;  5LKU A;  3MHS A;  1VFY A;  4YBS A;  2LGG A;  3ZVZ B;  4B86 C;  5C13 A;  3DPL R;  3L11 A;  1V87 A;  2VP7 A;  2MD8 C;  1WE9 A;  5B76 A;  5LCW B;  2KIZ A;  4LLB A;  1XWH A;  1LDJ B;  4V3K C;  2L75 A;  3PUR A;  2KWO A;  1F62 A;  4AUQ B;  4X3G A;  3KQI A;  2Y1N A;  2ECT A;  1VYX A;  2KRE A;  4LJN A;  2EGP A;  2CKL B;  4QF3 A;  4BBQ A;  4GNG A;  2QIC A;  2M6M A;  1Z60 A;  4S3O C;  4BHW A;  2VJE B;  3SHB A;  2OXQ C;  3T6R A;  4GNE A;  3LQI A;  3HCT A;  2ECW A;  2K17 A;  2VNF A;  4I7B A;  3KV5 A;  4AYC B;  4CCG X;  3MHH A;  5B77 A;  3O7A A;  3QZV A;  5C11 A;  2ZET C;  3PUQ A;  2DX8 A;  2VPG A;  5B79 A;  3KNV A;  4P5O B;  1N87 A;  2RSD A;  2C2L A;  1MM2 A;  4YAT A;  4R2Y A;  3ZYQ A;  4V3L C;  4A0C D;  3N9O A;  1X4J A;  4WZ2 A;  5LKX A;  5B75 A;  3ZPV E;  5H1T A;  4FK5 A;  1G25 A;  2FSA A;  2KU3 A;  4GB0 A;  3SOU A;  2RI7 A;  3M62 A;  3LRQ A;  2YYR A;  5D1K B;  2KWK A;  2LN0 A;  2XEU A;  2YT5 A;  3KV6 A;  1IYM A;  4YBT A;  4XI1 A;  2KE1 A;  5AIT A;  3PHD A;  2CSZ A;  4LKA A; 
#chains in the Genus database with same CATH topology
 3ZPV 1;  2CSV A;  2JRJ A;  5D1M B;  2YQL A;  2M85 A;  1K2F A;  3U5M A;  3LJU X;  5SVY A;  2KGI A;  4Z0O A;  4Z0R A;  2FUU A;  4L7X A;  2PNX A;  3U5N A;  4PPE A;  2L0B A;  4YC9 A;  3ZNI A;  2L43 A;  4OGC A;  2MNY A;  5KH3 A;  1RMD A;  2XB1 A;  1MM3 A;  2VJF B;  2L5U A;  2H0D B;  3DWD A;  2ECN A;  2IDA A;  1Z2Q A;  2KKX A;  3HCU A;  5LKT A;  5EYA F;  3IHP A;  3O36 A;  2CKL A;  4UI9 B;  5LKZ A;  2XP0 A;  4FJC A;  5FB1 A;  1WEE A;  2YQM A;  1JM7 B;  3V43 A;  4GND A;  3SOX A;  2P57 A;  2VJE A;  3U5P A;  1WEO A;  5H9M A;  3N9M A;  3ZTG A;  3LVR E;  5B8D A;  2MA6 A;  4AYC A;  2E6R A;  2VPD A;  1WGM A;  4O62 A;  5G04 B;  1WFK A;  2YW8 A;  5TDR A;  4WZ0 A;  2LQ6 A;  1X4U A;  2KYU A;  4O64 A;  2G43 A;  4MSX A;  5G0F A;  3E2D A;  3M63 A;  2K1J A;  2JMI A;  2NAA A;  3O47 A;  2M1R A;  5SVI B;  2HDP A;  2KWN A;  5H1V A;  4YAD A;  2RR4 A;  1WEM A;  2I50 A;  4FO9 A;  1Z6U A;  2YU4 A;  2KFT A;  2LXP C;  4CA1 A;  5D1L B;  4WA6 A;  2LGK A;  2L80 A;  3GV4 A;  4PTB A;  2QJ0 A;  2LGL A;  5I3L A;  2VPE A;  4WZ3 B;  5TAB A;  5DKA A;  4IC3 A;  5KH7 A;  1BOR A;  4Q6F A;  2E61 