1G25A

Solution structure of the n-terminal domain of the human tfiih mat1 subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the N-terminal Domain of the Human TFIIH MAT1 Subunit: New Insights into the RING Finger Family
pubmed doi rcsb
molecule keywords CDK-ACTIVATING KINASE ASSEMBLY FACTOR MAT1
molecule tags Metal binding protein
source organism Homo sapiens
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2000-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17121 zf-C3HC4_5 Zinc finger, C3HC4 type (RING finger)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1g25A00
3GV4A 2Y1MA 5LKUA 1ZBDB 2LN0A 4BBQA 4UP5A 2L0BA 2MD8C 2KREA 2MNYA 2G6QA 4YATA 4GNFA 1V87A 2CSZA 2YHNA 2HYED 2LV9A 2RSDA 3DQVR 2YW8A 2LXHC 4LJNA 2MUMA 2YT5A 3M62A 1WEEA 5JG6A 3U5PA 4I7DA 3HTKC 4AP4A 5FERA 4AVXA 3ZYQA 4LLBA 2KWJA 1FP0A 4GNDA 4R8PK 3U5NA 3O33A 4X3GA 2YYRA 2H0DB 2JMIA 4N4FA 3QZVA 4CA1A 2AN6A 2KWNA 1WEOA 1HYJA 1K2FA 3ASLA 4V3KC 2C2VS 2CT2A 4YBSA 3T7LA 1WEQA 3FL2A 2FUUA 4GNGA 4A4CA 2EODA 4V3LC 1U6GB 3SHBA 2Y1NA 4AUQB 4AYCB 1N87A 3M99A 5TDWA 2G45A 2KWOA 2MD7B 5FB1A 4ZUXU 4UP0A 1HYIA 2I50A 4R2YA 2DX8A 3HCUA 4FK5A 2KWKA 3U5OA 5C13A 4O64A 4L58A 3DPLR 4L7XA 2K1JA 2YSMA 2Y43A 3KQIA 3EB6A 2D8SA 3N9MA 4GB0A 3O36A 3ZNIA 2G43A 2F42A 4P5OB 2ZETC 2JMJA 3SOWA 2QICA 2LGVA 2L5UA 5B79A 4IC2A 1T1HA 1DVPA 1WEUA 4NN2A 4LKAA 1BORA 1G25A 2YU4A 3PUQA 1WENA 3SOXA 3L1XA 5LKZA 2YQMA 2CSYA 4QF3A 3KV5A 3N9LA 3PURA 5FB0A 5B75A 5H1UA 2K16A 2EGPA 3NG2A 2F6JA 2YQLA 4WZ0A 5FEYA 3N9PA 3L11A 2KFTA 4R7EA 2LQ6A 1WFKA 2QIZA 5TRBA 2LGKA 2LGLA 2E6RA 2KR4A 1RMDA 2C2LA 4UI9B 4YC9A 1Z6UA 2M85A 3LRQA 3MHSA 5B77A 4WZ2A 4WZ3B 5I3LA 4YABA 4Q6FA 5D1MB 2VPGA 2VPEA 2L75A 2NAAA 1VD4A 3KV6A 3SOUA 2L43A 2M3HA 3LQHA 5TABA 2PNXA 2FUIA 5C11A 2K4DA 2ECVA 5G0FA 5B78A 4B7YC 4YBMA 3O34A 2UZGA 2ECIA 1X4JA 5EYAF 4QF2A 2FSAA 2VP7A 1JM7A 1Z60A 3LQIA 4PTBA 4TKPB 2CKLA 1WILA 2YHOA 4ZQLA 2LXPC 2CKLB 3O37A 4FJCA 3T6RA 4A0CD 2VJFA 2BAYA 3ZVZB 4XI1A 2VJEA 4B86C 4IC3A 3N9QA 2KYUA 1WGMA 1WEPA 1CHCA 2KGIA 1WEVA 2L80A 3V43A 2F6NA 5KH9A 5J3XA 2ECNA 3RTRB 4I7CA 5LKXA 1WEMA 5LKTA 3C5KA 4YBTA 2QJ0A 5DKAA 1XWHA 2KU3A 2IDAA 3MHHA 3C6WA 5B8DA 1IYMA 2MT5A 1FBVA 2JRJA 3RPGB 3O7AA 2ECWA 5KH7A 4N3WA 1F62A 1X4IA 2XB1A 2VPDA 5H9MA 5TBNA 5B76A 2ECGA 2MA6A 1MM3A 3ZPVE 2VPBA 2JMDA 3RPGC 4A49A 1E4UA 4S3OB 4C9ZA 2ECTA 4FIPA 5KH3A 2KIZA 3IHPA 2VNFA 3O70A 2MA5A 2XEUA 1Z2QA 4LADB 4PPEA 