1HYJA

Solution structure of the eea1 fyve domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
65
structure length
65
Chain Sequence
RKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords ENDOSOME-ASSOCIATED PROTEIN
publication title Structural mechanism of endosome docking by the FYVE domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01363 FYVE FYVE zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1hyjA00
4A4CA 2VJFB 3ZVZB 4L58A 2VPGA 3PUQA 2VJEB 2ECNA 1JM7A 4MSXA 3HTKC 2CT2A 4YC9A 3ZNIA 2KWJA 2M6MA 2KREA 4B86C 2G43A 4XI1A 4YATA 2YSJA 3PURA 3N9QA 4S3OB 2FSAA 3KNVA 1WEPA 1WEMA 5LKXA 3RPGC 3U5NA 2F6JA 4GNGA 4GNDA 5B76A 5AITA 2E6SA 2K4DA 1WGMA 2HYED 1HYJA 4AP4A 4I7CA 2ECVA 1JM7B 5D1KB 5LKUA 2KFTA 2FUUA 2Y1MA 1VYXA 1LDJB 1WILA 5LCWB 3U5MA 2QIZA 2Y43A 3C5KA 1WEUA 3N9PA 2KYUA 5B8DA 1T1HA 1HYIA 1Z2QA 4AUQB 2YUCA 2YSMA 1CHCA 2JMJA 2KGGA 4YBMA 2ECTA 4L7XA 5H1UA 3EB6A 2H0DA 1XWHA 2YURA 3O37A 2MA5A 3SOXA 4CA1A 1BORA 4PTBA 5D1LB 2DX8A 1RMDA 3C6WA 2VPBA 2D8SA 3GL6A 3I2DA 5KH3A 3ASLA 4MVTA 4AYCB 1MM2A 1JOCA 1ZBDB 4WZ2A 3MHSA 5FB0A 2L0BA 2ECJA 4LADB 2MT5A 2H0DB 4I7BA 1WEVA 3SOUA 4GNFA 2F42A 4LLBA 2YU4A 3HCSA 3ZVYA 2YHNA 2HDPA 3EB5A 2C2LA 2JMDA 4LKAA 5J3XA 4FK5A 1WEOA 4YBTA 3M63A 5H1TA 4PPEA 3SOWA 1G25A 2RI7A 4X3GA 2LGGA 2PUYA 2AN6A 4LK9A 2EA6A 5B75A 4R8PK 3N9NA 2MIQA 1Z6UA 3O35A 4N3WA 3L11A 1WEEA 5G04B 3GV4A 2K17A 4LJNA 1N87A 2C2VS 5AIUA 1K2FA 2F6NA 1VFYA 2Y1NA 1X4IA 4QF2A 2BAYA 1WFKA 5TBNA 2MD7B 2VNFA 3QZVA 2YQMA 4IC3A 3ZYQA 4BBQA 3V43A 3DQVR 1F62A 4BHWA 5H9MA 3L1XA 2YW8A 4YBSA 5LKTA 4GNEA 5B78A 2LXPC 2QJ0A 5FEYA 2KWOA 3KQIA 1WEWA 4ZUXU 4UI9B 4AYCA 5KH9A 4A0CD 5FERA 1WENA 4YABA 4S3OC 1X4JA 3LQJA 4AVXA 2LGLA 2CSYA 5DKAA 1FP0A 5TABA 5D1MB 4V3LC 4O64A 2YT5A 5LKZA 4YAXA 3ZTGA 5TDWA 1X4UA 3M62A 5TRBA 4A49A 2ECIA 2L43A 1E4UA 4FJCA 2NAAA 3LRQA 3ZPV1 4ZDTA 2MNYA 5B77A 3N9MA 2YHOA 2I50A 3ZPVE 2LDRA 2KR4A 2KIZA 1WEQA 5TDRA 3RPGB 4QF3A 2ECGA 5JG6A 3N9LA 4N4FA 4IC2A 3O36A 4R2YA 3T6RA 2LGVA 3U5OA 3FL2A 3IHPA 3DPLR 2QICA 1WIMA 2CSZA 3O34A 2LXHC 2XEUA 4ZQLA 4P5OB 2JMIA 5C13A 4WA6A 1Z60A 5DINA 2OXQC 4UP0A 1WESA 3MHHA 4GB0A 2YYRA 2KWNA 3O7AA 3NG2A 3LQHA 2YREA 1MM3A 3M99A 2VP7A 4WZ0A 5I3LA 2KE1A 1WE9A 4FIPA 2M3HA 1DVPA 2CKLA 2L5UA 4YADA 2UZGA 1IYMA 4F52B 2KWKA 2G6QA 2K1JA 2VPDA 2M85A 2MUMA 5H1VA 5G0FA 3O33A 4TKPB 2E6RA 2YQLA 5FB1A 5C11A 2LV9A 4NN2A 3RTRB 3SHBA 3N9OA 2LGKA 