1HYJA

Solution structure of the eea1 fyve domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
65
structure length
65
Chain Sequence
b'RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 4
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyjA00
1WEMA 3GL6A 4QF2A 2Y43A 5JG6A 2LDRA 2JMIA 4XI1A 4UI9B 1IYMA 3NG2A 2VP7A 3SOUA 2CT2A 2LN0A 2PUYA 4YADA 4PPEA 1U6GB 5FEYA 4AYCA 1Z6UA 1G25A 2K1JA 1WESA 3EB6A 3O35A 1WENA 3VK6A 1X4JA 3O34A 3HCSA 3SHBA 2XEUA 2BAYA 4YBSA 4A49A 2VPGA 3EB5A 2E6SA 5D1KB 1CHCA 2K16A 4GB0A 4LLBA 4ZQLA 2KU3A 5FB0A 5AIUA 4BHWA 3SOWA 5LKZA 1XWHA 4ZUXU 5D1MB 4GNEA 2LGVA 2LXHC 4X3GA 2VJFA 5H9MA 2MNYA 2KWJA 2K4DA 3ZYQA 2VJEB 2JMJA 1X4IA 2YW8A 3DQVR 1WGMA 2VPEA 1RMDA 2HYED 3ZTGA 1WEVA 2EODA 1LDKC 5KH7A 2C2VS 3MHSA 5KH9A 2ECVA 2MD7B 1WFKA 3M62A 2Y1MA 2VJFB 3ZVZB 2KFTA 5J3XA 3MHHA 2KREA 2L43A 1WEOA 5LKXA 5EYAF 2ECTA 5G05B 2L0BA 3U5OA 2CSYA 4BBQA 4A4BA 3LQHA 2VNFA 3KV5A 4IC3A 1FP0A 1LDJB 4UP5A 3L11A 3LQIA 2VPBA 1VFYA 1HYIA 4B86C 2YREA 5C13A 4R8PK 2MT5A 4UP0A 4YBMA 3N9PA 2G43A 4LK9A 4AVXA 1WE9A 2JMDA 4Q6FA 4L7XA 4IC2A 1N87A 2LQ6A 2NAAA 2ECWA 5G0FA 4GNGA 5B78A 1WEWA 5AITA 2IDAA 2YHNA 2CKLA 4NN2A 5B76A 3QZVA 2QIZA 2YHOA 4FO9A 2C2LA 4A0CD 2JRJA 2ZETC 2MUMA 2KYUA 1E4UA 3ZVYA 2F42A 2KWOA 1WEPA 5B8DA 5FB1A 3M63A 5D1LB 4AUQB 3SOXA 3N9OA 2MD8C 2K17A 3I2DA 5B75A 4TKPB 4V3KC 4AYCB 2M6MA 1F62A 2FSAA 2KWKA 1VYXA 2LGLA 1BORA 2ECGA 3L1XA 2MNZA 5B79A 4YABA 4FK5A 2LV9A 5H1VA 3ZPVE 2M3HA 4FIPA 4CA1A 2H0DA 5H1UA 2KGIA 3PHDA 4PTBA 2Y1NA 3L1ZB 3HCUA 3LQJA 3C6WA 2KR4A 1MM3A 3C5KA 4MSXA 2YQLA 4W4UA 1WIMA 2M1RA 3HTKC 2YYRA 5FERA 3N9NA 2G6QA 1FBVA 2G45A 4S3OB 1WILA 1HYJA 3N9MA 5TDRA 4C9ZA 3RPGC 5G04B 4MVTA 4N4FA 2RSDA 3V43A 3DPLR 4WZ3B 3IHPA 3T7LA 3FL2A 3N9LA 2RI7A 3O36A 2MA5A 4FJCA 2LGKA 2YSJA 2YT5A 3O7AA 4ZDTA 4YBTA 5B77A 1X4UA 4YAXA 5I3LA 3T6RA 4I7CA 3HCTA 1JM7A 4GNDA 1ZBDB 2XB1A 5LKUA 2OXQC 3U5MA 5TABA 1WEEA 4LKAA 3O33A 2LXPC 1VD4A 2LGGA 2KIZA 4WZ0A 2KGGA 2QICA 4GNFA 5KH3A 3M99A 2QJ0A 4R2YA 2KWNA 2DX8A 2HDPA 3KV6A 5C11A 3U5NA 1V87A 4S3OC 2E6RA 2VJEA 2KE1A 4WZ2A 3RPGB 4LJNA 3PURA 3O37A 4AP4A 5LKTA 3O70A 4B7YC 2YUCA 3RTRB 4I7BA 2YQMA 3KNVA 2ECJA 5TBNA 1JM7B 4LADB 2CSZA 1MM2A 4A4CA 2EGPA 2CKLB 2F6JA 3LRQA 5LCWB 2I50A 5DINA 5TDWA 4L58A 4N3WA 3ZPV1 4F52B 3ZNIA 2M85A 2ECNA 2YSMA 3PUQA 5TRBA 4YC9A 3ASLA 2ECIA 2EA6A 2YURA 1JOCA 1K2FA 4QF3A 5DKAA 1DVPA 1WEQA 4R7EA 1Z60A 4P5OB 2AN6A 4CCGX 2LRIC 2UZGA 2FUUA 5H1TA 2L75A 1T1HA 4V3LC 2MIQA 3KQIA 2L5UA 2L80A 1WEUA 4WA6A 2YU4A 2PNXA 2H0DB 4I7DA 3GV4A 2FUIA 2MA6A 4YATA 2VPDA 3U5PA 2F6NA 1Z2QA 2D8SA 3N9QA 4O64A