1WEWA 1WE9A 3N9OA 3O35A 2LGGA 2M6MA 3LQJA 4MVTA 1WIMA 3ZPV1 1X4UA 3HCTA 2H0DA 4F52B 4I7BA 4S3OC 1MM2A 3HCSA 5TDRA 3L1ZB 2HDPA 2PUYA 3ZTGA 2KE1A 5H1TA 3PHDA 2MNZA 2LRIC 2YURA 1VFYA 2RI7A 5H1VA 4ZDTA 3KNVA 4CCGX 4A4BA 1WESA 4YAXA 2YUCA 4LK9A 5AITA 4MSXA 5AIUA 4GNEA 1JOCA 5D1KB 3GL6A 3VK6A 5G04B 5DINA 1JM7B 4AYCA 2E6SA 3I2DA 2OXQC 4WA6A 4YADA 3M63A 2MIQA 2ECJA 2EA6A 2LDRA 2VJFB 1LDJB 2YREA 3U5MA 2K17A 1VYXA 4BHWA 2VJEB 4FO9A 2YSJA 5D1LB 5LCWB 2M1RA 1LDKC 5G05B 3N9NA 4W4UA 3EB5A 2KGGA 3ZVYA
chains in the Genus database with same CATH superfamily
3GV4A 2Y1MA 5LKUA 1ZBDB 2LN0A 5SVXA 2MKEA 4BBQA 4UP5A 2L0BA 2MD8C 2KREA 2MNYA 2G6QA 4YATA 4GNFA 3FAOA 1V87A 2CSZA 2YHNA 2JM3A 2KKYA 3LJUX 2HYED 2LV9A 3FANA 2RSDA 3DQVR 2YW8A 2LXHC 4LJNA 2MUMA 2YT5A 3M62A 1WEEA 5JG6A 3U5PA 4I7DA 4O62A 3HTKC 4AP4A 5FERA 4AVXA 3ZYQA 4LLBA 2KWJA 1FP0A 4GNDA 4R8PK 3U5NA 3O33A 4X3GA 2YYRA 2H0DB 2FFWA 2JMIA 4N4FA 2YVRA 3QZVA 4CA1A 3M7KA 2AN6A 2KWNA 1WEOA 1HYJA 1K2FA 3Q1DA 3ASLA 4V3KC 2C2VS 2CT2A 1MBMA 4YBSA 3T7LA 1WEQA 3FL2A 2FUUA 4GNGA 4A4CA 3LDYA 2EODA 4V3LC 1U6GB 3SHBA 3O47A 3FEHA 2Y1NA 3LVQE 4AUQB 4AYCB 1N87A 3M99A 5TDWA 2G45A 2KWOA 2MD7B 5FB1A 4ZUXU 4UP0A 1HYIA 2I50A 4R2YA 2DX8A 3HCUA 4FK5A 2JUNA 2KWKA 3U5OA 5C13A 4O64A 4L58A 3DPLR 2XOZA 4L7XA 2K1JA 2YSMA 2Y43A 3KQIA 3EB6A 2D8SA 3N9MA 4GB0A 3O36A 3ZNIA 2G43A 2F42A 2EXUA 4P5OB 2ZETC 2JMJA 3SOWA 2QICA 2LGVA 2L5UA 5B79A 4IC2A 2DJAA 5SVYA 1T1HA 1DVPA 1WEUA 4NN2A 4LKAA 1BORA 1G25A 2YU4A 3PUQA 1WENA 3DDTA 3SOXA 2CONA 3L1XA 5LKZA 2YQMA 2CSYA 3JUEA 3FM8C 4QF3A 3KV5A 3N9LA 3PURA 5FB0A 5B75A 5H1UA 2K16A 2EGPA 3NG2A 2F6JA 2YQLA 4WZ0A 3LVRE 5FEYA 3N9PA 3L11A 4Z0RA 2CSVA 2KFTA 4R7EA 2LQ6A 1WFKA 2QIZA 5TRBA 2LGKA 2LGLA 2E6RA 2KR4A 2KKXA 1RMDA 2C2LA 4UI9B 5SVIA 4YC9A 1Z6UA 2M85A 3LRQA 3MHSA 5SVIB 5B77A 4OGCA 4WZ2A 4WZ3B 5I3LA 4YABA 4Q6FA 5D1MB 2VPGA 2VPEA 2L75A 2NAAA 1VD4A 3KV6A 3SOUA 2L43A 2M3HA 3LQHA 5TABA 2PNXA 2FUIA 5K3QA 5C11A 2K4DA 2ECVA 2M13A 5G0FA 5B78A 4B7YC 4YBMA 3O34A 4Z0OA 2B0OE 2UZGA 2IQJA 2ECIA 1X4JA 2E61A 5EYAF 4QF2A 2FSAA 2VP7A 3E2DA 1JM7A 2CRWA 1Z60A 3LQIA 4PTBA 4TKPB 2CKLA 1WILA 2YHOA 4ZQLA 3SUBA 3PLWA 2LXPC 2CKLB 3O37A 4FJCA 3T6RA 4A0CD 2VJFA 2DSMA 2BAYA 3ZVZB 4XI1A 2VJEA 4B86C 4IC3A 3N9QA 1DCQA 2KYUA 1WGMA 1WEPA 1CHCA 2KGIA 1WEVA 2L80A 3V43A 2F6NA 5KH9A 5J3XA 2ECNA 2LAUA 3RTRB 4I7CA 5LKXA 1WEMA 3KDEC 5LKTA 3C5KA 4YBTA 2QJ0A 5DKAA 1XWHA 2KU3A 2IDAA 3MHHA 3C6WA 