4W4UA 4B7YC 2K16A 4C9ZA 2CKLB 3O70A 3HCUA 1U6GB 2L75A 2RSDA 4V3KC 4Q6FA 2M1RA 3VK6A 1V87A 5B79A 2VJFA 2XB1A 3KV5A 2EGPA 4WZ3B 4UP5A 3LQIA 4R7EA 2VJEA 2ECWA 2FUIA 2MNZA 3KV6A 5EYAF 2KGIA 5G05B 2EODA 4FO9A 2MD8C 3HCTA 5KH7A 2L80A 4I7DA 2G45A 2VPEA 1FBVA 1VD4A 2JRJA 2IDAA 4A4BA 3T7LA 2KU3A 2LN0A 3U5PA 2MA6A 2LQ6A 2LRIC 4CCGX 3L1ZB 3PHDA 2ZETC 1LDKC 2PNXA
chains in the Genus database with same CATH superfamily
4A4CA 2VJFB 1MBMA 3ZVZB 4L58A 3E2DA 2VPGA 3PUQA 2VJEB 2ECNA 1JM7A 4MSXA 3HTKC 2CT2A 4YC9A 3ZNIA 2KWJA 2M6MA 2KREA 4B86C 2G43A 4XI1A 4YATA 2MKEA 3M7KA 2YSJA 3PURA 3MDBC 3N9QA 4S3OB 2FSAA 3KNVA 1WEPA 1WEMA 5LKXA 3RPGC 3U5NA 2F6JA 4GNGA 4GNDA 5B76A 5AITA 2E6SA 2EGMA 2K4DA 1WGMA 2HYED 1HYJA 4AP4A 4I7CA 2ECVA 1JM7B 5D1KB 5LKUA 2KFTA 2FUUA 4Z0RA 2Y1MA 1VYXA 1LDJB 1WILA 5LCWB 3U5MA 2QIZA 2Y43A 3C5KA 1WEUA 3N9PA 2KYUA 2CRRA 5K3QA 5B8DA 1T1HA 1HYIA 1Z2QA 4AUQB 2YUCA 2YSMA 1CHCA 2JMJA 2FFWA 5SVYA 2CSVA 2KGGA 4YBMA 2ECTA 4L7XA 5H1UA 3EB6A 2XOCA 2H0DA 1XWHA 2D8UA 2YURA 3O37A 2MA5A 3SOXA 4CA1A 1BORA 4PTBA 5D1LB 2DX8A 1RMDA 2P57A 3C6WA 2VPBA 2D8SA 3GL6A 3I2DA 5KH3A 2JM3A 3ASLA 2XOZA 3JUEA 4MVTA 4AYCB 1MM2A 1JOCA 1ZBDB 4WZ2A 3MHSA 5FB0A 2L0BA 2ECJA 3FM8C 4LADB 2M13A 2MT5A 2H0DB 3FAOA 4I7BA 1WEVA 4O62A 2CRWA 3SOUA 4GNFA 2F42A 4LLBA 2YU4A 2RR4A 3HCSA 3ZVYA 2YHNA 2HDPA 3EB5A 2C2LA 2JMDA 2FD4A 4LKAA 5J3XA 4FK5A 1WEOA 4YBTA 3M63A 5H1TA 4PPEA 3SOWA 1G25A 2RI7A 4X3GA 2LGGA 2PUYA 2AN6A 4LK9A 3FEHA 2EA6A 5B75A 4R8PK 2YVRA 3N9NA 2MIQA 1Z6UA 3O35A 4N3WA 3L11A 1WEEA 5G04B 3GV4A 2K17A 4LJNA 2KKXA 1N87A 2C2VS 5AIUA 1K2FA 2F6NA 1VFYA 2Y1NA 2DJAA 3PLWA 1X4IA 4QF2A 2BAYA 1WFKA 5TBNA 2MD7B 2JUNA 3DWDA 2VNFA 2DSMA 3QZVA 2YQMA 4IC3A 3ZYQA 4BBQA 3V43A 3DQVR 1F62A 4BHWA 5H9MA 3L1XA 2YW8A 4YBSA 5LKTA 4GNEA 5B78A 2LXPC 2QJ0A 5FEYA 2KWOA 3KQIA 1WEWA 4ZUXU 4UI9B 4AYCA 5KH9A 4A0CD 5FERA 1WENA 4YABA 4S3OC 1X4JA 3LQJA 4AVXA 2LGLA 3FJUB 2E61A 4Z0OA 2XOYA 2CSYA 5DKAA 1FP0A 5D1MB 5TABA 4V3LC 4O64A 2YT5A 5LKZA 4YAXA 3ZTGA 1DCQA 2IQJA 4OGCA 2XP0A 5TDWA 1X4UA 3M62A 5TRBA 2B0OE 4A49A 2ECIA 2L43A 1E4UA 4FJCA 2NAAA 3H7HA 3LRQA 3ZPV1 4ZDTA 2MNYA 5B77A 3N9MA 2YHOA 2I50A 3ZPVE 2LDRA 3T9KA 2KR4A 2KIZA 1WEQA 5TDRA 3RPGB 4QF3A 2ECGA 3KDEC 3LDYA 5JG6A 3N9LA 4N4FA 4IC2A 3O36A 4R2YA 2LAUA 3T6RA 2LGVA 4H9DA 3U5OA 3FL2A 3IHPA 3DPLR 2QICA 1WIMA 3DDTA 2CSZA 3O34A 3FANA 2LXHC 2XEUA 4ZQLA 3LVQE 4P5OB 2JMIA 2KKYA 5C13A 4WA6A 1Z60A 