1IYMA

Ring-h2 finger domain of el5
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AMDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Precision NMR Structure and Function of the RING-H2 Finger Domain of EL5, a Rice Protein Whose Expression Is Increased upon Exposure to Pathogen-derived Oligosaccharides
pubmed doi rcsb
molecule keywords EL5
molecule tags Dna binding protein
source organism Oryza sativa
total genus 4
structure length 55
sequence length 55
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2002-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13639 zf-RING_2 Ring finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1iymA00
1X4IA 2MT5A 1WEOA 1HYJA 4AVXA 2RI7A 3ASLA 3O7AA 5TABA 2LGGA 4LK9A 3N9NA 3SHBA 1WEUA 3FL2A 4FIPA 2E6RA 3LQJA 2M85A 2NAAA 2EODA 1JM7A 4CCGX 2L0BA 1V87A 4TKPB 2CSZA 2K17A 3RPGB 5TBNA 1X4UA 5LKXA 4PPEA 2ECTA 2VJEA 1WEEA 2CKLA 5LCWB 3ZNIA 5TRBA 2FUIA 4P5OB 5FB1A 2YW8A 4UP5A 2MNZA 2JRJA 4I7CA 4B7YC 2FUUA 4GB0A 4R7EA 3DPLR 2LV9A 2VJFB 4YADA 2QJ0A 4LKAA 1WEVA 2L5UA 4GNGA 1G25A 2KGGA 3U5PA 1X4JA 2YSMA 5AITA 5DKAA 4BHWA 2XB1A 5KH3A 3SOWA 4S3OC 4BBQA 3PHDA 2HDPA 4YBSA 1DVPA 2ECWA 4FJCA 4NN2A 2MA5A 2ECNA 2VPGA 4LLBA 4IC3A 2YHOA 1WILA 5B8DA 4YABA 2H0DA 2LXHC 2D8SA 2E6SA 4WZ2A 2ECIA 2ZETC 3L1ZB 5JG6A 3PUQA 1RMDA 4C9ZA 4L7XA 3SOUA 3U5OA 5D1MB 4YATA 4UP0A 2UZGA 2LN0A 2YU4A 3O70A 5KH7A 2JMIA 2KFTA 4AYCA 5J3XA 2KU3A 2KR4A 4YC9A 3MHHA 4WZ0A 2LGLA 1K2FA 2L43A 2VNFA 2CKLB 3ZYQA 4F52B 4YBMA 4ZQLA 2MA6A 1WEQA 3C6WA 2VPBA 3ZVYA 2KE1A 4UI9B 4IC2A 2LXPC 2Y1MA 3O35A 3KV5A 1FBVA 2KREA 3MHSA 4GNEA 5DINA 2DX8A 4FO9A 2YURA 2HYED 2Y1NA 4R2YA 5FEYA 3RTRB 2JMDA 3ZPV1 3V43A 3T7LA 2KYUA 5G05B 3PURA 2KWNA 2M3HA 5LKZA 1JOCA 2YHNA 1WIMA 4MSXA 3N9PA 2VPEA 2MNYA 3M62A 5D1LB 2C2VS 3I2DA 3DQVR 4FK5A 3NG2A 5D1KB 4AUQB 4A0CD 2M1RA 4N4FA 3KNVA 1LDKC 3N9LA 3SOXA 5H1VA 2LQ6A 5AIUA 3RPGC 2C2LA 3C5KA 4WA6A 3KV6A 5H1UA 5TDWA 2VP7A 1LDJB 4AP4A 3HCSA 3LQHA 1E4UA 1WENA 1N87A 3EB5A 3GL6A 4AYCB 1XWHA 4QF2A 1WEPA 3M63A 3N9OA 2VJFA 2F42A 4CA1A 3GV4A 4Q6FA 2MD8C 4O64A 2ECGA 5H9MA 2K4DA 2OXQC 2Y43A 3IHPA 2LGKA 1JM7B 2G45A 4LJNA 1VFYA 5H1TA 2JMJA 3ZPVE 2K16A 2G43A 5LKTA 4ZUXU 2BAYA 1U6GB 2YYRA 2IDAA 2VJEB 2KWOA 4YAXA 2YUCA 3HCUA 5B76A 3U5NA 4I7DA 3ZTGA 5KH9A 3EB6A 2CT2A 2MUMA 2YSJA 3T6RA 1WESA 5G0FA 4L58A 2L75A 1Z2QA 3O37A 2G6QA 5I3LA 5B77A 2M6MA 4B86C 1IYMA 4ZDTA 3O34A 4A4CA 4MVTA 2KGIA 2LRIC 1WGMA 