A;  3RPG B;  2KR4 A;  3ZVY A;  5FER A;  2LV9 A;  3N9L A;  1U6G B;  1WEN A;  1WEP A;  1X4I A;  3O34 A;  2XOZ A;  1WEQ A;  4NN2 A;  5J3X A;  2YVR A;  2FD4 A;  4LK9 A;  2JUN A;  4AVX A;  2YUC A;  2LDR A;  5KH9 A;  3FAN A;  2MUM A;  2D8U A;  2EGM A;  4YAB A;  4I7D A;  1ZBD B;  2ECJ A;  1LDK C;  4A4C A;  3EB5 A;  4UP0 A;  5H1U A;  3GL6 A;  2F6N A;  4R8P K;  2DSM A;  3HTK C;  4LAD B;  2VPB A;  2VJF A;  2L7P A;  2MIQ A;  2H0D A;  4A49 A;  2IQJ A;  3FL2 A;  3H7H A;  2ECI A;  2CON A;  4R7E A;  2Y43 A;  2YUR A;  3DDT A;  2HYE D;  3NG2 A;  4W4U A;  5TDW A;  3O70 A;  3M7K A;  2E6S A;  3T7L A;  2K16 A;  3O37 A;  5JG6 A;  2CSY A;  1JM7 A;  4YBM A;  4ZQL A;  3N9Q A;  3PLW A;  2YRE A;  4C9Z A;  3RTR B;  3N9P A;  3VK6 A;  1WEW A;  2M13 A;  1WIL A;  2CRW A;  4MVT A;  2YSM A;  2UZG A;  2AN6 A;  4S3O B;  2EA6 A;  3N9N A;  4FIP A;  1HYI A;  2F42 A;  5TRB A;  1WES A;  3ASL A;  4QF2 A;  1T1H A;  1WEV A;  4L58 A;  2EXU A;  3LQJ A;  5AIU A;  5DIN A;  2CT2 A;  2M3H A;  3L1Z B;  3HCS A;  2Y1M A;  2MD7 B;  4H9D A;  3L1X A;  1WIM A;  1FBV A;  3LVQ E;  2KGG A;  1JOC A;  2JMJ A;  2CRR A;  2PUY A;  4ZDT A;  2KWJ A;  5SVI A;  4AP4 A;  3C5K A;  4I7C A;  4UP5 A;  2MT5 A;  3JUE A;  1DVP A;  4A4B A;  2D8S A;  2C2V S;  2YSJ A;  2YHN A;  3DQV R;  2DJA A;  3Q1D A;  3KDE C;  1HYJ A;  3EB6 A;  3U5O A;  2QIZ A;  4YAX A;  2B0O E;  2LRI C;  4GNF A;  4B7Y C;  2YHO A;  5B78 A;  5FB0 A;  4N3W A;  5TBN A;  4F52 B;  2F6J A;  3FM8 C;  2EOD A;  2LXH C;  2LGV A;  2BAY A;  2MKE A;  3RPG C;  4IC2 A;  2FUI A;  2MA5 A;  2G6Q A;  3C6W A;  1VD4 A;  2JMD A;  2XOC A;  3I2D A;  1E4U A;  2ECV A;  1CHC A;  2K4D A;  3O33 A;  2XOY A;  1FP0 A;  5FEY A;  3M99 A;  3O35 A;  4ZUX U;  2ECG A;  4TKP B;  3SOW A;  2MNZ A;  3LQH A;  2G45 A;  1WEU A;  4N4F A;  5G05 B;  5LKU A;  3MHS A;  1VFY A;  4YBS A;  2LGG A;  3ZVZ B;  4B86 C;  5C13 A;  3DPL R;  3L11 A;  1V87 A;  2VP7 A;  2MD8 C;  5K3Q A;  1WE9 A;  5B76 A;  5LCW B;  2KIZ A;  4LLB A;  3SUB A;  1XWH A;  1LDJ B;  1DCQ A;  4V3K C;  2L75 A;  3PUR A;  2KWO A;  1F62 A;  4AUQ B;  1MBM A;  2KKY A;  4X3G A;  3KQI A;  2Y1N A;  2ECT A;  1VYX A;  2KRE A;  4LJN A;  2EGP A;  2CKL B;  4QF3 A;  4BBQ A;  2JM3 