5DINA 4F1PA 2OXQC 4UP0A 1WESA 3MHHA 2OWAA 4GB0A 2YYRA 2KWNA 5SVIA 3O7AA 3NG2A 3LQHA 2YREA 1MM3A 3M99A 2VP7A 4WZ0A 5I3LA 2KE1A 1WE9A 4FIPA 2M3HA 1DVPA 2CKLA 2L5UA 4YADA 4OGEA 2UZGA 1IYMA 4F52B 2KWKA 2G6QA 2K1JA 3LVRE 2VPDA 2M85A 2MUMA 5H1VA 5G0FA 3O33A 4TKPB 2E6RA 2YQLA 5FB1A 5C11A 2LV9A 4NN2A 3RTRB 3SHBA 3N9OA 2LGKA 4QQ4A 3SUBA 5SVIB 4W4UA 4B7YC 2K16A 4C9ZA 2CKLB 3O70A 3HCUA 2EXUA 1U6GB 2L75A 3LJUX 2RSDA 4V3KC 4Q6FA 2M1RA 3VK6A 1V87A 5B79A 2VJFA 2XB1A 3KV5A 2EGPA 4WZ3B 2L7PA 4UP5A 3LQIA 2CONA 4R7EA 2VJEA 2ECWA 2FUIA 2MNZA 3KV6A 3Q1DA 5EYAF 2KGIA 5G05B 2EODA 4FO9A 2MD8C 5SVXA 3HCTA 5KH7A 2L80A 4I7DA 2G45A 2VPEA 1FBVA 1VD4A 2JRJA 2IDAA 4A4BA 3T7LA 2KU3A 3O47A 2LN0A 3U5PA 2MA6A 2LQ6A 2LRIC 4CCGX 3L1ZB 3PHDA 2ZETC 1LDKC 2PNXA
chains in the Genus database with same CATH topology
4A4CA 2VJFB 3ZVZB 4L58A 2VPGA 3PUQA 2VJEB 2ECNA 1JM7A 4MSXA 3HTKC 2CT2A 4YC9A 3ZNIA 2KWJA 2M6MA 2KREA 4B86C 2G43A 4XI1A 4YATA 2YSJA 3PURA 3N9QA 4S3OB 2FSAA 3KNVA 1WEPA 1WEMA 5LKXA 3RPGC 3U5NA 2F6JA 4GNGA 4GNDA 5B76A 5AITA 2E6SA 2K4DA 1WGMA 2HYED 1HYJA 4AP4A 4I7CA 2ECVA 1JM7B 5D1KB 5LKUA 2KFTA 2FUUA 2Y1MA 1VYXA 1LDJB 1WILA 5LCWB 3U5MA 2QIZA 2Y43A 3C5KA 1WEUA 3N9PA 2KYUA 5B8DA 1T1HA 1HYIA 1Z2QA 4AUQB 2YUCA 2YSMA 1CHCA 2JMJA 2KGGA 4YBMA 2ECTA 4L7XA 5H1UA 3EB6A 2H0DA 1XWHA 2YURA 3O37A 2MA5A 3SOXA 4CA1A 1BORA 4PTBA 5D1LB 2DX8A 1RMDA 3C6WA 2VPBA 2D8SA 3GL6A 3I2DA 5KH3A 3ASLA 4MVTA 4AYCB 1MM2A 1JOCA 1ZBDB 4WZ2A 3MHSA 5FB0A 2L0BA 2ECJA 4LADB 2MT5A 2H0DB 4I7BA 1WEVA 3SOUA 4GNFA 2F42A 4LLBA 2YU4A 3HCSA 3ZVYA 2YHNA 2HDPA 3EB5A 2C2LA 2JMDA 4LKAA 5J3XA 4FK5A 1WEOA 4YBTA 3M63A 5H1TA 4PPEA 3SOWA 1G25A 2RI7A 4X3GA 2LGGA 2PUYA 2AN6A 4LK9A 2EA6A 5B75A 4R8PK 3N9NA 2MIQA 1Z6UA 3O35A 4N3WA 3L11A 1WEEA 5G04B 3GV4A 2K17A 4LJNA 1N87A 2C2VS 5AIUA 1K2FA 2F6NA 1VFYA 2Y1NA 1X4IA 4QF2A 2BAYA 1WFKA 5TBNA 2MD7B 2VNFA 3QZVA 2YQMA 4IC3A 3ZYQA 4BBQA 3V43A 3DQVR 1F62A 4BHWA 5H9MA 3L1XA 2YW8A 4YBSA 5LKTA 4GNEA 5B78A 2LXPC 2QJ0A 5FEYA 2KWOA 3KQIA 1WEWA 4ZUXU 4UI9B 4AYCA 5KH9A 4A0CD 5FERA 1WENA 4YABA 4S3OC 1X4JA 3LQJA 4AVXA 2LGLA 2CSYA 5DKAA 1FP0A 5TABA 5D1MB 4V3LC 4O64A 2YT5A 5LKZA 4YAXA 3ZTGA 5TDWA 1X4UA 3M62A 5TRBA 4A49A 2ECIA 2L43A 1E4UA 4FJCA 2NAAA 3LRQA 3ZPV1 4ZDTA 2MNYA 5B77A 3N9MA 2YHOA 2I50A 3ZPVE 2LDRA 2KR4A 2KIZA 1WEQA 5TDRA 3RPGB 4QF3A 2ECGA 5JG6A 3N9LA 4N4FA 4IC2A 3O36A 4R2YA 3T6RA 2LGVA 3U5OA 3FL2A 3IHPA 3DPLR 2QICA 1WIMA 