4PTBA 2CSYA 2YQLA 4S3OB 2LGVA 5G04B 3O33A 3QZVA 2K1JA 5C11A 4WZ3B 2AN6A 1HYIA 1WEMA 2YT5A 1MM3A 2H0DB 3L1XA 2KIZA 2PNXA 4A4BA 1ZBDB 2LDRA 4A49A 5B75A 2YREA 4V3KC 1WE9A 4X3GA 5FB0A 5TDRA 1BORA 2QIZA 1VYXA 2L80A 4R8PK 2MD7B 1FP0A 3VK6A 2KWJA 2ECVA 1Z60A 4LADB 4V3LC 3LQIA 5C13A 1VD4A 1MM2A 2KWKA 2XEUA 1T1HA 5B78A 3U5MA 4W4UA 2FSAA 3M99A 2ECJA 3HCTA 3L11A 3ZVZB 4N3WA 2EA6A 3N9MA 4QF3A 2I50A 1F62A 3LRQA 2RSDA 4I7BA 1WEWA 1Z6UA 2PUYA 1WFKA 4GNDA 2F6NA 2EGPA 2QICA 5FERA 2VPDA 5B79A 2F6JA 1CHCA 4XI1A 3KQIA 3N9QA 2MIQA 3HTKC 4YBTA 5EYAF 5LKUA 2YQMA 3O36A 4GNFA
chains in the Genus database with same CATH superfamily
2FFWA 1X4IA 2MT5A 2DSMA 2JM3A 1WEOA 1HYJA 3O47A 4AVXA 2RI7A 3ASLA 3O7AA 5TABA 2LGGA 4LK9A 3N9NA 3SHBA 1WEUA 3FL2A 4FIPA 2E6RA 3LQJA 2M85A 2NAAA 2EODA 1JM7A 4CCGX 2B0OE 1V87A 2L0BA 4TKPB 2CSZA 2K17A 3RPGB 3LVQE 5TBNA 1X4UA 5LKXA 2P57A 4PPEA 2ECTA 2VJEA 1WEEA 2CKLA 4H9DA 5LCWB 3ZNIA 5TRBA 2FUIA 4P5OB 5FB1A 2YW8A 3T9KA 4UP5A 3FAOA 2MNZA 2JRJA 4I7CA 3LJUX 4B7YC 2FUUA 4GB0A 4R7EA 3DPLR 2LV9A 2VJFB 4YADA 2QJ0A 4LKAA 1WEVA 2L5UA 2XOYA 4GNGA 1G25A 2KGGA 3U5PA 1X4JA 2YSMA 5AITA 5DKAA 2XOCA 4BHWA 2XB1A 5KH3A 3SOWA 4S3OC 4BBQA 3PHDA 2HDPA 4YBSA 3JUEA 1DVPA 2ECWA 4FJCA 4NN2A 2MA5A 2ECNA 2VPGA 4F1PA 4LLBA 4IC3A 2YHOA 1WILA 3E2DA 5B8DA 4YABA 2H0DA 2LXHC 2D8SA 3LDYA 2E6SA 4WZ2A 5SVIB 2ECIA 2ZETC 3L1ZB 5JG6A 3PUQA 1RMDA 4C9ZA 4L7XA 3SOUA 3U5OA 5D1MB 4YATA 4UP0A 2UZGA 2LN0A 2YU4A 3O70A 5KH7A 2JMIA 2KFTA 4AYCA 5J3XA 1DCQA 2KU3A 2KR4A 4YC9A 3MHHA 4WZ0A 3FANA 2LGLA 1K2FA 5K3QA 2L43A 2VNFA 3H7HA 2CKLB 2XP0A 3PLWA 3ZYQA 4F52B 4YBMA 4ZQLA 2MA6A 1WEQA 3C6WA 2VPBA 2KKYA 3ZVYA 2KE1A 4UI9B 4IC2A 3Q1DA 2LXPC 2Y1MA 4OGCA 3O35A 3KV5A 1FBVA 2KREA 3MHSA 4GNEA 5DINA 2DX8A 4FO9A 2YURA 2HYED 2Y1NA 4R2YA 5FEYA 3RTRB 2JMDA 3ZPV1 3V43A 3T7LA 2KYUA 5G05B 1MBMA 3PURA 2KWNA 2M3HA 5LKZA 1JOCA 2YHNA 1WIMA 4MSXA 3N9PA 2VPEA 2MNYA 3M62A 5D1LB 2C2VS 3I2DA 3DQVR 4FK5A 3NG2A 5D1KB 4AUQB 4A0CD 2M1RA 4N4FA 3KNVA 1LDKC 3DWDA 3N9LA 3SOXA 5H1VA 3DDTA 2DJAA 2LQ6A 5AIUA 2KKXA 3RPGC 3MDBC 2C2LA 3C5KA 2MKEA 4WA6A 3KV6A 5H1UA 5TDWA 3KDEC 2VP7A 1LDJB 2RR4A 4AP4A 3HCSA 3LQHA 1E4UA 1WENA 1N87A 3FM8C 3EB5A 2CRRA 3GL6A 4AYCB 1XWHA 4QF2A 1WEPA 3M63A 3N9OA 2VJFA 2F42A 4CA1A 2YVRA 3GV4A 4Q6FA 2MD8C 2CONA 4O64A 2CSVA 2ECGA 5H9MA 2K4DA 4Z0RA 2OXQC 2Y43A 3IHPA 2LGKA 1JM7B 2G45A 4LJNA 1VFYA 5H1TA 2JMJA 3ZPVE 2K16A 2G43A 5LKTA 4ZUXU 2BAYA 3LVRE 1U6GB 2XOZA 2YYRA 