1JM7B

Solution structure of the brca1/bard1 ring-domain heterodimer
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREPVCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNELSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a BRCA1-BARD1 heterodimeric RING-RING complex.
pubmed doi rcsb
molecule keywords BREAST CANCER TYPE 1 SUSCEPTIBILITY PROTEIN
molecule tags Antitumor
source organism Homo sapiens
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14835 zf-RING_6 zf-RING of BARD1-type protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 1jm7B00
3M99A 2MIQA 2MT5A 4WZ3B 1WEUA 2ZETC 2MNZA 2Y1MA 4S3OB 2FUUA 5LCWB 1ZBDB 2VJFB 2KREA 3EB6A 5H1VA 2HYED 2KFTA 3O37A 2L80A 3N9PA 3ZVYA 3N9LA 1T1HA 2L75A 5AITA 2PUYA 2MNYA 5FB0A 1MM2A 3PURA 2ECTA 3ZVZB 2JMJA 3IHPA 5B78A 4R2YA 4L58A 5B76A 4YABA 4LK9A 5TABA 4WA6A 4LLBA 3ZPVE 3O7AA 3SOUA 3T6RA 4YBTA 3N9OA 2KE1A 1JM7A 2CSZA 2VNFA 3ASLA 4YBMA 4UI9B 2K4DA 2YT5A 1WEQA 3HTKC 3KNVA 2KWNA 4A0CD 4PPEA 1G25A 3RPGB 2VPBA 2VPGA 1HYJA 5LKUA 3SOXA 4ZDTA 3ZPV1 2ECVA 3SOWA 2MD8C 5LKZA 2Y43A 3GL6A 1MM3A 2YQLA 2VPDA 2L0BA 3NG2A 2KWKA 2HDPA 2KWOA 3M62A 2YU4A 4XI1A 1RMDA 4P5OB 2LGVA 2C2VS 4YC9A 5B8DA 2M85A 2RI7A 4AP4A 3KV5A 2CKLB 1Z6UA 3O35A 1WESA 1VFYA 5D1KB 3O36A 1WILA 1WFKA 4FK5A 1XWHA 4MSXA 1F62A 2NAAA 3U5PA 3C6WA 4R8PK 3QZVA 4B86C 2KU3A 3PHDA 4CA1A 3DQVR 2OXQC 1WIMA 2EODA 3LRQA 2E6RA 2EGPA 3ZTGA 4LADB 4GNFA 4GNDA 4NN2A 2KWJA 2VJEA 2UZGA 2F6NA 4GB0A 1WENA 2CSYA 3LQIA 3KV6A 4I7CA 5G04B 3M63A 4V3LC 3L11A 2Y1NA 3DPLR 2LXPC 1K2FA 2G6QA 4AYCB 2KGGA 4FO9A 1FBVA 4IC3A 4UP5A 5DINA 1WEMA 3VK6A 2CT2A 3N9QA 3U5MA 1N87A 2FUIA 1U6GB 2LV9A 4FJCA 5AIUA 2ECNA 3MHSA 1IYMA 2YREA 4MVTA 2H0DB 3V43A 3HCTA 2MUMA 5TDWA 3C5KA 2K1JA 2YSMA 5FEYA 3L1ZB 2JMIA 4I7DA 2VJFA 2ECWA 2E6SA 2YQMA 2YW8A 3FL2A 4YBSA 2YHOA 4BBQA 1WEOA 3ZYQA 3PUQA 2ECGA 3LQHA 4GNGA 4LJNA 2QJ0A 2ECJA 4C9ZA 2JMDA 2MA6A 2DX8A 5DKAA 2D8SA 2L43A 2AN6A 5FB1A 5H1UA 4N3WA 2I50A 4N4FA 1LDKC 2LGKA 4S3OC 2ECIA 2XB1A 5KH9A 3GV4A 2LN0A 4A4BA 3ZNIA 2YHNA 5KH3A 