2CSZA 3O34A 2LXHC 2XEUA 4ZQLA 4P5OB 2JMIA 5C13A 4WA6A 1Z60A 5DINA 2OXQC 4UP0A 1WESA 3MHHA 4GB0A 2YYRA 2KWNA 3O7AA 3NG2A 3LQHA 2YREA 1MM3A 3M99A 2VP7A 4WZ0A 5I3LA 2KE1A 1WE9A 4FIPA 2M3HA 1DVPA 2CKLA 2L5UA 4YADA 2UZGA 1IYMA 4F52B 2KWKA 2G6QA 2K1JA 2VPDA 2M85A 2MUMA 5H1VA 5G0FA 3O33A 4TKPB 2E6RA 2YQLA 5FB1A 5C11A 2LV9A 4NN2A 3RTRB 3SHBA 3N9OA 2LGKA 4W4UA 4B7YC 2K16A 4C9ZA 2CKLB 3O70A 3HCUA 1U6GB 2L75A 2RSDA 4V3KC 4Q6FA 2M1RA 3VK6A 1V87A 5B79A 2VJFA 2XB1A 3KV5A 2EGPA 4WZ3B 4UP5A 3LQIA 4R7EA 2VJEA 2ECWA 2FUIA 2MNZA 3KV6A 5EYAF 2KGIA 5G05B 2EODA 4FO9A 2MD8C 3HCTA 5KH7A 2L80A 4I7DA 2G45A 2VPEA 1FBVA 1VD4A 2JRJA 2IDAA 4A4BA 3T7LA 2KU3A 2LN0A 3U5PA 2MA6A 2LQ6A 2LRIC 4CCGX 3L1ZB 3PHDA 2ZETC 1LDKC 2PNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4C A;  2VJF B;  3ZVZ B;  4L58 A;  2VPG A;  3PUQ A;  2VJE B;  2ECN A;  1JM7 A;  4MSX A;  3HTK C;  2CT2 A;  4YC9 A;  3ZNI A;  2KWJ A;  2M6M A;  2KRE A;  4B86 C;  2G43 A;  4XI1 A;  4YAT A;  2YSJ A;  3PUR A;  3N9Q A;  4S3O B;  2FSA A;  3KNV A;  1WEP A;  1WEM A;  5LKX A;  3RPG C;  3U5N A;  2F6J A;  4GNG A;  4GND A;  5B76 A;  5AIT A;  2E6S A;  2K4D A;  1WGM A;  2HYE D;  1HYJ A;  4AP4 A;  4I7C A;  2ECV A;  1JM7 B;  5D1K B;  5LKU A;  2KFT A;  2FUU A;  2Y1M A;  1VYX A;  1LDJ B;  1WIL A;  5LCW B;  3U5M A;  2QIZ A;  2Y43 A;  3C5K A;  1WEU A;  3N9P A;  2KYU A;  5B8D A;  1T1H A;  1HYI A;  1Z2Q A;  4AUQ B;  2YUC A;  2YSM A;  1CHC A;  2JMJ A;  2KGG A;  4YBM A;  2ECT A;  4L7X A;  5H1U A;  3EB6 A;  2H0D A;  1XWH A;  2YUR A;  3O37 A;  2MA5 A;  3SOX A;  4CA1 A;  1BOR A;  4PTB A;  5D1L B;  2DX8 A;  1RMD A;  3C6W A;  2VPB A;  2D8S A;  3GL6 A;  3I2D A;  5KH3 A;  3ASL A;  4MVT A;  4AYC B;  1MM2 A;  1JOC A;  1ZBD B;  4WZ2 A;  3MHS A;  5FB0 A;  2L0B A;  2ECJ A;  4LAD B;  2MT5 A;  2H0D B;  4I7B A;  1WEV A;  3SOU A;  4GNF A;  2F42 A;  4LLB A;  2YU4 A;  3HCS A;  3ZVY A;  2YHN A;  2HDP A;  3EB5 A;  2C2L A;  2JMD A;  4LKA A;  5J3X A;  4FK5 A;  1WEO A;  4YBT A;  3M63 A;  5H1T A;  4PPE A;  3SOW A;  1G25 A;  2RI7 A;  4X3G A;  2LGG A;  2PUY A;  2AN6 A;  4LK9 A;  2EA6 A;  5B75 A;  4R8P K;  3N9N A;  2MIQ A;  1Z6U A;  3O35 A;  4N3W A;  3L11 A;  1WEE A;  5G04 B;  3GV4 A;  2K17 A;  4LJN A;  1N87 A;  2C2V S;  5AIU A;  1K2F A;  2F6N A;  1VFY A;  2Y1N A;  1X4I A;  4QF2 A;  2BAY A;  1WFK A;  5TBN A;  2MD7 B;  2VNF A;  3QZV A;  2YQM A;  4IC3 A;  3ZYQ A;  4BBQ A;  3V43 A;  3DQV R;  1F62 A;  4BHW A;  5H9M A;  3L1X A;  2YW8 A;  4YBS A;  5LKT A;  4GNE A;  5B78 A;  2LXP C;  2QJ0 A;  5FEY A;  2KWO A;  3KQI A;  1WEW A;  4ZUX U;  4UI9 B;  4AYC A;  5KH9 A;  4A0C D;  5FER A;  1WEN A;  4YAB A;  4S3O C;  1X4J A;  3LQJ A;  4AVX A;  2LGL A;  2CSY A;  5DKA A;  1FP0 A;  5TAB A;  5D1M B;  4V3L C;  4O64 A;  2YT5 A;  5LKZ A;  4YAX A;  3ZTG A;  5TDW A;  1X4U A;  3M62 A;  5TRB A;  4A49 A;  2ECI A;  2L43 A;  1E4U A;  4FJC A;  2NAA A;  3LRQ A;  3ZPV 1;  4ZDT A;  2MNY A;  5B77 A;  3N9M A;  2YHO A;  2I50 A;  3ZPV E;  2LDR A;  2KR4 A;  2KIZ A;  1WEQ A;  5TDR A;  3RPG B;  4QF3 A;  2ECG A;  5JG6 A;  3N9L A;  4N4F A;  4IC2 A;  3O36 A;  4R2Y A;  3T6R A;  2LGV A;  3U5O A;  3FL2 A;  3IHP A;  3DPL R;  2QIC A;  1WIM A;  2CSZ A;  3O34 A;  2LXH C;  2XEU A;  4ZQL A;  4P5O B;  2JMI A;  5C13 A;  4WA6 A;  1Z60 A;  5DIN A;  2OXQ C;  4UP0 A;  1WES A;  3MHH A;  4GB0 A;  2YYR A;  2KWN A;  3O7A A;  3NG2 A;  3LQH A;  2YRE A;  1MM3 A;  3M99 A;  2VP7 A;  4WZ0 A;  5I3L A;  2KE1 A;  1WE9 A;  4FIP A;  2M3H A;  1DVP A;  2CKL A;  2L5U A;  4YAD A;  2UZG A;  1IYM A;  4F52 B;  2KWK A;  2G6Q A;  2K1J A;  2VPD A;  2M85 A;  2MUM A;  5H1V A;  5G0F A;  3O33 A;  4TKP B;  2E6R A;  2YQL A;  5FB1 A;  5C11 A;  2LV9 A;  4NN2 A;  3RTR B;  3SHB A;  3N9O A;  2LGK A;  4W4U A;  4B7Y C;  2K16 A;  4C9Z A;  2CKL B;  3O70 A;  3HCU A;  1U6G B;  2L75 A;  2RSD A;  4V3K C;  4Q6F A;  2M1R A;  3VK6 A;  1V87 A;  5B79 A;  2VJF A;  2XB1 A;  3KV5 A;  2EGP A;  4WZ3 B;  4UP5 A;  3LQI A;  4R7E A;  2VJE A;  2ECW A;  2FUI A;  2MNZ A;  3KV6 A;  5EYA F;  2KGI A;  5G05 B;  2EOD A;  4FO9 A;  2MD8 C;  3HCT A;  5KH7 A;  2L80 A;  4I7D A;  2G45 A;  2VPE A;  1FBV A;  1VD4 A;  2JRJ A;  2IDA A;  4A4B A;  3T7L A;  2KU3 A;  2LN0 A;  3U5P A;  2MA6 A;  2LQ6 A;  2LRI C;  4CCG X;  3L1Z B;  3PHD A;  2ZET C;  1LDK C;  2PNX A; 
#chains in the Genus database with same CATH topology
 4A4C A;  2VJF B;  1MBM A;  3ZVZ B;  4L58 A;  3E2D A;  2VPG A;  3PUQ A;  2VJE B;  2ECN A;  1JM7 A;  4MSX A;  3HTK C;  2CT2 A;  4YC9 A;  3ZNI A;  2KWJ A;  2M6M A;  2KRE A;  4B86 C;  2G43 A;  4XI1 A;  4YAT A;  2MKE A;  3M7K A;  2YSJ A;  3PUR A;  3MDB C;  3N9Q A;  4S3O B;  2FSA A;  3KNV A;  1WEP A;  1WEM A;  5LKX A;  3RPG C;  3U5N A;  2F6J A;  4GNG A;  4GND A;  5B76 A;  5AIT A;  2E6S A;  2EGM A;  2K4D A;  1WGM A;  2HYE D;  1HYJ A;  4AP4 A;  4I7C A;  2ECV A;  1JM7 B;  