5B8DA 1IYMA 2MT5A 1FBVA 3H7HA 2JRJA 3RPGB 3O7AA 2ECWA 5KH7A 4N3WA 1F62A 2OWAA 1X4IA 2XB1A 2VPDA 4QQ4A 2CRRA 2XP0A 5H9MA 5TBNA 5B76A 2ECGA 2MA6A 1MM3A 3ZPVE 2VPBA 2JMDA 3RPGC 4A49A 1E4UA 4S3OB 4C9ZA 2ECTA 4FIPA 5KH3A 4F1PA 2KIZA 3IHPA 2VNFA 3O70A 2MA5A 4OGEA 2XEUA 1Z2QA 4LADB 4PPEA 1WEWA 1WE9A 3N9OA 3O35A 2LGGA 2M6MA 3LQJA 4MVTA 1WIMA 3ZPV1 1X4UA 3HCTA 2H0DA 4F52B 4I7BA 4S3OC 1MM2A 3HCSA 5TDRA 3DWDA 3L1ZB 2HDPA 2PUYA 3ZTGA 2KE1A 5H1TA 3PHDA 2MNZA 2LRIC 2YURA 1VFYA 2RI7A 2XOCA 2D8UA 5H1VA 4ZDTA 3KNVA 4CCGX 4A4BA 1WESA 4YAXA 2YUCA 4LK9A 5AITA 4MSXA 5AIUA 4GNEA 1JOCA 3FJUB 5D1KB 3GL6A 3VK6A 5G04B 5DINA 1JM7B 4AYCA 3MDBC 2E6SA 2RR4A 3I2DA 2OXQC 4WA6A 4YADA 3M63A 2MIQA 2ECJA 2EA6A 2LDRA 2VJFB 1LDJB 2YREA 3U5MA 2L7PA 2K17A 2XOYA 1VYXA 4BHWA 2VJEB 4FO9A 2YSJA 5D1LB 5LCWB 2M1RA 4H9DA 1LDKC 5G05B 2P57A 2EGMA 3T9KA 3N9NA 2FD4A 4W4UA 3EB5A 2KGGA 3ZVYA
chains in the Genus database with same CATH topology
3GV4A 2Y1MA 5LKUA 1ZBDB 2LN0A 4BBQA 4UP5A 2L0BA 2MD8C 2KREA 2MNYA 2G6QA 4YATA 4GNFA 1V87A 2CSZA 2YHNA 2HYED 2LV9A 2RSDA 3DQVR 2YW8A 2LXHC 4LJNA 2MUMA 2YT5A 3M62A 1WEEA 5JG6A 3U5PA 4I7DA 3HTKC 4AP4A 5FERA 4AVXA 3ZYQA 4LLBA 2KWJA 1FP0A 4GNDA 4R8PK 3U5NA 3O33A 4X3GA 2YYRA 2H0DB 2JMIA 4N4FA 3QZVA 4CA1A 2AN6A 2KWNA 1WEOA 1HYJA 1K2FA 3ASLA 4V3KC 2C2VS 2CT2A 4YBSA 3T7LA 1WEQA 3FL2A 2FUUA 4GNGA 4A4CA 2EODA 4V3LC 1U6GB 3SHBA 2Y1NA 4AUQB 4AYCB 1N87A 3M99A 5TDWA 2G45A 2KWOA 2MD7B 5FB1A 4ZUXU 4UP0A 1HYIA 2I50A 4R2YA 2DX8A 3HCUA 4FK5A 2KWKA 3U5OA 5C13A 4O64A 4L58A 3DPLR 4L7XA 2K1JA 2YSMA 2Y43A 3KQIA 3EB6A 2D8SA 3N9MA 4GB0A 3O36A 3ZNIA 2G43A 2F42A 4P5OB 2ZETC 2JMJA 3SOWA 2QICA 2LGVA 2L5UA 5B79A 4IC2A 1T1HA 1DVPA 1WEUA 4NN2A 4LKAA 1BORA 1G25A 2YU4A 3PUQA 1WENA 3SOXA 3L1XA 5LKZA 2YQMA 2CSYA 4QF3A 3KV5A 3N9LA 3PURA 5FB0A 5B75A 5H1UA 2K16A 2EGPA 3NG2A 2F6JA 2YQLA 4WZ0A 5FEYA 3N9PA 3L11A 2KFTA 4R7EA 2LQ6A 1WFKA 2QIZA 5TRBA 2LGKA 2LGLA 2E6RA 2KR4A 1RMDA 2C2LA 4UI9B 4YC9A 1Z6UA 2M85A 3LRQA 3MHSA 5B77A 4WZ2A 4WZ3B 5I3LA 4YABA 4Q6FA 5D1MB 2VPGA 2VPEA 2L75A 2NAAA 1VD4A 3KV6A 3SOUA 2L43A 2M3HA 3LQHA 5TABA 2PNXA 2FUIA 5C11A 2K4DA 2ECVA 5G0FA 5B78A 4B7YC 4YBMA 3O34A 2UZGA 2ECIA 1X4JA 5EYAF 4QF2A 2FSAA 2VP7A 1JM7A 1Z60A 3LQIA 4PTBA 4TKPB 2CKLA 1WILA 2YHOA 4ZQLA 2LXPC 2CKLB 3O37A 4FJCA 3T6RA 4A0CD 2VJFA 2BAYA 3ZVZB 4XI1A 2VJEA 4B86C 4IC3A 3N9QA 2KYUA 1WGMA 1WEPA 1CHCA 2KGIA 1WEVA 2L80A 3V43A 2F6NA 5KH9A 5J3XA 2ECNA 3RTRB 4I7CA 