5TBNA 3HCUA 1X4JA 2MA5A 2XEUA 3U5OA 2LRIC 2YURA 5C13A 2JRJA 1JM7B 1X4UA 2C2LA 2VPEA 3LQJA 2LQ6A 4WZ0A 5LKTA 3RTRB 3MHHA 4X3GA 5TRBA 2BAYA 4QF3A 2KIZA 1BORA 2H0DA 4ZQLA 2F42A 2EA6A 4YADA 2QIZA 2YUCA 4A49A 2LXHC 1Z60A 1X4IA 2M6MA 5H1TA 2KGIA 4PTBA 4V3KC 5TDRA 1WEWA 2L5UA 3U5NA 3HCSA 2YYRA 5B79A 1VD4A 4LKAA 2MD7B 4I7BA 3RPGC 1WEPA 4F52B 5LKXA 5KH7A 2KR4A 4YAXA 1WGMA 4R7EA 2LDRA 4AVXA 2RSDA 4CCGX 1DVPA 2K17A 2CKLA 2G45A 2M1RA 1V87A 5B75A 5G05B 4IC2A 4YATA 5EYAF 3I2DA 5D1MB 5FERA 5D1LB 3O33A 4B7YC 4Q6FA 1LDJB 3EB5A 1FP0A 3N9NA 4ZUXU 4BHWA 4FIPA 2LGGA 4L7XA 5I3LA 2LGLA 1JOCA 2VJEB 1HYIA 5JG6A 1WEVA 5H9MA 2FSAA 4QF2A 2M3HA 1WE9A 3T7LA 3N9MA 4W4UA 2IDAA 3L1XA 4GNEA 3SHBA 1VYXA 4UP0A 1CHCA 2G43A 1WEEA 2KYUA 4A4CA 4WZ2A 1Z2QA 5G0FA 3KQIA 2PNXA 3O70A 1E4UA 2K16A 5J3XA 4O64A 2VP7A 5B77A 2QICA 4TKPB 4AUQB 5C11A 2F6JA 3O34A 4AYCA 2YSJA
chains in the Genus database with same CATH superfamily
3M99A 2JM3A 2MIQA 3FM8C 2MT5A 4WZ3B 1WEUA 2ZETC 4F1PA 2MNZA 2Y1MA 4S3OB 2FUUA 5LCWB 1ZBDB 3O47A 2VJFB 3T9KA 2KREA 3EB6A 5H1VA 5SVIB 2HYED 2OWAA 2KFTA 3O37A 2L80A 3N9PA 3ZVYA 3N9LA 2L7PA 1T1HA 2L75A 5AITA 2PUYA 2MNYA 5FB0A 1MM2A 3PURA 3JUEA 2ECTA 3ZVZB 2JMJA 3IHPA 5B78A 4R2YA 4L58A 5B76A 4YABA 4LK9A 5TABA 4WA6A 4LLBA 3ZPVE 3O7AA 3SOUA 3T6RA 4OGEA 4YBTA 3N9OA 2KE1A 1JM7A 2CSZA 4QQ4A 2VNFA 3ASLA 4YBMA 4UI9B 2K4DA 2YT5A 1WEQA 3HTKC 3KNVA 2KWNA 3H7HA 4A0CD 4PPEA 1G25A 3RPGB 2VPBA 2VPGA 1HYJA 5LKUA 2LAUA 3SOXA 4ZDTA 3ZPV1 2ECVA 3SOWA 2MD8C 5LKZA 2Y43A 2KKXA 3GL6A 1MM3A 2YQLA 2VPDA 2L0BA 3NG2A 2KWKA 2HDPA 2KWOA 3M62A 2IQJA 2YU4A 4XI1A 1RMDA 4P5OB 2LGVA 2C2VS 4YC9A 5B8DA 2M85A 5K3QA 2RI7A 4AP4A 3KV5A 2CKLB 1Z6UA 3O35A 1WESA 1VFYA 5D1KB 3O36A 5SVXA 2CONA 1WILA 1WFKA 4FK5A 1XWHA 3DWDA 4MSXA 1F62A 2NAAA 3U5PA 3C6WA 4R8PK 3QZVA 4B86C 2EGMA 2KU3A 3PHDA 4CA1A 3DQVR 2OXQC 1WIMA 2EODA 3LRQA 2E6RA 2EGPA 3ZTGA 3KDEC 4LADB 4GNFA 4GNDA 4NN2A 2KWJA 2VJEA 2UZGA 3E2DA 2F6NA 4GB0A 2JUNA 1WENA 2CSYA 3LQIA 3KV6A 4O62A 4I7CA 3M7KA 5G04B 3M63A 4V3LC 3L11A 2Y1NA 3DPLR 2LXPC 1K2FA 3Q1DA 2G6QA 