2IDAA 2VJEB 5SVIA 2KWOA 4YAXA 2YUCA 4OGEA 3M7KA 3HCUA 5B76A 3U5NA 4I7DA 3ZTGA 5KH9A 3EB6A 2CT2A 2MUMA 3FJUB 2YSJA 1WESA 3T6RA 5G0FA 4L58A 2L75A 1Z2QA 2D8UA 2G6QA 3O37A 5I3LA 5B77A 2M6MA 3SUBA 4B86C 1IYMA 4ZDTA 3O34A 4A4CA 4MVTA 2KGIA 2LRIC 1WGMA 4PTBA 2CSYA 3FEHA 2YQLA 4S3OB 2LGVA 5G04B 5SVYA 3O33A 3QZVA 2K1JA 5C11A 4WZ3B 2AN6A 1HYIA 2LAUA 1WEMA 2YT5A 1MM3A 2H0DB 3L1XA 2KIZA 2PNXA 4A4BA 1ZBDB 2LDRA 4A49A 5B75A 2IQJA 2YREA 2JUNA 4O62A 2FD4A 4V3KC 1WE9A 4X3GA 5FB0A 5TDRA 1BORA 2QIZA 1VYXA 2L80A 4R8PK 2MD7B 1FP0A 2E61A 4QQ4A 3VK6A 2KWJA 2ECVA 1Z60A 4LADB 4V3LC 3LQIA 5C13A 1VD4A 1MM2A 2KWKA 2XEUA 1T1HA 5B78A 3U5MA 4W4UA 2CRWA 2FSAA 3M99A 2EXUA 2ECJA 3HCTA 3L11A 5SVXA 3ZVZB 4N3WA 2EA6A 3N9MA 4QF3A 2I50A 1F62A 4Z0OA 3LRQA 2RSDA 4I7BA 1WEWA 1Z6UA 2PUYA 1WFKA 2L7PA 4GNDA 2F6NA 2M13A 2EGPA 2QICA 5FERA 2VPDA 5B79A 2F6JA 1CHCA 2EGMA 4XI1A 3KQIA 3N9QA 2MIQA 3HTKC 4YBTA 5EYAF 5LKUA 2YQMA 3O36A 2OWAA 4GNFA
chains in the Genus database with same CATH topology
1X4IA 2MT5A 1WEOA 1HYJA 4AVXA 2RI7A 3ASLA 3O7AA 5TABA 2LGGA 4LK9A 3N9NA 3SHBA 1WEUA 3FL2A 4FIPA 2E6RA 3LQJA 2M85A 2NAAA 2EODA 1JM7A 4CCGX 2L0BA 1V87A 4TKPB 2CSZA 2K17A 3RPGB 5TBNA 1X4UA 5LKXA 4PPEA 2ECTA 2VJEA 1WEEA 2CKLA 5LCWB 3ZNIA 5TRBA 2FUIA 4P5OB 5FB1A 2YW8A 4UP5A 2MNZA 2JRJA 4I7CA 4B7YC 2FUUA 4GB0A 4R7EA 3DPLR 2LV9A 2VJFB 4YADA 2QJ0A 4LKAA 1WEVA 2L5UA 4GNGA 1G25A 2KGGA 3U5PA 1X4JA 2YSMA 5AITA 5DKAA 4BHWA 2XB1A 5KH3A 3SOWA 4S3OC 4BBQA 3PHDA 2HDPA 4YBSA 1DVPA 2ECWA 4FJCA 4NN2A 2MA5A 2ECNA 2VPGA 4LLBA 4IC3A 2YHOA 1WILA 5B8DA 4YABA 2H0DA 2LXHC 2D8SA 2E6SA 4WZ2A 2ECIA 2ZETC 3L1ZB 5JG6A 3PUQA 1RMDA 4C9ZA 4L7XA 3SOUA 3U5OA 5D1MB 4YATA 4UP0A 2UZGA 2LN0A 2YU4A 3O70A 5KH7A 2JMIA 2KFTA 4AYCA 5J3XA 2KU3A 2KR4A 4YC9A 3MHHA 4WZ0A 2LGLA 1K2FA 2L43A 2VNFA 2CKLB 3ZYQA 4F52B 4YBMA 4ZQLA 2MA6A 1WEQA 3C6WA 2VPBA 3ZVYA 2KE1A 4UI9B 4IC2A 2LXPC 2Y1MA 3O35A 3KV5A 1FBVA 2KREA 3MHSA 4GNEA 5DINA 2DX8A 4FO9A 2YURA 2HYED 2Y1NA 4R2YA 5FEYA 3RTRB 2JMDA 3ZPV1 3V43A 3T7LA 2KYUA 5G05B 3PURA 2KWNA 2M3HA 5LKZA 1JOCA 2YHNA 1WIMA 4MSXA 3N9PA 2VPEA 2MNYA 3M62A 5D1LB 2C2VS 3I2DA 3DQVR 4FK5A 3NG2A 5D1KB 4AUQB 4A0CD 2M1RA 4N4FA 3KNVA 1LDKC 3N9LA 3SOXA 5H1VA 2LQ6A 5AIUA 3RPGC 2C2LA 3C5KA 4WA6A 3KV6A 5H1UA 5TDWA 2VP7A 1LDJB 4AP4A 3HCSA 3LQHA 1E4UA 1WENA 1N87A 3EB5A 3GL6A 4AYCB 1XWHA 4QF2A 1WEPA 3M63A 3N9OA 2VJFA 2F42A 4CA1A 3GV4A 4Q6FA 2MD8C 4O64A 2ECGA 5H9MA 2K4DA 2OXQC 2Y43A 3IHPA 2LGKA 1JM7B 