chains in the Genus database with same CATH superfamily
1WEMA 3GL6A 4QF2A 2Y43A 3O47A 5JG6A 2LDRA 2JUNA 2JMIA 4XI1A 4UI9B 1IYMA 3NG2A 2VP7A 3SOUA 2CT2A 2L7PA 2LN0A 2PUYA 4YADA 1MBMA 4PPEA 1U6GB 5FEYA 4AYCA 1Z6UA 1G25A 2K1JA 1WESA 2LAUA 3EB6A 3O35A 1WENA 3VK6A 1X4JA 3O34A 3HCSA 3SHBA 2XEUA 2BAYA 4YBSA 4A49A 2VPGA 3EB5A 2E6SA 5D1KB 1CHCA 2K16A 4GB0A 5SVYA 3FEHA 4LLBA 2IQJA 4ZQLA 2KU3A 5FB0A 2CRWA 5AIUA 4BHWA 4OGCA 3SOWA 5LKZA 1XWHA 4ZUXU 5D1MB 4GNEA 2LGVA 2LXHC 4X3GA 2VJFA 5H9MA 2MNYA 2KWJA 2K4DA 3ZYQA 2VJEB 2JMJA 1X4IA 2YW8A 3DQVR 1WGMA 2VPEA 4O62A 1RMDA 2HYED 3ZTGA 1WEVA 2CSVA 2EXUA 2EODA 1LDKC 5KH7A 3FJUB 2C2VS 2XOYA 3MHSA 5KH9A 2ECVA 2FD4A 4OGEA 2MD7B 1WFKA 3M62A 2Y1MA 2XP0A 2VJFB 3ZVZB 2KFTA 5J3XA 3MHHA 2KREA 2L43A 1WEOA 5LKXA 5EYAF 2ECTA 5G05B 2L0BA 3U5OA 2CSYA 2EGMA 3MDBC 3H7HA 4BBQA 4A4BA 3LQHA 2VNFA 3KV5A 4IC3A 1FP0A 1LDJB 4UP5A 3L11A 3LQIA 5SVIB 3LDYA 2VPBA 2DJAA 1VFYA 1HYIA 4B86C 2YREA 5C13A 4R8PK 2MT5A 2RR4A 4UP0A 4YBMA 3N9PA 2G43A 4LK9A 4AVXA 2CRRA 1WE9A 2JMDA 4Q6FA 4L7XA 4IC2A 1N87A 2LQ6A 2NAAA 2ECWA 5G0FA 4GNGA 5B78A 1WEWA 5AITA 2IDAA 2YHNA 2CKLA 4NN2A 5B76A 3QZVA 2QIZA 2YHOA 4FO9A 2C2LA 4A0CD 2JRJA 2ZETC 2MUMA 2KYUA 1E4UA 2JM3A 3ZVYA 2F42A 2KWOA 1WEPA 5SVXA 5B8DA 5FB1A 3M63A 5D1LB 4AUQB 3SOXA 3T9KA 3N9OA 2MD8C 2K17A 3JUEA 3I2DA 5B75A 4TKPB 4V3KC 3DWDA 4AYCB 2M6MA 1F62A 2FSAA 2KWKA 1VYXA 2LGLA 1BORA 2ECGA 3E2DA 2MNZA 3L1XA 5B79A 4YABA 4FK5A 2LV9A 5H1VA 3ZPVE 3FAOA 2M3HA 4FIPA 4CA1A 2H0DA 5H1UA 2KGIA 3PHDA 4Z0OA 4PTBA 3LVQE 2D8UA 2Y1NA 3L1ZB 2E61A 3HCUA 3LQJA 2KKYA 3C6WA 4F1PA 2KR4A 1MM3A 3C5KA 4MSXA 2YQLA 4W4UA 1WIMA 2M1RA 3HTKC 2YYRA 5FERA 3M7KA 3N9NA 2G6QA 1FBVA 2G45A 4S3OB 1WILA 1HYJA 4H9DA 3N9MA 5TDRA 4C9ZA 3RPGC 5G04B 4MVTA 4N4FA 2RSDA 3V43A 3DPLR 4WZ3B 3IHPA 2YVRA 3T7LA 3FL2A 3N9LA 2RI7A 3O36A 2MA5A 4FJCA 2LGKA 2YSJA 2YT5A 2B0OE 3O7AA 4ZDTA 4YBTA 5B77A 1X4UA 4YAXA 5I3LA 3T6RA 4I7CA 3HCTA 1JM7A 4GNDA 1ZBDB 2XB1A 5LKUA 3PLWA 2OXQC 1DCQA 2KKXA 3U5MA 5TABA 2CONA 1WEEA 4LKAA 3O33A 2LXPC 1VD4A 2MKEA 2LGGA 2KIZA 4WZ0A 2KGGA 2QICA 4GNFA 5KH3A 3M99A 2QJ0A 4R2YA 2KWNA 2DSMA 2DX8A 2HDPA 3KV6A 5C11A 3U5NA 1V87A 4S3OC 2E6RA 2VJEA 2KE1A 4WZ2A 