5D1K B;  5LKU A;  2KFT A;  2FUU A;  4Z0R A;  2Y1M A;  1VYX A;  1LDJ B;  1WIL A;  5LCW B;  3U5M A;  2QIZ A;  2Y43 A;  3C5K A;  1WEU A;  3N9P A;  2KYU A;  2CRR A;  5K3Q A;  5B8D A;  1T1H A;  1HYI A;  1Z2Q A;  4AUQ B;  2YUC A;  2YSM A;  1CHC A;  2JMJ A;  2FFW A;  5SVY A;  2CSV A;  2KGG A;  4YBM A;  2ECT A;  4L7X A;  5H1U A;  3EB6 A;  2XOC A;  2H0D A;  1XWH A;  2D8U A;  2YUR A;  3O37 A;  2MA5 A;  3SOX A;  4CA1 A;  1BOR A;  4PTB A;  5D1L B;  2DX8 A;  1RMD A;  2P57 A;  3C6W A;  2VPB A;  2D8S A;  3GL6 A;  3I2D A;  5KH3 A;  2JM3 A;  3ASL A;  2XOZ A;  3JUE A;  4MVT A;  4AYC B;  1MM2 A;  1JOC A;  1ZBD B;  4WZ2 A;  3MHS A;  5FB0 A;  2L0B A;  2ECJ A;  3FM8 C;  4LAD B;  2M13 A;  2MT5 A;  2H0D B;  3FAO A;  4I7B A;  1WEV A;  4O62 A;  2CRW A;  3SOU A;  4GNF A;  2F42 A;  4LLB A;  2YU4 A;  2RR4 A;  3HCS A;  3ZVY A;  2YHN A;  2HDP A;  3EB5 A;  2C2L A;  2JMD A;  2FD4 A;  4LKA A;  5J3X A;  4FK5 A;  1WEO A;  4YBT A;  3M63 A;  5H1T A;  4PPE A;  3SOW A;  1G25 A;  2RI7 A;  4X3G A;  2LGG A;  2PUY A;  2AN6 A;  4LK9 A;  3FEH A;  2EA6 A;  5B75 A;  4R8P K;  2YVR A;  3N9N A;  2MIQ A;  1Z6U A;  3O35 A;  4N3W A;  3L11 A;  1WEE A;  5G04 B;  3GV4 A;  2K17 A;  4LJN A;  2KKX A;  1N87 A;  2C2V S;  5AIU A;  1K2F A;  2F6N A;  1VFY A;  2Y1N A;  2DJA A;  3PLW A;  1X4I A;  4QF2 A;  2BAY A;  1WFK A;  5TBN A;  2MD7 B;  2JUN A;  3DWD A;  2VNF A;  2DSM A;  3QZV A;  2YQM A;  4IC3 A;  3ZYQ A;  4BBQ A;  3V43 A;  3DQV R;  1F62 A;  4BHW A;  5H9M A;  3L1X A;  2YW8 A;  4YBS A;  5LKT A;  4GNE A;  5B78 A;  2LXP C;  2QJ0 A;  5FEY A;  2KWO A;  3KQI A;  1WEW A;  4ZUX U;  4UI9 B;  4AYC A;  5KH9 A;  4A0C D;  5FER A;  1WEN A;  4YAB A;  4S3O C;  1X4J A;  3LQJ A;  4AVX A;  2LGL A;  3FJU B;  2E61 A;  4Z0O A;  2XOY A;  2CSY A;  5DKA A;  1FP0 A;  5D1M B;  5TAB A;  4V3L C;  4O64 A;  2YT5 A;  5LKZ A;  4YAX A;  3ZTG A;  1DCQ A;  2IQJ A;  4OGC A;  2XP0 A;  5TDW A;  1X4U A;  3M62 A;  5TRB A;  2B0O E;  4A49 A;  2ECI A;  2L43 A;  1E4U A;  4FJC A;  2NAA A;  3H7H A;  3LRQ A;  3ZPV 1;  4ZDT A;  2MNY A;  5B77 A;  3N9M A;  2YHO A;  2I50 A;  3ZPV E;  2LDR A;  3T9K A;  2KR4 A;  2KIZ A;  1WEQ A;  5TDR A;  3RPG B;  4QF3 A;  2ECG A;  3KDE C;  3LDY A;  5JG6 A;  3N9L A;  4N4F A;  4IC2 A;  3O36 A;  4R2Y A;  2LAU A;  3T6R A;  2LGV A;  4H9D A;  3U5O A;  3FL2 A;  3IHP A;  3DPL R;  2QIC A;  1WIM A;  3DDT A;  2CSZ A;  3O34 A;  3FAN A;  2LXH C;  2XEU A;  