5LKXA 1WEMA 5LKTA 3C5KA 4YBTA 2QJ0A 5DKAA 1XWHA 2KU3A 2IDAA 3MHHA 3C6WA 5B8DA 1IYMA 2MT5A 1FBVA 2JRJA 3RPGB 3O7AA 2ECWA 5KH7A 4N3WA 1F62A 1X4IA 2XB1A 2VPDA 5H9MA 5TBNA 5B76A 2ECGA 2MA6A 1MM3A 3ZPVE 2VPBA 2JMDA 3RPGC 4A49A 1E4UA 4S3OB 4C9ZA 2ECTA 4FIPA 5KH3A 2KIZA 3IHPA 2VNFA 3O70A 2MA5A 2XEUA 1Z2QA 4LADB 4PPEA 1WEWA 1WE9A 3N9OA 3O35A 2LGGA 2M6MA 3LQJA 4MVTA 1WIMA 3ZPV1 1X4UA 3HCTA 2H0DA 4F52B 4I7BA 4S3OC 1MM2A 3HCSA 5TDRA 3L1ZB 2HDPA 2PUYA 3ZTGA 2KE1A 5H1TA 3PHDA 2MNZA 2LRIC 2YURA 1VFYA 2RI7A 5H1VA 4ZDTA 3KNVA 4CCGX 4A4BA 1WESA 4YAXA 2YUCA 4LK9A 5AITA 4MSXA 5AIUA 4GNEA 1JOCA 5D1KB 3GL6A 3VK6A 5G04B 5DINA 1JM7B 4AYCA 2E6SA 3I2DA 2OXQC 4WA6A 4YADA 3M63A 2MIQA 2ECJA 2EA6A 2LDRA 2VJFB 1LDJB 2YREA 3U5MA 2K17A 1VYXA 4BHWA 2VJEB 4FO9A 2YSJA 5D1LB 5LCWB 2M1RA 1LDKC 5G05B 3N9NA 4W4UA 3EB5A 2KGGA 3ZVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV4 A;  2Y1M A;  5LKU A;  1ZBD B;  2LN0 A;  4BBQ A;  4UP5 A;  2L0B A;  2MD8 C;  2KRE A;  2MNY A;  2G6Q A;  4YAT A;  4GNF A;  1V87 A;  2CSZ A;  2YHN A;  2HYE D;  2LV9 A;  2RSD A;  3DQV R;  2YW8 A;  2LXH C;  4LJN A;  2MUM A;  2YT5 A;  3M62 A;  1WEE A;  5JG6 A;  3U5P A;  4I7D A;  3HTK C;  4AP4 A;  5FER A;  4AVX A;  3ZYQ A;  4LLB A;  2KWJ A;  1FP0 A;  4GND A;  4R8P K;  3U5N A;  3O33 A;  4X3G A;  2YYR A;  2H0D B;  2JMI A;  4N4F A;  3QZV A;  4CA1 A;  2AN6 A;  2KWN A;  1WEO A;  1HYJ A;  1K2F A;  3ASL A;  4V3K C;  2C2V S;  2CT2 A;  4YBS A;  3T7L A;  1WEQ A;  3FL2 A;  2FUU A;  4GNG A;  4A4C A;  2EOD A;  4V3L C;  1U6G B;  3SHB A;  2Y1N A;  4AUQ B;  4AYC B;  1N87 A;  3M99 A;  5TDW A;  2G45 A;  2KWO A;  2MD7 B;  5FB1 A;  4ZUX U;  4UP0 A;  1HYI A;  2I50 A;  4R2Y A;  2DX8 A;  3HCU A;  4FK5 A;  2KWK A;  3U5O A;  5C13 A;  4O64 A;  4L58 A;  3DPL R;  4L7X A;  2K1J A;  2YSM A;  2Y43 A;  3KQI A;  3EB6 A;  2D8S A;  3N9M A;  4GB0 A;  3O36 A;  3ZNI A;  2G43 A;  2F42 A;  4P5O B;  2ZET C;  2JMJ A;  3SOW A;  2QIC A;  2LGV A;  2L5U A;  5B79 A;  4IC2 A;  1T1H A;  1DVP A;  1WEU A;  4NN2 A;  4LKA A;  1BOR A;  1G25 A;  2YU4 A;  3PUQ A;  1WEN A;  3SOX A;  3L1X A;  5LKZ A;  2YQM A;  2CSY A;  4QF3 A;  3KV5 A;  3N9L A;  3PUR A;  5FB0 A;  5B75 A;  5H1U A;  2K16 A;  2EGP A;  3NG2 A;  2F6J A;  2YQL A;  4WZ0 A;  5FEY A;  3N9P A;  3L11 A;  2KFT A;  4R7E A;  2LQ6 A;  1WFK A;  2QIZ A;  5TRB A;  2LGK A;  2LGL A;  2E6R A;  2KR4 A;  1RMD A;  2C2L A;  4UI9 B;  4YC9 A;  1Z6U A;  2M85 A;  3LRQ A;  3MHS A;  5B77 A;  4WZ2 A;  4WZ3 B;  5I3L A;  4YAB A;  4Q6F A;  5D1M B;  2VPG A;  2VPE A;  2L75 A;  2NAA A;  1VD4 A;  3KV6 A;  3SOU A;  2L43 A;  2M3H A;  3LQH A;  5TAB A;  2PNX A;  2FUI A;  5C11 A;  2K4D A;  2ECV A;  5G0F A;  5B78 A;  4B7Y C;  4YBM A;  3O34 A;  2UZG A;  2ECI A;  1X4J A;  5EYA F;  4QF2 A;  2FSA A;  2VP7 A;  1JM7 A;  1Z60 A;  3LQI A;  4PTB A;  4TKP B;  2CKL A;  1WIL A;  2YHO A;  4ZQL A;  2LXP C;  2CKL B;  3O37 A;  4FJC A;  3T6R A;  4A0C D;  2VJF A;  2BAY A;  3ZVZ B;  4XI1 A;  2VJE A;  4B86 C;  4IC3 A;  3N9Q A;  2KYU A;  1WGM A;  1WEP A;  1CHC A;  2KGI A;  1WEV A;  2L80 A;  3V43 A;  2F6N A;  5KH9 A;  5J3X A;  2ECN A;  3RTR B;  4I7C A;  5LKX A;  1WEM A;  5LKT A;  3C5K A;  4YBT A;  2QJ0 A;  5DKA A;  1XWH A;  2KU3 A;  2IDA A;  3MHH A;  3C6W A;  5B8D A;  1IYM A;  2MT5 A;  1FBV A;  2JRJ A;  3RPG B;  3O7A A;  2ECW A;  5KH7 A;  4N3W A;  1F62 A;  1X4I A;  2XB1 A;  2VPD A;  5H9M A;  5TBN A;  5B76 A;  2ECG A;  2MA6 A;  1MM3 A;  3ZPV E;  2VPB A;  2JMD A;  3RPG C;  4A49 A;  1E4U A;  4S3O B;  4C9Z A;  2ECT A;  4FIP A;  5KH3 A;  2KIZ A;  3IHP A;  2VNF A;  3O70 A;  2MA5 A;  2XEU A;  1Z2Q A;  4LAD B;  4PPE A;  1WEW A;  1WE9 A;  3N9O A;  3O35 A;  2LGG A;  2M6M A;  3LQJ A;  4MVT A;  1WIM A;  3ZPV 1;  1X4U A;  3HCT A;  2H0D A;  4F52 B;  4I7B A;  4S3O C;  1MM2 A;  3HCS A;  5TDR A;  3L1Z B;  2HDP A;  2PUY A;  3ZTG A;  2KE1 A;  5H1T A;  3PHD A;  2MNZ A;  2LRI C;  2YUR A;  1VFY A;  2RI7 A;  5H1V A;  4ZDT A;  3KNV A;  4CCG X;  4A4B A;  1WES A;  4YAX A;  2YUC A;  4LK9 A;  5AIT A;  4MSX A;  5AIU A;  4GNE A;  1JOC A;  5D1K B;  3GL6 A;  3VK6 A;  5G04 B;  5DIN A;  1JM7 B;  4AYC A;  2E6S A;  3I2D A;  2OXQ C;  4WA6 A;  4YAD A;  3M63 A;  2MIQ A;  2ECJ A;  2EA6 A;  2LDR A;  2VJF B;  1LDJ B;  2YRE A;  3U5M A;  2K17 A;  1VYX A;  4BHW A;  2VJE B;  4FO9 A;  2YSJ A;  5D1L B;  5LCW B;  2M1R A;  1LDK C;  5G05 B;  3N9N A;  4W4U A;  3EB5 A;  2KGG A;  3ZVY A; 
#chains in the Genus database with same CATH topology
 3GV4 A;  2Y1M A;  5LKU A;  1ZBD B;  2LN0 A;  5SVX A;  2MKE A;  4BBQ A;  4UP5 A;  2L0B A;  2MD8 C;  2KRE A;  2MNY A;  2G6Q A;  4YAT A;  4GNF A;  3FAO A;  1V87 A;  2CSZ A;  2YHN A;  2JM3 A;  2KKY A;  3LJU X;  2HYE D;  2LV9 A;  3FAN A;  2RSD A;  3DQV R;  2YW8 A;  2LXH C;  4LJN A;  2MUM A;  2YT5 A;  3M62 A;  1WEE A;  5JG6 A;  3U5P A;  4I7D A;  4O62 A;  3HTK C;  4AP4 A;  5FER A;  4AVX A;  3ZYQ A;  4LLB A;  