3RPGB 4LJNA 3PURA 3O37A 4AP4A 2OWAA 5LKTA 3O70A 4B7YC 2YUCA 3RTRB 4I7BA 2YQMA 3KNVA 2ECJA 2M13A 5TBNA 1JM7B 4LADB 2CSZA 1MM2A 2XOZA 4A4CA 2EGPA 2CKLB 2F6JA 3LRQA 2FFWA 5LCWB 2I50A 2XOCA 5DINA 5TDWA 4L58A 4N3WA 3ZPV1 4F52B 3ZNIA 2M85A 2ECNA 2YSMA 3PUQA 5TRBA 4YC9A 3ASLA 2ECIA 2EA6A 2YURA 1JOCA 1K2FA 4QF3A 3DDTA 5DKAA 1DVPA 1WEQA 3LJUX 4R7EA 1Z60A 4P5OB 2AN6A 2P57A 4CCGX 5SVIA 2LRIC 2UZGA 3FANA 2FUUA 5H1TA 4Z0RA 2L75A 1T1HA 4V3LC 2MIQA 3KQIA 5K3QA 2L5UA 2L80A 1WEUA 4QQ4A 4WA6A 2YU4A 2PNXA 2H0DB 4I7DA 3GV4A 2FUIA 2MA6A 4YATA 2VPDA 3U5PA 3FM8C 2F6NA 3Q1DA 3KDEC 1Z2QA 2D8SA 3SUBA 3LVRE 3N9QA 4O64A
chains in the Genus database with same CATH topology
1WEMA 3GL6A 4QF2A 2Y43A 5JG6A 2LDRA 2JMIA 4XI1A 4UI9B 1IYMA 3NG2A 2VP7A 3SOUA 2CT2A 2LN0A 2PUYA 4YADA 4PPEA 1U6GB 5FEYA 4AYCA 1Z6UA 1G25A 2K1JA 1WESA 3EB6A 3O35A 1WENA 3VK6A 1X4JA 3O34A 3HCSA 3SHBA 2XEUA 2BAYA 4YBSA 4A49A 2VPGA 3EB5A 2E6SA 5D1KB 1CHCA 2K16A 4GB0A 4LLBA 4ZQLA 2KU3A 5FB0A 5AIUA 4BHWA 3SOWA 5LKZA 1XWHA 4ZUXU 5D1MB 4GNEA 2LGVA 2LXHC 4X3GA 2VJFA 5H9MA 2MNYA 2KWJA 2K4DA 3ZYQA 2VJEB 2JMJA 1X4IA 2YW8A 3DQVR 1WGMA 2VPEA 1RMDA 2HYED 3ZTGA 1WEVA 2EODA 1LDKC 5KH7A 2C2VS 3MHSA 5KH9A 2ECVA 2MD7B 1WFKA 3M62A 2Y1MA 2VJFB 3ZVZB 2KFTA 5J3XA 3MHHA 2KREA 2L43A 1WEOA 5LKXA 5EYAF 2ECTA 5G05B 2L0BA 3U5OA 2CSYA 4BBQA 4A4BA 3LQHA 2VNFA 3KV5A 4IC3A 1FP0A 1LDJB 4UP5A 3L11A 3LQIA 2VPBA 1VFYA 1HYIA 4B86C 2YREA 5C13A 4R8PK 2MT5A 4UP0A 4YBMA 3N9PA 2G43A 4LK9A 4AVXA 1WE9A 2JMDA 4Q6FA 4L7XA 4IC2A 1N87A 2LQ6A 2NAAA 2ECWA 5G0FA 4GNGA 5B78A 1WEWA 5AITA 2IDAA 2YHNA 2CKLA 4NN2A 5B76A 3QZVA 2QIZA 2YHOA 4FO9A 2C2LA 4A0CD 2JRJA 2ZETC 2MUMA 2KYUA 1E4UA 3ZVYA 2F42A 2KWOA 1WEPA 5B8DA 5FB1A 3M63A 5D1LB 4AUQB 3SOXA 3N9OA 2MD8C 2K17A 3I2DA 5B75A 4TKPB 4V3KC 4AYCB 2M6MA 1F62A 2FSAA 2KWKA 1VYXA 2LGLA 1BORA 2ECGA 3L1XA 2MNZA 5B79A 4YABA 4FK5A 2LV9A 5H1VA 3ZPVE 2M3HA 4FIPA 4CA1A 2H0DA 5H1UA 2KGIA 3PHDA 4PTBA 2Y1NA 3L1ZB 3HCUA 3LQJA 3C6WA 2KR4A 1MM3A 3C5KA 4MSXA 2YQLA 4W4UA 1WIMA 2M1RA 3HTKC 2YYRA 5FERA 3N9NA 2G6QA 1FBVA 2G45A 4S3OB 1WILA 1HYJA 3N9MA 5TDRA 4C9ZA 3RPGC 5G04B 4MVTA 4N4FA 2RSDA 3V43A 3DPLR 4WZ3B 3IHPA 3T7LA 3FL2A 3N9LA 2RI7A 3O36A 2MA5A 4FJCA 2LGKA 2YSJA 2YT5A 3O7AA 4ZDTA 4YBTA 5B77A 1X4UA 4YAXA 5I3LA 3T6RA 4I7CA 3HCTA 1JM7A 4GNDA 1ZBDB 2XB1A 5LKUA 2OXQC 3U5MA 5TABA 1WEEA 4LKAA 3O33A 2LXPC 1VD4A 2LGGA 2KIZA 4WZ0A 2KGGA 2QICA 