4ZQL A;  3LVQ E;  4P5O B;  2JMI A;  2KKY A;  5C13 A;  4WA6 A;  1Z60 A;  5DIN A;  4F1P A;  2OXQ C;  4UP0 A;  1WES A;  3MHH A;  2OWA A;  4GB0 A;  2YYR A;  2KWN A;  5SVI A;  3O7A A;  3NG2 A;  3LQH A;  2YRE A;  1MM3 A;  3M99 A;  2VP7 A;  4WZ0 A;  5I3L A;  2KE1 A;  1WE9 A;  4FIP A;  2M3H A;  1DVP A;  2CKL A;  2L5U A;  4YAD A;  4OGE A;  2UZG A;  1IYM A;  4F52 B;  2KWK A;  2G6Q A;  2K1J A;  3LVR E;  2VPD A;  2M85 A;  2MUM A;  5H1V A;  5G0F A;  3O33 A;  4TKP B;  2E6R A;  2YQL A;  5FB1 A;  5C11 A;  2LV9 A;  4NN2 A;  3RTR B;  3SHB A;  3N9O A;  2LGK A;  4QQ4 A;  3SUB A;  5SVI B;  4W4U A;  4B7Y C;  2K16 A;  4C9Z A;  2CKL B;  3O70 A;  3HCU A;  2EXU A;  1U6G B;  2L75 A;  3LJU X;  2RSD A;  4V3K C;  4Q6F A;  2M1R A;  3VK6 A;  1V87 A;  5B79 A;  2VJF A;  2XB1 A;  3KV5 A;  2EGP A;  4WZ3 B;  2L7P A;  4UP5 A;  3LQI A;  2CON A;  4R7E A;  2VJE A;  2ECW A;  2FUI A;  2MNZ A;  3KV6 A;  3Q1D A;  5EYA F;  2KGI A;  5G05 B;  2EOD A;  4FO9 A;  2MD8 C;  5SVX A;  3HCT A;  5KH7 A;  2L80 A;  4I7D A;  2G45 A;  2VPE A;  1FBV A;  1VD4 A;  2JRJ A;  2IDA A;  4A4B A;  3T7L A;  2KU3 A;  3O47 A;  2LN0 A;  3U5P A;  2MA6 A;  2LQ6 A;  2LRI C;  4CCG X;  3L1Z B;  3PHD A;  2ZET C;  1LDK C;  2PNX A; 
#chains in the Genus database with same CATH homology
 4A4C A;  2VJF B;  3ZVZ B;  4L58 A;  2VPG A;  3PUQ A;  2VJE B;  2ECN A;  1JM7 A;  4MSX A;  3HTK C;  2CT2 A;  4YC9 A;  3ZNI A;  2KWJ A;  2M6M A;  2KRE A;  4B86 C;  2G43 A;  4XI1 A;  4YAT A;  2YSJ A;  3PUR A;  3N9Q A;  4S3O B;  2FSA A;  3KNV A;  1WEP A;  1WEM A;  5LKX A;  3RPG C;  3U5N A;  2F6J A;  4GNG A;  4GND A;  5B76 A;  5AIT A;  2E6S A;  2K4D A;  1WGM A;  2HYE D;  1HYJ A;  4AP4 A;  4I7C A;  2ECV A;  1JM7 B;  5D1K B;  5LKU A;  2KFT A;  2FUU A;  2Y1M A;  1VYX A;  1LDJ B;  1WIL A;  5LCW B;  3U5M A;  2QIZ A;  2Y43 A;  3C5K A;  1WEU A;  3N9P A;  2KYU A;  5B8D A;  1T1H A;  1HYI A;  1Z2Q A;  4AUQ B;  2YUC A;  2YSM A;  1CHC A;  2JMJ A;  2KGG A;  4YBM A;  2ECT A;  4L7X A;  5H1U A;  3EB6 A;  2H0D A;  1XWH A;  2YUR A;  3O37 A;  2MA5 A;  3SOX A;  4CA1 A;  1BOR A;  4PTB A;  5D1L B;  2DX8 A;  1RMD A;  3C6W A;  2VPB A;  2D8S A;  3GL6 A;  3I2D A;  5KH3 A;  3ASL A;  4MVT A;  4AYC B;  1MM2 A;  1JOC A;  1ZBD B;  4WZ2 A;  3MHS A;  5FB0 A;  2L0B A;  2ECJ A;  4LAD B;  2MT5 A;  2H0D B;  4I7B A;  1WEV A;  3SOU A;  4GNF A;  2F42 A;  4LLB A;  2YU4 A;  3HCS A;  3ZVY A;  2YHN A;  2HDP A;  3EB5 