2G45A 4LJNA 1VFYA 5H1TA 2JMJA 3ZPVE 2K16A 2G43A 5LKTA 4ZUXU 2BAYA 1U6GB 2YYRA 2IDAA 2VJEB 2KWOA 4YAXA 2YUCA 3HCUA 5B76A 3U5NA 4I7DA 3ZTGA 5KH9A 3EB6A 2CT2A 2MUMA 2YSJA 3T6RA 1WESA 5G0FA 4L58A 2L75A 1Z2QA 3O37A 2G6QA 5I3LA 5B77A 2M6MA 4B86C 1IYMA 4ZDTA 3O34A 4A4CA 4MVTA 2KGIA 2LRIC 1WGMA 4PTBA 2CSYA 2YQLA 4S3OB 2LGVA 5G04B 3O33A 3QZVA 2K1JA 5C11A 4WZ3B 2AN6A 1HYIA 1WEMA 2YT5A 1MM3A 2H0DB 3L1XA 2KIZA 2PNXA 4A4BA 1ZBDB 2LDRA 4A49A 5B75A 2YREA 4V3KC 1WE9A 4X3GA 5FB0A 5TDRA 1BORA 2QIZA 1VYXA 2L80A 4R8PK 2MD7B 1FP0A 3VK6A 2KWJA 2ECVA 1Z60A 4LADB 4V3LC 3LQIA 5C13A 1VD4A 1MM2A 2KWKA 2XEUA 1T1HA 5B78A 3U5MA 4W4UA 2FSAA 3M99A 2ECJA 3HCTA 3L11A 3ZVZB 4N3WA 2EA6A 3N9MA 4QF3A 2I50A 1F62A 3LRQA 2RSDA 4I7BA 1WEWA 1Z6UA 2PUYA 1WFKA 4GNDA 2F6NA 2EGPA 2QICA 5FERA 2VPDA 5B79A 2F6JA 1CHCA 4XI1A 3KQIA 3N9QA 2MIQA 3HTKC 4YBTA 5EYAF 5LKUA 2YQMA 3O36A 4GNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4I A;  2MT5 A;  1WEO A;  1HYJ A;  4AVX A;  2RI7 A;  3ASL A;  3O7A A;  5TAB A;  2LGG A;  4LK9 A;  3N9N A;  3SHB A;  1WEU A;  3FL2 A;  4FIP A;  2E6R A;  3LQJ A;  2M85 A;  2NAA A;  2EOD A;  1JM7 A;  4CCG X;  2L0B A;  1V87 A;  4TKP B;  2CSZ A;  2K17 A;  3RPG B;  5TBN A;  1X4U A;  5LKX A;  4PPE A;  2ECT A;  2VJE A;  1WEE A;  2CKL A;  5LCW B;  3ZNI A;  5TRB A;  2FUI A;  4P5O B;  5FB1 A;  2YW8 A;  4UP5 A;  2MNZ A;  2JRJ A;  4I7C A;  4B7Y C;  2FUU A;  4GB0 A;  4R7E A;  3DPL R;  2LV9 A;  2VJF B;  4YAD A;  2QJ0 A;  4LKA A;  1WEV A;  2L5U A;  4GNG A;  1G25 A;  2KGG A;  3U5P A;  1X4J A;  2YSM A;  5AIT A;  5DKA A;  4BHW A;  2XB1 A;  5KH3 A;  3SOW A;  4S3O C;  4BBQ A;  3PHD A;  2HDP A;  4YBS A;  1DVP A;  2ECW A;  4FJC A;  4NN2 A;  2MA5 A;  2ECN A;  2VPG A;  4LLB A;  4IC3 A;  2YHO A;  1WIL A;  5B8D A;  4YAB A;  2H0D A;  2LXH C;  2D8S A;  2E6S A;  4WZ2 A;  2ECI A;  2ZET C;  3L1Z B;  5JG6 A;  3PUQ A;  1RMD A;  4C9Z A;  4L7X A;  3SOU A;  3U5O A;  5D1M B;  4YAT A;  4UP0 A;  2UZG A;  2LN0 A;  2YU4 A;  3O70 A;  5KH7 A;  2JMI A;  2KFT A;  4AYC A;  5J3X A;  2KU3 A;  2KR4 A;  4YC9 A;  3MHH A;  4WZ0 A;  2LGL A;  1K2F A;  2L43 A;  2VNF A;  2CKL B;  3ZYQ A;  4F52 B;  4YBM A;  4ZQL A;  2MA6 A;  1WEQ A;  3C6W A;  2VPB A;  3ZVY A;  2KE1 A;  4UI9 B;  4IC2 A;  2LXP C;  2Y1M A;  3O35 A;  3KV5 A;  1FBV A;  2KRE A;  3MHS A;  4GNE A;  5DIN A;  2DX8 A;  4FO9 A;  2YUR A;  2HYE D;  2Y1N A;  4R2Y A;  5FEY A;  3RTR B;  2JMD A;  3ZPV 1;  3V43 A;  3T7L A;  