2KWJ A;  1FP0 A;  4GND A;  4R8P K;  3U5N A;  3O33 A;  4X3G A;  2YYR A;  2H0D B;  2FFW A;  2JMI A;  4N4F A;  2YVR A;  3QZV A;  4CA1 A;  3M7K A;  2AN6 A;  2KWN A;  1WEO A;  1HYJ A;  1K2F A;  3Q1D A;  3ASL A;  4V3K C;  2C2V S;  2CT2 A;  1MBM A;  4YBS A;  3T7L A;  1WEQ A;  3FL2 A;  2FUU A;  4GNG A;  4A4C A;  3LDY A;  2EOD A;  4V3L C;  1U6G B;  3SHB A;  3O47 A;  3FEH A;  2Y1N A;  3LVQ E;  4AUQ B;  4AYC B;  1N87 A;  3M99 A;  5TDW A;  2G45 A;  2KWO A;  2MD7 B;  5FB1 A;  4ZUX U;  4UP0 A;  1HYI A;  2I50 A;  4R2Y A;  2DX8 A;  3HCU A;  4FK5 A;  2JUN A;  2KWK A;  3U5O A;  5C13 A;  4O64 A;  4L58 A;  3DPL R;  2XOZ A;  4L7X A;  2K1J A;  2YSM A;  2Y43 A;  3KQI A;  3EB6 A;  2D8S A;  3N9M A;  4GB0 A;  3O36 A;  3ZNI A;  2G43 A;  2F42 A;  2EXU A;  4P5O B;  2ZET C;  2JMJ A;  3SOW A;  2QIC A;  2LGV A;  2L5U A;  5B79 A;  4IC2 A;  2DJA A;  5SVY A;  1T1H A;  1DVP A;  1WEU A;  4NN2 A;  4LKA A;  1BOR A;  1G25 A;  2YU4 A;  3PUQ A;  1WEN A;  3DDT A;  3SOX A;  2CON A;  3L1X A;  5LKZ A;  2YQM A;  2CSY A;  3JUE A;  3FM8 C;  4QF3 A;  3KV5 A;  3N9L A;  3PUR A;  5FB0 A;  5B75 A;  5H1U A;  2K16 A;  2EGP A;  3NG2 A;  2F6J A;  2YQL A;  4WZ0 A;  3LVR E;  5FEY A;  3N9P A;  3L11 A;  4Z0R A;  2CSV A;  2KFT A;  4R7E A;  2LQ6 A;  1WFK A;  2QIZ A;  5TRB A;  2LGK A;  2LGL A;  2E6R A;  2KR4 A;  2KKX A;  1RMD A;  2C2L A;  4UI9 B;  5SVI A;  4YC9 A;  1Z6U A;  2M85 A;  3LRQ A;  3MHS A;  5SVI B;  5B77 A;  4OGC A;  4WZ2 A;  4WZ3 B;  5I3L A;  4YAB A;  4Q6F A;  5D1M B;  2VPG A;  2VPE A;  2L75 A;  2NAA A;  1VD4 A;  3KV6 A;  3SOU A;  2L43 A;  2M3H A;  3LQH A;  5TAB A;  2PNX A;  2FUI A;  5K3Q A;  5C11 A;  2K4D A;  2ECV A;  2M13 A;  5G0F A;  5B78 A;  4B7Y C;  4YBM A;  3O34 A;  4Z0O A;  2B0O E;  2UZG A;  2IQJ A;  2ECI A;  1X4J A;  2E61 A;  5EYA F;  4QF2 A;  2FSA A;  2VP7 A;  3E2D A;  1JM7 A;  2CRW A;  1Z60 A;  3LQI A;  4PTB A;  4TKP B;  2CKL A;  1WIL A;  2YHO A;  4ZQL A;  3SUB A;  3PLW A;  2LXP C;  2CKL B;  3O37 A;  4FJC A;  3T6R A;  4A0C D;  2VJF A;  2DSM A;  2BAY A;  3ZVZ B;  4XI1 A;  2VJE A;  4B86 C;  4IC3 A;  3N9Q A;  1DCQ A;  2KYU A;  1WGM A;  1WEP A;  1CHC A;  2KGI A;  1WEV A;  2L80 A;  3V43 A;  2F6N A;  5KH9 A;  5J3X A;  2ECN A;  2LAU A;  3RTR B;  4I7C A;  5LKX A;  1WEM A;  3KDE C;  5LKT A;  3C5K A;  4YBT A;  2QJ0 A;  5DKA A;  1XWH A;  2KU3 A;  2IDA A;  3MHH A;  3C6W A;  5B8D A;  1IYM A;  2MT5 A;  1FBV A;  3H7H A;  2JRJ A;  3RPG B;  3O7A