4GNFA 5KH3A 3M99A 2QJ0A 4R2YA 2KWNA 2DX8A 2HDPA 3KV6A 5C11A 3U5NA 1V87A 4S3OC 2E6RA 2VJEA 2KE1A 4WZ2A 3RPGB 4LJNA 3PURA 3O37A 4AP4A 5LKTA 3O70A 4B7YC 2YUCA 3RTRB 4I7BA 2YQMA 3KNVA 2ECJA 5TBNA 1JM7B 4LADB 2CSZA 1MM2A 4A4CA 2EGPA 2CKLB 2F6JA 3LRQA 5LCWB 2I50A 5DINA 5TDWA 4L58A 4N3WA 3ZPV1 4F52B 3ZNIA 2M85A 2ECNA 2YSMA 3PUQA 5TRBA 4YC9A 3ASLA 2ECIA 2EA6A 2YURA 1JOCA 1K2FA 4QF3A 5DKAA 1DVPA 1WEQA 4R7EA 1Z60A 4P5OB 2AN6A 4CCGX 2LRIC 2UZGA 2FUUA 5H1TA 2L75A 1T1HA 4V3LC 2MIQA 3KQIA 2L5UA 2L80A 1WEUA 4WA6A 2YU4A 2PNXA 2H0DB 4I7DA 3GV4A 2FUIA 2MA6A 4YATA 2VPDA 3U5PA 2F6NA 1Z2QA 2D8SA 3N9QA 4O64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEM A;  3GL6 A;  4QF2 A;  2Y43 A;  5JG6 A;  2LDR A;  2JMI A;  4XI1 A;  4UI9 B;  1IYM A;  3NG2 A;  2VP7 A;  3SOU A;  2CT2 A;  2LN0 A;  2PUY A;  4YAD A;  4PPE A;  1U6G B;  5FEY A;  4AYC A;  1Z6U A;  1G25 A;  2K1J A;  1WES A;  3EB6 A;  3O35 A;  1WEN A;  3VK6 A;  1X4J A;  3O34 A;  3HCS A;  3SHB A;  2XEU A;  2BAY A;  4YBS A;  4A49 A;  2VPG A;  3EB5 A;  2E6S A;  5D1K B;  1CHC A;  2K16 A;  4GB0 A;  4LLB A;  4ZQL A;  2KU3 A;  5FB0 A;  5AIU A;  4BHW A;  3SOW A;  5LKZ A;  1XWH A;  4ZUX U;  5D1M B;  4GNE A;  2LGV A;  2LXH C;  4X3G A;  2VJF A;  5H9M A;  2MNY A;  2KWJ A;  2K4D A;  3ZYQ A;  2VJE B;  2JMJ A;  1X4I A;  2YW8 A;  3DQV R;  1WGM A;  2VPE A;  1RMD A;  2HYE D;  3ZTG A;  1WEV A;  2EOD A;  1LDK C;  5KH7 A;  2C2V S;  3MHS A;  5KH9 A;  2ECV A;  2MD7 B;  1WFK A;  3M62 A;  2Y1M A;  2VJF B;  3ZVZ B;  2KFT A;  5J3X A;  3MHH A;  2KRE A;  2L43 A;  1WEO A;  5LKX A;  5EYA F;  2ECT A;  5G05 B;  2L0B A;  3U5O A;  2CSY A;  4BBQ A;  4A4B A;  3LQH A;  2VNF A;  3KV5 A;  4IC3 A;  1FP0 A;  1LDJ B;  4UP5 A;  3L11 A;  3LQI A;  2VPB A;  1VFY A;  1HYI A;  4B86 C;  2YRE A;  5C13 A;  4R8P K;  2MT5 A;  4UP0 A;  4YBM A;  3N9P A;  2G43 A;  4LK9 A;  4AVX A;  1WE9 A;  2JMD A;  4Q6F A;  4L7X A;  4IC2 A;  1N87 A;  2LQ6 A;  2NAA A;  2ECW A;  5G0F A;  4GNG A;  5B78 A;  1WEW A;  5AIT A;  2IDA A;  2YHN A;  2CKL A;  4NN2 A;  5B76 A;  3QZV A;  2QIZ A;  2YHO A;  4FO9 A;  2C2L A;  4A0C D;  2JRJ A;  2ZET C;  2MUM A;  2KYU A;  1E4U A;  3ZVY A;  2F42 A;  2KWO A;  1WEP A;  5B8D A;  5FB1 A;  3M63 A;  5D1L B;  4AUQ B;  3SOX A;  3N9O A;  2MD8 C;  2K17 A;  3I2D A;  5B75 A;  4TKP B;  4V3K C;  4AYC B;  2M6M A;  1F62 A;  2FSA A;  2KWK A;  1VYX A;  2LGL A;  1BOR A;  2ECG