2CSVA 4AYCB 2KGGA 4FO9A 1FBVA 4IC3A 4UP5A 5DINA 1WEMA 3DDTA 3VK6A 2CRWA 2CT2A 3N9QA 1N87A 3U5MA 2FUIA 1U6GB 2LV9A 4FJCA 5AIUA 3FEHA 2ECNA 3MHSA 1IYMA 2YREA 4MVTA 2XOCA 2H0DB 3V43A 2FD4A 3HCTA 3LVQE 5SVYA 2MUMA 5TDWA 3C5KA 2K1JA 3LJUX 2YSMA 5FEYA 3L1ZB 2EXUA 2JMIA 4I7DA 2VJFA 4H9DA 2ECWA 2E6SA 2YQMA 2YW8A 5SVIA 3FL2A 4YBSA 2YHOA 4BBQA 1WEOA 3ZYQA 3PUQA 2ECGA 3LQHA 1MBMA 4GNGA 4LJNA 2QJ0A 2ECJA 4C9ZA 2KKYA 2JMDA 2MA6A 2DX8A 5DKAA 2D8SA 2L43A 2AN6A 5FB1A 5H1UA 4N3WA 2RR4A 2B0OE 2DJAA 2XOYA 2I50A 4N4FA 1LDKC 2LGKA 4S3OC 2ECIA 2XB1A 5KH9A 3GV4A 2LN0A 4A4BA 3ZNIA 2XP0A 2YHNA 5KH3A 5TBNA 3HCUA 1X4JA 2MA5A 2XEUA 3U5OA 2LRIC 2YURA 5C13A 2JRJA 1JM7B 1X4UA 3FAOA 2C2LA 2VPEA 3LQJA 1DCQA 2LQ6A 4WZ0A 5LKTA 2E61A 3RTRB 3MHHA 4X3GA 5TRBA 2BAYA 4QF3A 2KIZA 4OGCA 1BORA 2H0DA 4ZQLA 2F42A 2EA6A 4YADA 2QIZA 2YUCA 4A49A 2LXHC 3FJUB 1Z60A 1X4IA 2M6MA 5H1TA 2KGIA 4PTBA 4V3KC 5TDRA 1WEWA 2L5UA 3MDBC 3U5NA 3HCSA 2YYRA 2YVRA 5B79A 1VD4A 4LKAA 2MD7B 4I7BA 3RPGC 1WEPA 4F52B 5LKXA 5KH7A 2KR4A 4YAXA 1WGMA 4R7EA 2LDRA 4AVXA 2RSDA 4CCGX 1DVPA 2K17A 2CKLA 2G45A 4Z0OA 2M1RA 1V87A 2XOZA 5B75A 5G05B 4IC2A 4YATA 5EYAF 3FANA 3I2DA 5D1MB 5FERA 5D1LB 3O33A 2M13A 4B7YC 4Q6FA 1LDJB 3EB5A 1FP0A 3N9NA 4ZUXU 2P57A 3SUBA 2D8UA 4BHWA 4FIPA 2LGGA 4Z0RA 4L7XA 5I3LA 2LGLA 1JOCA 2VJEB 1HYIA 5JG6A 1WEVA 5H9MA 3PLWA 2FSAA 2DSMA 4QF2A 2M3HA 1WE9A 3T7LA 2CRRA 2MKEA 3N9MA 4W4UA 2IDAA 3L1XA 4GNEA 3SHBA 3LVRE 1VYXA 4UP0A 1CHCA 2G43A 1WEEA 2KYUA 4A4CA 4WZ2A 1Z2QA 5G0FA 3KQIA 2PNXA 3O70A 1E4UA 2K16A 5J3XA 4O64A 2VP7A 5B77A 2QICA 4TKPB 4AUQB 5C11A 2F6JA 3O34A 4AYCA 2FFWA 2YSJA 3LDYA
chains in the Genus database with same CATH topology
3M99A 2MIQA 2MT5A 4WZ3B 1WEUA 2ZETC 2MNZA 2Y1MA 4S3OB 2FUUA 5LCWB 1ZBDB 2VJFB 2KREA 3EB6A 5H1VA 2HYED 2KFTA 3O37A 2L80A 3N9PA 3ZVYA 3N9LA 1T1HA 2L75A 5AITA 2PUYA 2MNYA 5FB0A 1MM2A 3PURA 2ECTA 3ZVZB 2JMJA 3IHPA 5B78A 4R2YA 4L58A 5B76A 4YABA 4LK9A 5TABA 4WA6A 4LLBA 3ZPVE 3O7AA 3SOUA 3T6RA 4YBTA 3N9OA 2KE1A 1JM7A 2CSZA 2VNFA 3ASLA 4YBMA 4UI9B 2K4DA 2YT5A 1WEQA 