2KYU A;  5G05 B;  3PUR A;  2KWN A;  2M3H A;  5LKZ A;  1JOC A;  2YHN A;  1WIM A;  4MSX A;  3N9P A;  2VPE A;  2MNY A;  3M62 A;  5D1L B;  2C2V S;  3I2D A;  3DQV R;  4FK5 A;  3NG2 A;  5D1K B;  4AUQ B;  4A0C D;  2M1R A;  4N4F A;  3KNV A;  1LDK C;  3N9L A;  3SOX A;  5H1V A;  2LQ6 A;  5AIU A;  3RPG C;  2C2L A;  3C5K A;  4WA6 A;  3KV6 A;  5H1U A;  5TDW A;  2VP7 A;  1LDJ B;  4AP4 A;  3HCS A;  3LQH A;  1E4U A;  1WEN A;  1N87 A;  3EB5 A;  3GL6 A;  4AYC B;  1XWH A;  4QF2 A;  1WEP A;  3M63 A;  3N9O A;  2VJF A;  2F42 A;  4CA1 A;  3GV4 A;  4Q6F A;  2MD8 C;  4O64 A;  2ECG A;  5H9M A;  2K4D A;  2OXQ C;  2Y43 A;  3IHP A;  2LGK A;  1JM7 B;  2G45 A;  4LJN A;  1VFY A;  5H1T A;  2JMJ A;  3ZPV E;  2K16 A;  2G43 A;  5LKT A;  4ZUX U;  2BAY A;  1U6G B;  2YYR A;  2IDA A;  2VJE B;  2KWO A;  4YAX A;  2YUC A;  3HCU A;  5B76 A;  3U5N A;  4I7D A;  3ZTG A;  5KH9 A;  3EB6 A;  2CT2 A;  2MUM A;  2YSJ A;  3T6R A;  1WES A;  5G0F A;  4L58 A;  2L75 A;  1Z2Q A;  3O37 A;  2G6Q A;  5I3L A;  5B77 A;  2M6M A;  4B86 C;  1IYM A;  4ZDT A;  3O34 A;  4A4C A;  4MVT A;  2KGI A;  2LRI C;  1WGM A;  4PTB A;  2CSY A;  2YQL A;  4S3O B;  2LGV A;  5G04 B;  3O33 A;  3QZV A;  2K1J A;  5C11 A;  4WZ3 B;  2AN6 A;  1HYI A;  1WEM A;  2YT5 A;  1MM3 A;  2H0D B;  3L1X A;  2KIZ A;  2PNX A;  4A4B A;  1ZBD B;  2LDR A;  4A49 A;  5B75 A;  2YRE A;  4V3K C;  1WE9 A;  4X3G A;  5FB0 A;  5TDR A;  1BOR A;  2QIZ A;  1VYX A;  2L80 A;  4R8P K;  2MD7 B;  1FP0 A;  3VK6 A;  2KWJ A;  2ECV A;  1Z60 A;  4LAD B;  4V3L C;  3LQI A;  5C13 A;  1VD4 A;  1MM2 A;  2KWK A;  2XEU A;  1T1H A;  5B78 A;  3U5M A;  4W4U A;  2FSA A;  3M99 A;  2ECJ A;  3HCT A;  3L11 A;  3ZVZ B;  4N3W A;  2EA6 A;  3N9M A;  4QF3 A;  2I50 A;  1F62 A;  3LRQ A;  2RSD A;  4I7B A;  1WEW A;  1Z6U A;  2PUY A;  1WFK A;  4GND A;  2F6N A;  2EGP A;  2QIC A;  5FER A;  2VPD A;  5B79 A;  2F6J A;  1CHC A;  4XI1 A;  3KQI A;  3N9Q A;  2MIQ A;  3HTK C;  4YBT A;  5EYA F;  5LKU A;  2YQM A;  3O36 A;  4GNF A; 
#chains in the Genus database with same CATH topology
 2FFW A;  1X4I A;  2MT5 A;  2DSM A;  2JM3 A;  1WEO A;  1HYJ A;  3O47 A;  4AVX A;  2RI7 A;  3ASL A;  3O7A A;  5TAB A;  2LGG A;  4LK9 A;  3N9N A;  3SHB A;  1WEU A;  3FL2 A;  4FIP A;  2E6R A;  3LQJ A;  2M85 A;  2NAA A;  2EOD A;  1JM7 A;  4CCG X;  2B0O E;  1V87 A;  2L0B A;  4TKP B;  2CSZ A;  2K17 A;  3RPG B;  3LVQ E;  5TBN A;  1X4U A;  5LKX A;  2P57 A;  4PPE A;  2ECT A;  2VJE A;  