A;  3L1X A;  2MNZ A;  5B79 A;  4YAB A;  4FK5 A;  2LV9 A;  5H1V A;  3ZPV E;  2M3H A;  4FIP A;  4CA1 A;  2H0D A;  5H1U A;  2KGI A;  3PHD A;  4PTB A;  2Y1N A;  3L1Z B;  3HCU A;  3LQJ A;  3C6W A;  2KR4 A;  1MM3 A;  3C5K A;  4MSX A;  2YQL A;  4W4U A;  1WIM A;  2M1R A;  3HTK C;  2YYR A;  5FER A;  3N9N A;  2G6Q A;  1FBV A;  2G45 A;  4S3O B;  1WIL A;  1HYJ A;  3N9M A;  5TDR A;  4C9Z A;  3RPG C;  5G04 B;  4MVT A;  4N4F A;  2RSD A;  3V43 A;  3DPL R;  4WZ3 B;  3IHP A;  3T7L A;  3FL2 A;  3N9L A;  2RI7 A;  3O36 A;  2MA5 A;  4FJC A;  2LGK A;  2YSJ A;  2YT5 A;  3O7A A;  4ZDT A;  4YBT A;  5B77 A;  1X4U A;  4YAX A;  5I3L A;  3T6R A;  4I7C A;  3HCT A;  1JM7 A;  4GND A;  1ZBD B;  2XB1 A;  5LKU A;  2OXQ C;  3U5M A;  5TAB A;  1WEE A;  4LKA A;  3O33 A;  2LXP C;  1VD4 A;  2LGG A;  2KIZ A;  4WZ0 A;  2KGG A;  2QIC A;  4GNF A;  5KH3 A;  3M99 A;  2QJ0 A;  4R2Y A;  2KWN A;  2DX8 A;  2HDP A;  3KV6 A;  5C11 A;  3U5N A;  1V87 A;  4S3O C;  2E6R A;  2VJE A;  2KE1 A;  4WZ2 A;  3RPG B;  4LJN A;  3PUR A;  3O37 A;  4AP4 A;  5LKT A;  3O70 A;  4B7Y C;  2YUC A;  3RTR B;  4I7B A;  2YQM A;  3KNV A;  2ECJ A;  5TBN A;  1JM7 B;  4LAD B;  2CSZ A;  1MM2 A;  4A4C A;  2EGP A;  2CKL B;  2F6J A;  3LRQ A;  5LCW B;  2I50 A;  5DIN A;  5TDW A;  4L58 A;  4N3W A;  3ZPV 1;  4F52 B;  3ZNI A;  2M85 A;  2ECN A;  2YSM A;  3PUQ A;  5TRB A;  4YC9 A;  3ASL A;  2ECI A;  2EA6 A;  2YUR A;  1JOC A;  1K2F A;  4QF3 A;  5DKA A;  1DVP A;  1WEQ A;  4R7E A;  1Z60 A;  4P5O B;  2AN6 A;  4CCG X;  2LRI C;  2UZG A;  2FUU A;  5H1T A;  2L75 A;  1T1H A;  4V3L C;  2MIQ A;  3KQI A;  2L5U A;  2L80 A;  1WEU A;  4WA6 A;  2YU4 A;  2PNX A;  2H0D B;  4I7D A;  3GV4 A;  2FUI A;  2MA6 A;  4YAT A;  2VPD A;  3U5P A;  2F6N A;  1Z2Q A;  2D8S A;  3N9Q A;  4O64 A; 
#chains in the Genus database with same CATH topology
 1WEM A;  3GL6 A;  4QF2 A;  2Y43 A;  3O47 A;  5JG6 A;  2LDR A;  2JUN A;  2JMI A;  4XI1 A;  4UI9 B;  1IYM A;  3NG2 A;  2VP7 A;  3SOU A;  2CT2 A;  2L7P A;  2LN0 A;  2PUY A;  4YAD A;  1MBM A;  4PPE A;  1U6G B;  5FEY A;  4AYC A;  1Z6U A;  1G25 A;  2K1J A;  1WES A;  2LAU A;  3EB6 A;  3O35 A;  1WEN A;  3VK6 A;  1X4J A;  3O34 A;  3HCS A;  3SHB A;  2XEU A;  2BAY A;  4YBS A;  4A49 A;  2VPG A;  3EB5 A;  2E6S A;  5D1K B;  1CHC A;  2K16 A;  4GB0 A;  5SVY A;  3FEH A;  4LLB A;  2IQJ A;  4ZQL A;  2KU3 A;  5FB0 A;  2CRW A;  5AIU A;  4BHW A;  4OGC