3HTKC 3KNVA 2KWNA 4A0CD 4PPEA 1G25A 3RPGB 2VPBA 2VPGA 1HYJA 5LKUA 3SOXA 4ZDTA 3ZPV1 2ECVA 3SOWA 2MD8C 5LKZA 2Y43A 3GL6A 1MM3A 2YQLA 2VPDA 2L0BA 3NG2A 2KWKA 2HDPA 2KWOA 3M62A 2YU4A 4XI1A 1RMDA 4P5OB 2LGVA 2C2VS 4YC9A 5B8DA 2M85A 2RI7A 4AP4A 3KV5A 2CKLB 1Z6UA 3O35A 1WESA 1VFYA 5D1KB 3O36A 1WILA 1WFKA 4FK5A 1XWHA 4MSXA 1F62A 2NAAA 3U5PA 3C6WA 4R8PK 3QZVA 4B86C 2KU3A 3PHDA 4CA1A 3DQVR 2OXQC 1WIMA 2EODA 3LRQA 2E6RA 2EGPA 3ZTGA 4LADB 4GNFA 4GNDA 4NN2A 2KWJA 2VJEA 2UZGA 2F6NA 4GB0A 1WENA 2CSYA 3LQIA 3KV6A 4I7CA 5G04B 3M63A 4V3LC 3L11A 2Y1NA 3DPLR 2LXPC 1K2FA 2G6QA 4AYCB 2KGGA 4FO9A 1FBVA 4IC3A 4UP5A 5DINA 1WEMA 3VK6A 2CT2A 3N9QA 3U5MA 1N87A 2FUIA 1U6GB 2LV9A 4FJCA 5AIUA 2ECNA 3MHSA 1IYMA 2YREA 4MVTA 2H0DB 3V43A 3HCTA 2MUMA 5TDWA 3C5KA 2K1JA 2YSMA 5FEYA 3L1ZB 2JMIA 4I7DA 2VJFA 2ECWA 2E6SA 2YQMA 2YW8A 3FL2A 4YBSA 2YHOA 4BBQA 1WEOA 3ZYQA 3PUQA 2ECGA 3LQHA 4GNGA 4LJNA 2QJ0A 2ECJA 4C9ZA 2JMDA 2MA6A 2DX8A 5DKAA 2D8SA 2L43A 2AN6A 5FB1A 5H1UA 4N3WA 2I50A 4N4FA 1LDKC 2LGKA 4S3OC 2ECIA 2XB1A 5KH9A 3GV4A 2LN0A 4A4BA 3ZNIA 2YHNA 5KH3A 5TBNA 3HCUA 1X4JA 2MA5A 2XEUA 3U5OA 2LRIC 2YURA 5C13A 2JRJA 1JM7B 1X4UA 2C2LA 2VPEA 3LQJA 2LQ6A 4WZ0A 5LKTA 3RTRB 3MHHA 4X3GA 5TRBA 2BAYA 4QF3A 2KIZA 1BORA 2H0DA 4ZQLA 2F42A 2EA6A 4YADA 2QIZA 2YUCA 4A49A 2LXHC 1Z60A 1X4IA 2M6MA 5H1TA 2KGIA 4PTBA 4V3KC 5TDRA 1WEWA 2L5UA 3U5NA 3HCSA 2YYRA 5B79A 1VD4A 4LKAA 2MD7B 4I7BA 3RPGC 1WEPA 4F52B 5LKXA 5KH7A 2KR4A 4YAXA 1WGMA 4R7EA 2LDRA 4AVXA 2RSDA 4CCGX 1DVPA 2K17A 2CKLA 2G45A 2M1RA 1V87A 5B75A 5G05B 4IC2A 4YATA 5EYAF 3I2DA 5D1MB 5FERA 5D1LB 3O33A 4B7YC 4Q6FA 1LDJB 3EB5A 1FP0A 3N9NA 4ZUXU 4BHWA 4FIPA 2LGGA 4L7XA 5I3LA 2LGLA 1JOCA 2VJEB 1HYIA 5JG6A 1WEVA 5H9MA 2FSAA 4QF2A 2M3HA 1WE9A 3T7LA 3N9MA 4W4UA 2IDAA 3L1XA 4GNEA 3SHBA 1VYXA 4UP0A 1CHCA 2G43A 1WEEA 2KYUA 4A4CA 4WZ2A 1Z2QA 5G0FA 3KQIA 2PNXA 3O70A 1E4UA 2K16A 5J3XA 4O64A 2VP7A 5B77A 2QICA 4TKPB 4AUQB 5C11A 2F6JA 3O34A 4AYCA 2YSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M99 A;  2MIQ A;  2MT5 A;  4WZ3 B;  1WEU A;  2ZET C;  