1WEE A;  2CKL A;  4H9D A;  5LCW B;  3ZNI A;  5TRB A;  2FUI A;  4P5O B;  5FB1 A;  2YW8 A;  3T9K A;  4UP5 A;  3FAO A;  2MNZ A;  2JRJ A;  4I7C A;  3LJU X;  4B7Y C;  2FUU A;  4GB0 A;  4R7E A;  3DPL R;  2LV9 A;  2VJF B;  4YAD A;  2QJ0 A;  4LKA A;  1WEV A;  2L5U A;  2XOY A;  4GNG A;  1G25 A;  2KGG A;  3U5P A;  1X4J A;  2YSM A;  5AIT A;  5DKA A;  2XOC A;  4BHW A;  2XB1 A;  5KH3 A;  3SOW A;  4S3O C;  4BBQ A;  3PHD A;  2HDP A;  4YBS A;  3JUE A;  1DVP A;  2ECW A;  4FJC A;  4NN2 A;  2MA5 A;  2ECN A;  2VPG A;  4F1P A;  4LLB A;  4IC3 A;  2YHO A;  1WIL A;  3E2D A;  5B8D A;  4YAB A;  2H0D A;  2LXH C;  2D8S A;  3LDY A;  2E6S A;  4WZ2 A;  5SVI B;  2ECI A;  2ZET C;  3L1Z B;  5JG6 A;  3PUQ A;  1RMD A;  4C9Z A;  4L7X A;  3SOU A;  3U5O A;  5D1M B;  4YAT A;  4UP0 A;  2UZG A;  2LN0 A;  2YU4 A;  3O70 A;  5KH7 A;  2JMI A;  2KFT A;  4AYC A;  5J3X A;  1DCQ A;  2KU3 A;  2KR4 A;  4YC9 A;  3MHH A;  4WZ0 A;  3FAN A;  2LGL A;  1K2F A;  5K3Q A;  2L43 A;  2VNF A;  3H7H A;  2CKL B;  2XP0 A;  3PLW A;  3ZYQ A;  4F52 B;  4YBM A;  4ZQL A;  2MA6 A;  1WEQ A;  3C6W A;  2VPB A;  2KKY A;  3ZVY A;  2KE1 A;  4UI9 B;  4IC2 A;  3Q1D A;  2LXP C;  2Y1M A;  4OGC A;  3O35 A;  3KV5 A;  1FBV A;  2KRE A;  3MHS A;  4GNE A;  5DIN A;  2DX8 A;  4FO9 A;  2YUR A;  2HYE D;  2Y1N A;  4R2Y A;  5FEY A;  3RTR B;  2JMD A;  3ZPV 1;  3V43 A;  3T7L A;  2KYU A;  5G05 B;  1MBM A;  3PUR A;  2KWN A;  2M3H A;  5LKZ A;  1JOC A;  2YHN A;  1WIM A;  4MSX A;  3N9P A;  2VPE A;  2MNY A;  3M62 A;  5D1L B;  2C2V S;  3I2D A;  3DQV R;  4FK5 A;  3NG2 A;  5D1K B;  4AUQ B;  4A0C D;  2M1R A;  4N4F A;  3KNV A;  1LDK C;  3DWD A;  3N9L A;  3SOX A;  5H1V A;  3DDT A;  2DJA A;  2LQ6 A;  5AIU A;  2KKX A;  3RPG C;  3MDB C;  2C2L A;  3C5K A;  2MKE A;  4WA6 A;  3KV6 A;  5H1U A;  5TDW A;  3KDE C;  2VP7 A;  1LDJ B;  2RR4 A;  4AP4 A;  3HCS A;  3LQH A;  1E4U A;  1WEN A;  1N87 A;  3FM8 C;  3EB5 A;  2CRR A;  3GL6 A;  4AYC B;  1XWH A;  4QF2 A;  1WEP A;  3M63 A;  3N9O A;  2VJF A;  2F42 A;  4CA1 A;  2YVR A;  3GV4 A;  4Q6F A;  2MD8 C;  2CON A;  4O64 A;  2CSV A;  2ECG A;  5H9M A;  2K4D A;  4Z0R A;  2OXQ C;  2Y43 A;  3IHP A;  2LGK A;  1JM7 B;  2G45 A;  4LJN A;  1VFY A;  5H1T A;  2JMJ A;  3ZPV E;  2K16 A;  2G43 A;  5LKT A;  4ZUX U;  2BAY A;  3LVR E;  1U6G B;  2XOZ A;  2YYR A;  2IDA A;  2VJE B;  5SVI A;  2KWO A;  4YAX A;  2YUC A;  4OGE A;  3M7K A;  3HCU A;  5B76 A;  3U5N A;  4I7D A;  3ZTG A;  5KH9 A;  3EB6 