A;  3SOW A;  5LKZ A;  1XWH A;  4ZUX U;  5D1M B;  4GNE A;  2LGV A;  2LXH C;  4X3G A;  2VJF A;  5H9M A;  2MNY A;  2KWJ A;  2K4D A;  3ZYQ A;  2VJE B;  2JMJ A;  1X4I A;  2YW8 A;  3DQV R;  1WGM A;  2VPE A;  4O62 A;  1RMD A;  2HYE D;  3ZTG A;  1WEV A;  2CSV A;  2EXU A;  2EOD A;  1LDK C;  5KH7 A;  3FJU B;  2C2V S;  2XOY A;  3MHS A;  5KH9 A;  2ECV A;  2FD4 A;  4OGE A;  2MD7 B;  1WFK A;  3M62 A;  2Y1M A;  2XP0 A;  2VJF B;  3ZVZ B;  2KFT A;  5J3X A;  3MHH A;  2KRE A;  2L43 A;  1WEO A;  5LKX A;  5EYA F;  2ECT A;  5G05 B;  2L0B A;  3U5O A;  2CSY A;  2EGM A;  3MDB C;  3H7H A;  4BBQ A;  4A4B A;  3LQH A;  2VNF A;  3KV5 A;  4IC3 A;  1FP0 A;  1LDJ B;  4UP5 A;  3L11 A;  3LQI A;  5SVI B;  3LDY A;  2VPB A;  2DJA A;  1VFY A;  1HYI A;  4B86 C;  2YRE A;  5C13 A;  4R8P K;  2MT5 A;  2RR4 A;  4UP0 A;  4YBM A;  3N9P A;  2G43 A;  4LK9 A;  4AVX A;  2CRR A;  1WE9 A;  2JMD A;  4Q6F A;  4L7X A;  4IC2 A;  1N87 A;  2LQ6 A;  2NAA A;  2ECW A;  5G0F A;  4GNG A;  5B78 A;  1WEW A;  5AIT A;  2IDA A;  2YHN A;  2CKL A;  4NN2 A;  5B76 A;  3QZV A;  2QIZ A;  2YHO A;  4FO9 A;  2C2L A;  4A0C D;  2JRJ A;  2ZET C;  2MUM A;  2KYU A;  1E4U A;  2JM3 A;  3ZVY A;  2F42 A;  2KWO A;  1WEP A;  5SVX A;  5B8D A;  5FB1 A;  3M63 A;  5D1L B;  4AUQ B;  3SOX A;  3T9K A;  3N9O A;  2MD8 C;  2K17 A;  3JUE A;  3I2D A;  5B75 A;  4TKP B;  4V3K C;  3DWD A;  4AYC B;  2M6M A;  1F62 A;  2FSA A;  2KWK A;  1VYX A;  2LGL A;  1BOR A;  2ECG A;  3E2D A;  2MNZ A;  3L1X A;  5B79 A;  4YAB A;  4FK5 A;  2LV9 A;  5H1V A;  3ZPV E;  3FAO A;  2M3H A;  4FIP A;  4CA1 A;  2H0D A;  5H1U A;  2KGI A;  3PHD A;  4Z0O A;  4PTB A;  3LVQ E;  2D8U A;  2Y1N A;  3L1Z B;  2E61 A;  3HCU A;  3LQJ A;  2KKY A;  3C6W A;  4F1P A;  2KR4 A;  1MM3 A;  3C5K A;  4MSX A;  2YQL A;  4W4U A;  1WIM A;  2M1R A;  3HTK C;  2YYR A;  5FER A;  3M7K A;  3N9N A;  2G6Q A;  1FBV A;  2G45 A;  4S3O B;  1WIL A;  1HYJ A;  4H9D A;  3N9M A;  5TDR A;  4C9Z A;  3RPG C;  5G04 B;  4MVT A;  4N4F A;  2RSD A;  3V43 A;  3DPL R;  4WZ3 B;  3IHP A;  2YVR A;  3T7L A;  3FL2 A;  3N9L A;  2RI7 A;  3O36 A;  2MA5 A;  4FJC A;  2LGK A;  2YSJ A;  2YT5 A;  2B0O E;  3O7A A;  4ZDT A;  4YBT A;  5B77 A;  1X4U A;  4YAX A;  5I3L A;  3T6R A;  4I7C A;  3HCT A;  1JM7 A;  4GND A;  1ZBD B;  2XB1 A;  5LKU A;  3PLW A;  2OXQ C;  1DCQ A;  2KKX A;  3U5M A;  5TAB A;  2CON A;  1WEE A;  4LKA A;  3O33 A;  2LXP C;  