A;  2ECW A;  5KH7 A;  4N3W A;  1F62 A;  2OWA A;  1X4I A;  2XB1 A;  2VPD A;  4QQ4 A;  2CRR A;  2XP0 A;  5H9M A;  5TBN A;  5B76 A;  2ECG A;  2MA6 A;  1MM3 A;  3ZPV E;  2VPB A;  2JMD A;  3RPG C;  4A49 A;  1E4U A;  4S3O B;  4C9Z A;  2ECT A;  4FIP A;  5KH3 A;  4F1P A;  2KIZ A;  3IHP A;  2VNF A;  3O70 A;  2MA5 A;  4OGE A;  2XEU A;  1Z2Q A;  4LAD B;  4PPE A;  1WEW A;  1WE9 A;  3N9O A;  3O35 A;  2LGG A;  2M6M A;  3LQJ A;  4MVT A;  1WIM A;  3ZPV 1;  1X4U A;  3HCT A;  2H0D A;  4F52 B;  4I7B A;  4S3O C;  1MM2 A;  3HCS A;  5TDR A;  3DWD A;  3L1Z B;  2HDP A;  2PUY A;  3ZTG A;  2KE1 A;  5H1T A;  3PHD A;  2MNZ A;  2LRI C;  2YUR A;  1VFY A;  2RI7 A;  2XOC A;  2D8U A;  5H1V A;  4ZDT A;  3KNV A;  4CCG X;  4A4B A;  1WES A;  4YAX A;  2YUC A;  4LK9 A;  5AIT A;  4MSX A;  5AIU A;  4GNE A;  1JOC A;  3FJU B;  5D1K B;  3GL6 A;  3VK6 A;  5G04 B;  5DIN A;  1JM7 B;  4AYC A;  3MDB C;  2E6S A;  2RR4 A;  3I2D A;  2OXQ C;  4WA6 A;  4YAD A;  3M63 A;  2MIQ A;  2ECJ A;  2EA6 A;  2LDR A;  2VJF B;  1LDJ B;  2YRE A;  3U5M A;  2L7P A;  2K17 A;  2XOY A;  1VYX A;  4BHW A;  2VJE B;  4FO9 A;  2YSJ A;  5D1L B;  5LCW B;  2M1R A;  4H9D A;  1LDK C;  5G05 B;  2P57 A;  2EGM A;  3T9K A;  3N9N A;  2FD4 A;  4W4U A;  3EB5 A;  2KGG A;  3ZVY A; 
#chains in the Genus database with same CATH homology
 3GV4 A;  2Y1M A;  5LKU A;  1ZBD B;  2LN0 A;  4BBQ A;  4UP5 A;  2L0B A;  2MD8 C;  2KRE A;  2MNY A;  2G6Q A;  4YAT A;  4GNF A;  1V87 A;  2CSZ A;  2YHN A;  2HYE D;  2LV9 A;  2RSD A;  3DQV R;  2YW8 A;  2LXH C;  4LJN A;  2MUM A;  2YT5 A;  3M62 A;  1WEE A;  5JG6 A;  3U5P A;  4I7D A;  3HTK C;  4AP4 A;  5FER A;  4AVX A;  3ZYQ A;  4LLB A;  2KWJ A;  1FP0 A;  4GND A;  4R8P K;  3U5N A;  3O33 A;  4X3G A;  2YYR A;  2H0D B;  2JMI A;  4N4F A;  3QZV A;  4CA1 A;  2AN6 A;  2KWN A;  1WEO A;  1HYJ A;  1K2F A;  3ASL A;  4V3K C;  2C2V S;  2CT2 A;  4YBS A;  3T7L A;  1WEQ A;  3FL2 A;  2FUU A;  4GNG A;  4A4C A;  2EOD A;  4V3L C;  1U6G B;  3SHB A;  2Y1N A;  4AUQ B;  4AYC B;  1N87 A;  3M99 A;  5TDW A;  2G45 A;  2KWO A;  2MD7 B;  5FB1 A;  4ZUX U;  4UP0 A;  1HYI A;  2I50 A;  4R2Y A;  2DX8 A;  3HCU A;  4FK5 A;  2KWK A;  3U5O A;  5C13 A;  4O64 A;  4L58 A;  3DPL R;  4L7X A;  2K1J A;  2YSM A;  2Y43 A;  3KQI A;  3EB6 A;  2D8S A;  3N9M A;  4GB0 A;  3O36 A;  3ZNI A;  2G43 A;  2F42 A;  4P5O B;  2ZET C;  2JMJ A;  3SOW A;  2QIC A;  2LGV A;  2L5U A;  5B79 A;  4IC2 A;  1T1H A;  1DVP A;  