A;  2CT2 A;  2MUM A;  3FJU B;  2YSJ A;  1WES A;  3T6R A;  5G0F A;  4L58 A;  2L75 A;  1Z2Q A;  2D8U A;  2G6Q A;  3O37 A;  5I3L A;  5B77 A;  2M6M A;  3SUB A;  4B86 C;  1IYM A;  4ZDT A;  3O34 A;  4A4C A;  4MVT A;  2KGI A;  2LRI C;  1WGM A;  4PTB A;  2CSY A;  3FEH A;  2YQL A;  4S3O B;  2LGV A;  5G04 B;  5SVY A;  3O33 A;  3QZV A;  2K1J A;  5C11 A;  4WZ3 B;  2AN6 A;  1HYI A;  2LAU A;  1WEM A;  2YT5 A;  1MM3 A;  2H0D B;  3L1X A;  2KIZ A;  2PNX A;  4A4B A;  1ZBD B;  2LDR A;  4A49 A;  5B75 A;  2IQJ A;  2YRE A;  2JUN A;  4O62 A;  2FD4 A;  4V3K C;  1WE9 A;  4X3G A;  5FB0 A;  5TDR A;  1BOR A;  2QIZ A;  1VYX A;  2L80 A;  4R8P K;  2MD7 B;  1FP0 A;  2E61 A;  4QQ4 A;  3VK6 A;  2KWJ A;  2ECV A;  1Z60 A;  4LAD B;  4V3L C;  3LQI A;  5C13 A;  1VD4 A;  1MM2 A;  2KWK A;  2XEU A;  1T1H A;  5B78 A;  3U5M A;  4W4U A;  2CRW A;  2FSA A;  3M99 A;  2EXU A;  2ECJ A;  3HCT A;  3L11 A;  5SVX A;  3ZVZ B;  4N3W A;  2EA6 A;  3N9M A;  4QF3 A;  2I50 A;  1F62 A;  4Z0O A;  3LRQ A;  2RSD A;  4I7B A;  1WEW A;  1Z6U A;  2PUY A;  1WFK A;  2L7P A;  4GND A;  2F6N A;  2M13 A;  2EGP A;  2QIC A;  5FER A;  2VPD A;  5B79 A;  2F6J A;  1CHC A;  2EGM A;  4XI1 A;  3KQI A;  3N9Q A;  2MIQ A;  3HTK C;  4YBT A;  5EYA F;  5LKU A;  2YQM A;  3O36 A;  2OWA A;  4GNF A; 
#chains in the Genus database with same CATH homology
 1X4I A;  2MT5 A;  1WEO A;  1HYJ A;  4AVX A;  2RI7 A;  3ASL A;  3O7A A;  5TAB A;  2LGG A;  4LK9 A;  3N9N A;  3SHB A;  1WEU A;  3FL2 A;  4FIP A;  2E6R A;  3LQJ A;  2M85 A;  2NAA A;  2EOD A;  1JM7 A;  4CCG X;  2L0B A;  1V87 A;  4TKP B;  2CSZ A;  2K17 A;  3RPG B;  5TBN A;  1X4U A;  5LKX A;  4PPE A;  2ECT A;  2VJE A;  1WEE A;  2CKL A;  5LCW B;  3ZNI A;  5TRB A;  2FUI A;  4P5O B;  5FB1 A;  2YW8 A;  4UP5 A;  2MNZ A;  2JRJ A;  4I7C A;  4B7Y C;  2FUU A;  4GB0 A;  4R7E A;  3DPL R;  2LV9 A;  2VJF B;  4YAD A;  2QJ0 A;  4LKA A;  1WEV A;  2L5U A;  4GNG A;  1G25 A;  2KGG A;  3U5P A;  1X4J A;  2YSM A;  5AIT A;  5DKA A;  4BHW A;  2XB1 A;  5KH3 A;  3SOW A;  4S3O C;  4BBQ A;  3PHD A;  2HDP A;  4YBS A;  1DVP A;  2ECW A;  4FJC A;  4NN2 A;  2MA5 A;  2ECN A;  2VPG A;  4LLB A;  4IC3 A;  2YHO A;  1WIL A;  5B8D A;  4YAB A;  2H0D A;  2LXH C;  2D8S A;  2E6S A;  4WZ2 A;  2ECI A;  2ZET C;  3L1Z B;  5JG6 A;  3PUQ A;  1RMD A;  4C9Z A;  4L7X A;  3SOU A;  3U5O A;  5D1M B;  4YAT A;  4UP0 A;  2UZG A;  2LN0 A;  2YU4 A;  3O70 A;  5KH7 A;  2JMI A;  2KFT A;  4AYC A;  5J3X A;  