A;  4QQ4 A;  4F1P A;  4GNG A;  2QIC A;  2M6M A;  1Z60 A;  4S3O C;  4OGE A;  4BHW A;  2OWA A;  2VJE B;  3SHB A;  2OXQ C;  3T6R A;  4GNE A;  3LQI A;  3HCT A;  2ECW A;  2K17 A;  2VNF A;  4I7B A;  3KV5 A;  4AYC B;  4CCG X;  3MHH A;  5B77 A;  3FEH A;  3O7A A;  3QZV A;  5C11 A;  2ZET C;  3PUQ A;  2DX8 A;  2VPG A;  3MDB C;  5B79 A;  5SVX A;  3KNV A;  4P5O B;  1N87 A;  2RSD A;  2C2L A;  1MM2 A;  4YAT A;  4R2Y A;  3ZYQ A;  4V3L C;  4A0C D;  3N9O A;  1X4J A;  4WZ2 A;  5LKX A;  3T9K A;  5B75 A;  3ZPV E;  5H1T A;  4FK5 A;  1G25 A;  2LAU A;  2FSA A;  2KU3 A;  4GB0 A;  3SOU A;  2RI7 A;  3M62 A;  3LDY A;  3LRQ A;  2YYR A;  5D1K B;  2KWK A;  2LN0 A;  2XEU A;  2YT5 A;  3KV6 A;  1IYM A;  4YBT A;  4XI1 A;  2KE1 A;  2FFW A;  5AIT A;  3FJU B;  3PHD A;  2CSZ A;  4LKA A;  3FAO A; 
#chains in the Genus database with same CATH homology
 3ZPV 1;  2JRJ A;  5D1M B;  2YQL A;  2M85 A;  1K2F A;  3U5M A;  2KGI A;  2FUU A;  4L7X A;  2PNX A;  3U5N A;  4PPE A;  2L0B A;  4YC9 A;  3ZNI A;  2L43 A;  2MNY A;  5KH3 A;  1RMD A;  2XB1 A;  1MM3 A;  2VJF B;  2L5U A;  2H0D B;  2ECN A;  2IDA A;  1Z2Q A;  3HCU A;  5LKT A;  5EYA F;  3IHP A;  3O36 A;  2CKL A;  4UI9 B;  5LKZ A;  4FJC A;  5FB1 A;  1WEE A;  2YQM A;  1JM7 B;  3V43 A;  4GND A;  3SOX A;  2VJE A;  3U5P A;  1WEO A;  5H9M A;  3N9M A;  3ZTG A;  5B8D A;  2MA6 A;  4AYC A;  2E6R A;  2VPD A;  1WGM A;  5G04 B;  1WFK A;  2YW8 A;  5TDR A;  4WZ0 A;  2LQ6 A;  1X4U A;  2KYU A;  4O64 A;  2G43 A;  4MSX A;  5G0F A;  3M63 A;  2K1J A;  2JMI A;  2NAA A;  2M1R A;  2HDP A;  2KWN A;  5H1V A;  4YAD A;  1WEM A;  2I50 A;  4FO9 A;  1Z6U A;  2YU4 A;  2KFT A;  2LXP C;  4CA1 A;  5D1L B;  4WA6 A;  2LGK A;  2L80 A;  3GV4 A;  4PTB A;  2QJ0 A;  2LGL A;  5I3L A;  2VPE A;  4WZ3 B;  5TAB A;  5DKA A;  4IC3 A;  5KH7 A;  1BOR A;  4Q6F A;  3RPG B;  2KR4 A;  3ZVY A;  5FER A;  2LV9 A;  3N9L A;  1U6G B;  1WEN A;  1WEP A;  1X4I A;  3O34 A;  1WEQ A;  4NN2 A;  5J3X A;  4LK9 A;  4AVX A;  2YUC A;  2LDR A;  5KH9 A;  2MUM A;  4YAB A;  4I7D A;  1ZBD B;  2ECJ A;  1LDK C;  4A4C A;  3EB5 A;  4UP0 A;  5H1U A;  3GL6 A;  2F6N A;  4R8P K;  3HTK C;  4LAD B;  2VPB A;  2VJF A;  2MIQ A;  2H0D A;  4A49 A;  3FL2 A;  2ECI