1WEU A;  4NN2 A;  4LKA A;  1BOR A;  1G25 A;  2YU4 A;  3PUQ A;  1WEN A;  3SOX A;  3L1X A;  5LKZ A;  2YQM A;  2CSY A;  4QF3 A;  3KV5 A;  3N9L A;  3PUR A;  5FB0 A;  5B75 A;  5H1U A;  2K16 A;  2EGP A;  3NG2 A;  2F6J A;  2YQL A;  4WZ0 A;  5FEY A;  3N9P A;  3L11 A;  2KFT A;  4R7E A;  2LQ6 A;  1WFK A;  2QIZ A;  5TRB A;  2LGK A;  2LGL A;  2E6R A;  2KR4 A;  1RMD A;  2C2L A;  4UI9 B;  4YC9 A;  1Z6U A;  2M85 A;  3LRQ A;  3MHS A;  5B77 A;  4WZ2 A;  4WZ3 B;  5I3L A;  4YAB A;  4Q6F A;  5D1M B;  2VPG A;  2VPE A;  2L75 A;  2NAA A;  1VD4 A;  3KV6 A;  3SOU A;  2L43 A;  2M3H A;  3LQH A;  5TAB A;  2PNX A;  2FUI A;  5C11 A;  2K4D A;  2ECV A;  5G0F A;  5B78 A;  4B7Y C;  4YBM A;  3O34 A;  2UZG A;  2ECI A;  1X4J A;  5EYA F;  4QF2 A;  2FSA A;  2VP7 A;  1JM7 A;  1Z60 A;  3LQI A;  4PTB A;  4TKP B;  2CKL A;  1WIL A;  2YHO A;  4ZQL A;  2LXP C;  2CKL B;  3O37 A;  4FJC A;  3T6R A;  4A0C D;  2VJF A;  2BAY A;  3ZVZ B;  4XI1 A;  2VJE A;  4B86 C;  4IC3 A;  3N9Q A;  2KYU A;  1WGM A;  1WEP A;  1CHC A;  2KGI A;  1WEV A;  2L80 A;  3V43 A;  2F6N A;  5KH9 A;  5J3X A;  2ECN A;  3RTR B;  4I7C A;  5LKX A;  1WEM A;  5LKT A;  3C5K A;  4YBT A;  2QJ0 A;  5DKA A;  1XWH A;  2KU3 A;  2IDA A;  3MHH A;  3C6W A;  5B8D A;  1IYM A;  2MT5 A;  1FBV A;  2JRJ A;  3RPG B;  3O7A A;  2ECW A;  5KH7 A;  4N3W A;  1F62 A;  1X4I A;  2XB1 A;  2VPD A;  5H9M A;  5TBN A;  5B76 A;  2ECG A;  2MA6 A;  1MM3 A;  3ZPV E;  2VPB A;  2JMD A;  3RPG C;  4A49 A;  1E4U A;  4S3O B;  4C9Z A;  2ECT A;  4FIP A;  5KH3 A;  2KIZ A;  3IHP A;  2VNF A;  3O70 A;  2MA5 A;  2XEU A;  1Z2Q A;  4LAD B;  4PPE A;  1WEW A;  1WE9 A;  3N9O A;  3O35 A;  2LGG A;  2M6M A;  3LQJ A;  4MVT A;  1WIM A;  3ZPV 1;  1X4U A;  3HCT A;  2H0D A;  4F52 B;  4I7B A;  4S3O C;  1MM2 A;  3HCS A;  5TDR A;  3L1Z B;  2HDP A;  2PUY A;  3ZTG A;  2KE1 A;  5H1T A;  3PHD A;  2MNZ A;  2LRI C;  2YUR A;  1VFY A;  2RI7 A;  5H1V A;  4ZDT A;  3KNV A;  4CCG X;  4A4B A;  1WES A;  4YAX A;  2YUC A;  4LK9 A;  5AIT A;  4MSX A;  5AIU A;  4GNE A;  1JOC A;  5D1K B;  3GL6 A;  3VK6 A;  5G04 B;  5DIN A;  1JM7 B;  4AYC A;  2E6S A;  3I2D A;  2OXQ C;  4WA6 A;  4YAD A;  3M63 A;  2MIQ A;  2ECJ A;  2EA6 A;  2LDR A;  2VJF B;  1LDJ B;  2YRE A;  3U5M A;  2K17 A;  1VYX A;  4BHW A;  2VJE B;  4FO9 A;  2YSJ A;  5D1L B;  5LCW B;  2M1R A;  1LDK C;  5G05 B;  3N9N A;  4W4U A;  3EB5 A;  2KGG A;  3ZVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...