1VD4 A;  2MKE A;  2LGG A;  2KIZ A;  4WZ0 A;  2KGG A;  2QIC A;  4GNF A;  5KH3 A;  3M99 A;  2QJ0 A;  4R2Y A;  2KWN A;  2DSM A;  2DX8 A;  2HDP A;  3KV6 A;  5C11 A;  3U5N A;  1V87 A;  4S3O C;  2E6R A;  2VJE A;  2KE1 A;  4WZ2 A;  3RPG B;  4LJN A;  3PUR A;  3O37 A;  4AP4 A;  2OWA A;  5LKT A;  3O70 A;  4B7Y C;  2YUC A;  3RTR B;  4I7B A;  2YQM A;  3KNV A;  2ECJ A;  2M13 A;  5TBN A;  1JM7 B;  4LAD B;  2CSZ A;  1MM2 A;  2XOZ A;  4A4C A;  2EGP A;  2CKL B;  2F6J A;  3LRQ A;  2FFW A;  5LCW B;  2I50 A;  2XOC A;  5DIN A;  5TDW A;  4L58 A;  4N3W A;  3ZPV 1;  4F52 B;  3ZNI A;  2M85 A;  2ECN A;  2YSM A;  3PUQ A;  5TRB A;  4YC9 A;  3ASL A;  2ECI A;  2EA6 A;  2YUR A;  1JOC A;  1K2F A;  4QF3 A;  3DDT A;  5DKA A;  1DVP A;  1WEQ A;  3LJU X;  4R7E A;  1Z60 A;  4P5O B;  2AN6 A;  2P57 A;  4CCG X;  5SVI A;  2LRI C;  2UZG A;  3FAN A;  2FUU A;  5H1T A;  4Z0R A;  2L75 A;  1T1H A;  4V3L C;  2MIQ A;  3KQI A;  5K3Q A;  2L5U A;  2L80 A;  1WEU A;  4QQ4 A;  4WA6 A;  2YU4 A;  2PNX A;  2H0D B;  4I7D A;  3GV4 A;  2FUI A;  2MA6 A;  4YAT A;  2VPD A;  3U5P A;  3FM8 C;  2F6N A;  3Q1D A;  3KDE C;  1Z2Q A;  2D8S A;  3SUB A;  3LVR E;  3N9Q A;  4O64 A; 
#chains in the Genus database with same CATH homology
 1WEM A;  3GL6 A;  4QF2 A;  2Y43 A;  5JG6 A;  2LDR A;  2JMI A;  4XI1 A;  4UI9 B;  1IYM A;  3NG2 A;  2VP7 A;  3SOU A;  2CT2 A;  2LN0 A;  2PUY A;  4YAD A;  4PPE A;  1U6G B;  5FEY A;  4AYC A;  1Z6U A;  1G25 A;  2K1J A;  1WES A;  3EB6 A;  3O35 A;  1WEN A;  3VK6 A;  1X4J A;  3O34 A;  3HCS A;  3SHB A;  2XEU A;  2BAY A;  4YBS A;  4A49 A;  2VPG A;  3EB5 A;  2E6S A;  5D1K B;  1CHC A;  2K16 A;  4GB0 A;  4LLB A;  4ZQL A;  2KU3 A;  5FB0 A;  5AIU A;  4BHW A;  3SOW A;  5LKZ A;  1XWH A;  4ZUX U;  5D1M B;  4GNE A;  2LGV A;  2LXH C;  4X3G A;  2VJF A;  5H9M A;  2MNY A;  2KWJ A;  2K4D A;  3ZYQ A;  2VJE B;  2JMJ A;  1X4I A;  2YW8 A;  3DQV R;  1WGM A;  2VPE A;  1RMD A;  2HYE D;  3ZTG A;  1WEV A;  2EOD A;  1LDK C;  5KH7 A;  2C2V S;  3MHS A;  5KH9 A;  2ECV A;  2MD7 B;  1WFK A;  3M62 A;  2Y1M A;  2VJF B;  3ZVZ B;  2KFT A;  5J3X A;  3MHH A;  2KRE A;  2L43 A;  1WEO A;  5LKX A;  5EYA F;  2ECT A;  5G05 B;  2L0B A;  3U5O A;  2CSY A;  4BBQ A;  4A4B A;  3LQH A;  2VNF A;  3KV5 A;  4IC3 A;  1FP0 A;  1LDJ B;  4UP5 A;  3L11 A;  3LQI A;  2VPB A;  1VFY A;  1HYI A;  4B86 C;  2YRE A;  5C13 A;  4R8P K;  2MT5 A;  4UP0 A;  4YBM A;  