A;  2C2L A;  2JMD A;  4LKA A;  5J3X A;  4FK5 A;  1WEO A;  4YBT A;  3M63 A;  5H1T A;  4PPE A;  3SOW A;  1G25 A;  2RI7 A;  4X3G A;  2LGG A;  2PUY A;  2AN6 A;  4LK9 A;  2EA6 A;  5B75 A;  4R8P K;  3N9N A;  2MIQ A;  1Z6U A;  3O35 A;  4N3W A;  3L11 A;  1WEE A;  5G04 B;  3GV4 A;  2K17 A;  4LJN A;  1N87 A;  2C2V S;  5AIU A;  1K2F A;  2F6N A;  1VFY A;  2Y1N A;  1X4I A;  4QF2 A;  2BAY A;  1WFK A;  5TBN A;  2MD7 B;  2VNF A;  3QZV A;  2YQM A;  4IC3 A;  3ZYQ A;  4BBQ A;  3V43 A;  3DQV R;  1F62 A;  4BHW A;  5H9M A;  3L1X A;  2YW8 A;  4YBS A;  5LKT A;  4GNE A;  5B78 A;  2LXP C;  2QJ0 A;  5FEY A;  2KWO A;  3KQI A;  1WEW A;  4ZUX U;  4UI9 B;  4AYC A;  5KH9 A;  4A0C D;  5FER A;  1WEN A;  4YAB A;  4S3O C;  1X4J A;  3LQJ A;  4AVX A;  2LGL A;  2CSY A;  5DKA A;  1FP0 A;  5TAB A;  5D1M B;  4V3L C;  4O64 A;  2YT5 A;  5LKZ A;  4YAX A;  3ZTG A;  5TDW A;  1X4U A;  3M62 A;  5TRB A;  4A49 A;  2ECI A;  2L43 A;  1E4U A;  4FJC A;  2NAA A;  3LRQ A;  3ZPV 1;  4ZDT A;  2MNY A;  5B77 A;  3N9M A;  2YHO A;  2I50 A;  3ZPV E;  2LDR A;  2KR4 A;  2KIZ A;  1WEQ A;  5TDR A;  3RPG B;  4QF3 A;  2ECG A;  5JG6 A;  3N9L A;  4N4F A;  4IC2 A;  3O36 A;  4R2Y A;  3T6R A;  2LGV A;  3U5O A;  3FL2 A;  3IHP A;  3DPL R;  2QIC A;  1WIM A;  2CSZ A;  3O34 A;  2LXH C;  2XEU A;  4ZQL A;  4P5O B;  2JMI A;  5C13 A;  4WA6 A;  1Z60 A;  5DIN A;  2OXQ C;  4UP0 A;  1WES A;  3MHH A;  4GB0 A;  2YYR A;  2KWN A;  3O7A A;  3NG2 A;  3LQH A;  2YRE A;  1MM3 A;  3M99 A;  2VP7 A;  4WZ0 A;  5I3L A;  2KE1 A;  1WE9 A;  4FIP A;  2M3H A;  1DVP A;  2CKL A;  2L5U A;  4YAD A;  2UZG A;  1IYM A;  4F52 B;  2KWK A;  2G6Q A;  2K1J A;  2VPD A;  2M85 A;  2MUM A;  5H1V A;  5G0F A;  3O33 A;  4TKP B;  2E6R A;  2YQL A;  5FB1 A;  5C11 A;  2LV9 A;  4NN2 A;  3RTR B;  3SHB A;  3N9O A;  2LGK A;  4W4U A;  4B7Y C;  2K16 A;  4C9Z A;  2CKL B;  3O70 A;  3HCU A;  1U6G B;  2L75 A;  2RSD A;  4V3K C;  4Q6F A;  2M1R A;  3VK6 A;  1V87 A;  5B79 A;  2VJF A;  2XB1 A;  3KV5 A;  2EGP A;  4WZ3 B;  4UP5 A;  3LQI A;  4R7E A;  2VJE A;  2ECW A;  2FUI A;  2MNZ A;  3KV6 A;  5EYA F;  2KGI A;  5G05 B;  2EOD A;  4FO9 A;  2MD8 C;  3HCT A;  5KH7 A;  2L80 A;  4I7D A;  2G45 A;  2VPE A;  1FBV A;  1VD4 A;  2JRJ A;  2IDA A;  4A4B A;  3T7L A;  2KU3 A;  2LN0 A;  3U5P A;  2MA6 A;  2LQ6 A;  2LRI C;  4CCG X;  3L1Z B;  3PHD A;  2ZET C;  1LDK C;  2PNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...