2KU3 A;  2KR4 A;  4YC9 A;  3MHH A;  4WZ0 A;  2LGL A;  1K2F A;  2L43 A;  2VNF A;  2CKL B;  3ZYQ A;  4F52 B;  4YBM A;  4ZQL A;  2MA6 A;  1WEQ A;  3C6W A;  2VPB A;  3ZVY A;  2KE1 A;  4UI9 B;  4IC2 A;  2LXP C;  2Y1M A;  3O35 A;  3KV5 A;  1FBV A;  2KRE A;  3MHS A;  4GNE A;  5DIN A;  2DX8 A;  4FO9 A;  2YUR A;  2HYE D;  2Y1N A;  4R2Y A;  5FEY A;  3RTR B;  2JMD A;  3ZPV 1;  3V43 A;  3T7L A;  2KYU A;  5G05 B;  3PUR A;  2KWN A;  2M3H A;  5LKZ A;  1JOC A;  2YHN A;  1WIM A;  4MSX A;  3N9P A;  2VPE A;  2MNY A;  3M62 A;  5D1L B;  2C2V S;  3I2D A;  3DQV R;  4FK5 A;  3NG2 A;  5D1K B;  4AUQ B;  4A0C D;  2M1R A;  4N4F A;  3KNV A;  1LDK C;  3N9L A;  3SOX A;  5H1V A;  2LQ6 A;  5AIU A;  3RPG C;  2C2L A;  3C5K A;  4WA6 A;  3KV6 A;  5H1U A;  5TDW A;  2VP7 A;  1LDJ B;  4AP4 A;  3HCS A;  3LQH A;  1E4U A;  1WEN A;  1N87 A;  3EB5 A;  3GL6 A;  4AYC B;  1XWH A;  4QF2 A;  1WEP A;  3M63 A;  3N9O A;  2VJF A;  2F42 A;  4CA1 A;  3GV4 A;  4Q6F A;  2MD8 C;  4O64 A;  2ECG A;  5H9M A;  2K4D A;  2OXQ C;  2Y43 A;  3IHP A;  2LGK A;  1JM7 B;  2G45 A;  4LJN A;  1VFY A;  5H1T A;  2JMJ A;  3ZPV E;  2K16 A;  2G43 A;  5LKT A;  4ZUX U;  2BAY A;  1U6G B;  2YYR A;  2IDA A;  2VJE B;  2KWO A;  4YAX A;  2YUC A;  3HCU A;  5B76 A;  3U5N A;  4I7D A;  3ZTG A;  5KH9 A;  3EB6 A;  2CT2 A;  2MUM A;  2YSJ A;  3T6R A;  1WES A;  5G0F A;  4L58 A;  2L75 A;  1Z2Q A;  3O37 A;  2G6Q A;  5I3L A;  5B77 A;  2M6M A;  4B86 C;  1IYM A;  4ZDT A;  3O34 A;  4A4C A;  4MVT A;  2KGI A;  2LRI C;  1WGM A;  4PTB A;  2CSY A;  2YQL A;  4S3O B;  2LGV A;  5G04 B;  3O33 A;  3QZV A;  2K1J A;  5C11 A;  4WZ3 B;  2AN6 A;  1HYI A;  1WEM A;  2YT5 A;  1MM3 A;  2H0D B;  3L1X A;  2KIZ A;  2PNX A;  4A4B A;  1ZBD B;  2LDR A;  4A49 A;  5B75 A;  2YRE A;  4V3K C;  1WE9 A;  4X3G A;  5FB0 A;  5TDR A;  1BOR A;  2QIZ A;  1VYX A;  2L80 A;  4R8P K;  2MD7 B;  1FP0 A;  3VK6 A;  2KWJ A;  2ECV A;  1Z60 A;  4LAD B;  4V3L C;  3LQI A;  5C13 A;  1VD4 A;  1MM2 A;  2KWK A;  2XEU A;  1T1H A;  5B78 A;  3U5M A;  4W4U A;  2FSA A;  3M99 A;  2ECJ A;  3HCT A;  3L11 A;  3ZVZ B;  4N3W A;  2EA6 A;  3N9M A;  4QF3 A;  2I50 A;  1F62 A;  3LRQ A;  2RSD A;  4I7B A;  1WEW A;  1Z6U A;  2PUY A;  1WFK A;  4GND A;  2F6N A;  2EGP A;  2QIC A;  5FER A;  2VPD A;  5B79 A;  2F6J A;  1CHC A;  4XI1 A;  3KQI A;  3N9Q A;  2MIQ A;  3HTK C;  4YBT A;  5EYA F;  5LKU A;  2YQM A;  3O36 A;  4GNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...