3N9P A;  2G43 A;  4LK9 A;  4AVX A;  1WE9 A;  2JMD A;  4Q6F A;  4L7X A;  4IC2 A;  1N87 A;  2LQ6 A;  2NAA A;  2ECW A;  5G0F A;  4GNG A;  5B78 A;  1WEW A;  5AIT A;  2IDA A;  2YHN A;  2CKL A;  4NN2 A;  5B76 A;  3QZV A;  2QIZ A;  2YHO A;  4FO9 A;  2C2L A;  4A0C D;  2JRJ A;  2ZET C;  2MUM A;  2KYU A;  1E4U A;  3ZVY A;  2F42 A;  2KWO A;  1WEP A;  5B8D A;  5FB1 A;  3M63 A;  5D1L B;  4AUQ B;  3SOX A;  3N9O A;  2MD8 C;  2K17 A;  3I2D A;  5B75 A;  4TKP B;  4V3K C;  4AYC B;  2M6M A;  1F62 A;  2FSA A;  2KWK A;  1VYX A;  2LGL A;  1BOR A;  2ECG A;  3L1X A;  2MNZ A;  5B79 A;  4YAB A;  4FK5 A;  2LV9 A;  5H1V A;  3ZPV E;  2M3H A;  4FIP A;  4CA1 A;  2H0D A;  5H1U A;  2KGI A;  3PHD A;  4PTB A;  2Y1N A;  3L1Z B;  3HCU A;  3LQJ A;  3C6W A;  2KR4 A;  1MM3 A;  3C5K A;  4MSX A;  2YQL A;  4W4U A;  1WIM A;  2M1R A;  3HTK C;  2YYR A;  5FER A;  3N9N A;  2G6Q A;  1FBV A;  2G45 A;  4S3O B;  1WIL A;  1HYJ A;  3N9M A;  5TDR A;  4C9Z A;  3RPG C;  5G04 B;  4MVT A;  4N4F A;  2RSD A;  3V43 A;  3DPL R;  4WZ3 B;  3IHP A;  3T7L A;  3FL2 A;  3N9L A;  2RI7 A;  3O36 A;  2MA5 A;  4FJC A;  2LGK A;  2YSJ A;  2YT5 A;  3O7A A;  4ZDT A;  4YBT A;  5B77 A;  1X4U A;  4YAX A;  5I3L A;  3T6R A;  4I7C A;  3HCT A;  1JM7 A;  4GND A;  1ZBD B;  2XB1 A;  5LKU A;  2OXQ C;  3U5M A;  5TAB A;  1WEE A;  4LKA A;  3O33 A;  2LXP C;  1VD4 A;  2LGG A;  2KIZ A;  4WZ0 A;  2KGG A;  2QIC A;  4GNF A;  5KH3 A;  3M99 A;  2QJ0 A;  4R2Y A;  2KWN A;  2DX8 A;  2HDP A;  3KV6 A;  5C11 A;  3U5N A;  1V87 A;  4S3O C;  2E6R A;  2VJE A;  2KE1 A;  4WZ2 A;  3RPG B;  4LJN A;  3PUR A;  3O37 A;  4AP4 A;  5LKT A;  3O70 A;  4B7Y C;  2YUC A;  3RTR B;  4I7B A;  2YQM A;  3KNV A;  2ECJ A;  5TBN A;  1JM7 B;  4LAD B;  2CSZ A;  1MM2 A;  4A4C A;  2EGP A;  2CKL B;  2F6J A;  3LRQ A;  5LCW B;  2I50 A;  5DIN A;  5TDW A;  4L58 A;  4N3W A;  3ZPV 1;  4F52 B;  3ZNI A;  2M85 A;  2ECN A;  2YSM A;  3PUQ A;  5TRB A;  4YC9 A;  3ASL A;  2ECI A;  2EA6 A;  2YUR A;  1JOC A;  1K2F A;  4QF3 A;  5DKA A;  1DVP A;  1WEQ A;  4R7E A;  1Z60 A;  4P5O B;  2AN6 A;  4CCG X;  2LRI C;  2UZG A;  2FUU A;  5H1T A;  2L75 A;  1T1H A;  4V3L C;  2MIQ A;  3KQI A;  2L5U A;  2L80 A;  1WEU A;  4WA6 A;  2YU4 A;  2PNX A;  2H0D B;  4I7D A;  3GV4 A;  2FUI A;  2MA6 A;  4YAT A;  2VPD A;  3U5P A;  2F6N A;  1Z2Q A;  2D8S A;  3N9Q A;  4O64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...