A;  4R7E A;  2Y43 A;  2YUR A;  2HYE D;  3NG2 A;  4W4U A;  5TDW A;  3O70 A;  2E6S A;  3T7L A;  2K16 A;  3O37 A;  5JG6 A;  2CSY A;  1JM7 A;  4YBM A;  4ZQL A;  3N9Q A;  2YRE A;  4C9Z A;  3RTR B;  3N9P A;  3VK6 A;  1WEW A;  1WIL A;  4MVT A;  2YSM A;  2UZG A;  2AN6 A;  4S3O B;  2EA6 A;  3N9N A;  4FIP A;  1HYI A;  2F42 A;  5TRB A;  1WES A;  3ASL A;  4QF2 A;  1T1H A;  1WEV A;  4L58 A;  3LQJ A;  5AIU A;  5DIN A;  2CT2 A;  2M3H A;  3L1Z B;  3HCS A;  2Y1M A;  2MD7 B;  3L1X A;  1WIM A;  1FBV A;  2KGG A;  1JOC A;  2JMJ A;  2PUY A;  4ZDT A;  2KWJ A;  4AP4 A;  3C5K A;  4I7C A;  4UP5 A;  2MT5 A;  1DVP A;  4A4B A;  2D8S A;  2C2V S;  2YSJ A;  2YHN A;  3DQV R;  1HYJ A;  3EB6 A;  3U5O A;  2QIZ A;  4YAX A;  2LRI C;  4GNF A;  4B7Y C;  2YHO A;  5B78 A;  5FB0 A;  4N3W A;  5TBN A;  4F52 B;  2F6J A;  2EOD A;  2LXH C;  2LGV A;  2BAY A;  3RPG C;  4IC2 A;  2FUI A;  2MA5 A;  2G6Q A;  3C6W A;  1VD4 A;  2JMD A;  3I2D A;  1E4U A;  2ECV A;  1CHC A;  2K4D A;  3O33 A;  1FP0 A;  5FEY A;  3M99 A;  3O35 A;  4ZUX U;  2ECG A;  4TKP B;  3SOW A;  2MNZ A;  3LQH A;  2G45 A;  1WEU A;  4N4F A;  5G05 B;  5LKU A;  3MHS A;  1VFY A;  4YBS A;  2LGG A;  3ZVZ B;  4B86 C;  5C13 A;  3DPL R;  3L11 A;  1V87 A;  2VP7 A;  2MD8 C;  1WE9 A;  5B76 A;  5LCW B;  2KIZ A;  4LLB A;  1XWH A;  1LDJ B;  4V3K C;  2L75 A;  3PUR A;  2KWO A;  1F62 A;  4AUQ B;  4X3G A;  3KQI A;  2Y1N A;  2ECT A;  1VYX A;  2KRE A;  4LJN A;  2EGP A;  2CKL B;  4QF3 A;  4BBQ A;  4GNG A;  2QIC A;  2M6M A;  1Z60 A;  4S3O C;  4BHW A;  2VJE B;  3SHB A;  2OXQ C;  3T6R A;  4GNE A;  3LQI A;  3HCT A;  2ECW A;  2K17 A;  2VNF A;  4I7B A;  3KV5 A;  4AYC B;  4CCG X;  3MHH A;  5B77 A;  3O7A A;  3QZV A;  5C11 A;  2ZET C;  3PUQ A;  2DX8 A;  2VPG A;  5B79 A;  3KNV A;  4P5O B;  1N87 A;  2RSD A;  2C2L A;  1MM2 A;  4YAT A;  4R2Y A;  3ZYQ A;  4V3L C;  4A0C D;  3N9O A;  1X4J A;  4WZ2 A;  5LKX A;  5B75 A;  3ZPV E;  5H1T A;  4FK5 A;  1G25 A;  2FSA A;  2KU3 A;  4GB0 A;  3SOU A;  2RI7 A;  3M62 A;  3LRQ A;  2YYR A;  5D1K B;  2KWK A;  2LN0 A;  2XEU A;  2YT5 A;  3KV6 A;  1IYM A;  4YBT A;  4XI1 A;  2KE1 A;  5AIT A;  3PHD A;  2CSZ A;  4LKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...