2MNZ A;  2Y1M A;  4S3O B;  2FUU A;  5LCW B;  1ZBD B;  2VJF B;  2KRE A;  3EB6 A;  5H1V A;  2HYE D;  2KFT A;  3O37 A;  2L80 A;  3N9P A;  3ZVY A;  3N9L A;  1T1H A;  2L75 A;  5AIT A;  2PUY A;  2MNY A;  5FB0 A;  1MM2 A;  3PUR A;  2ECT A;  3ZVZ B;  2JMJ A;  3IHP A;  5B78 A;  4R2Y A;  4L58 A;  5B76 A;  4YAB A;  4LK9 A;  5TAB A;  4WA6 A;  4LLB A;  3ZPV E;  3O7A A;  3SOU A;  3T6R A;  4YBT A;  3N9O A;  2KE1 A;  1JM7 A;  2CSZ A;  2VNF A;  3ASL A;  4YBM A;  4UI9 B;  2K4D A;  2YT5 A;  1WEQ A;  3HTK C;  3KNV A;  2KWN A;  4A0C D;  4PPE A;  1G25 A;  3RPG B;  2VPB A;  2VPG A;  1HYJ A;  5LKU A;  3SOX A;  4ZDT A;  3ZPV 1;  2ECV A;  3SOW A;  2MD8 C;  5LKZ A;  2Y43 A;  3GL6 A;  1MM3 A;  2YQL A;  2VPD A;  2L0B A;  3NG2 A;  2KWK A;  2HDP A;  2KWO A;  3M62 A;  2YU4 A;  4XI1 A;  1RMD A;  4P5O B;  2LGV A;  2C2V S;  4YC9 A;  5B8D A;  2M85 A;  2RI7 A;  4AP4 A;  3KV5 A;  2CKL B;  1Z6U A;  3O35 A;  1WES A;  1VFY A;  5D1K B;  3O36 A;  1WIL A;  1WFK A;  4FK5 A;  1XWH A;  4MSX A;  1F62 A;  2NAA A;  3U5P A;  3C6W A;  4R8P K;  3QZV A;  4B86 C;  2KU3 A;  3PHD A;  4CA1 A;  3DQV R;  2OXQ C;  1WIM A;  2EOD A;  3LRQ A;  2E6R A;  2EGP A;  3ZTG A;  4LAD B;  4GNF A;  4GND A;  4NN2 A;  2KWJ A;  2VJE A;  2UZG A;  2F6N A;  4GB0 A;  1WEN A;  2CSY A;  3LQI A;  3KV6 A;  4I7C A;  5G04 B;  3M63 A;  4V3L C;  3L11 A;  2Y1N A;  3DPL R;  2LXP C;  1K2F A;  2G6Q A;  4AYC B;  2KGG A;  4FO9 A;  1FBV A;  4IC3 A;  4UP5 A;  5DIN A;  1WEM A;  3VK6 A;  2CT2 A;  3N9Q A;  3U5M A;  1N87 A;  2FUI A;  1U6G B;  2LV9 A;  4FJC A;  5AIU A;  2ECN A;  3MHS A;  1IYM A;  2YRE A;  4MVT A;  2H0D B;  3V43 A;  3HCT A;  2MUM A;  5TDW A;  3C5K A;  2K1J A;  2YSM A;  5FEY A;  3L1Z B;  2JMI A;  4I7D A;  2VJF A;  2ECW A;  2E6S A;  2YQM A;  2YW8 A;  3FL2 A;  4YBS A;  2YHO A;  4BBQ A;  1WEO A;  3ZYQ A;  3PUQ A;  2ECG A;  3LQH A;  4GNG A;  4LJN A;  2QJ0 A;  2ECJ A;  4C9Z A;  2JMD A;  2MA6 A;  2DX8 A;  5DKA A;  2D8S A;  2L43 A;  2AN6 A;  5FB1 A;  5H1U A;  4N3W A;  2I50 A;  4N4F A;  1LDK C;  2LGK A;  4S3O C;  2ECI A;  2XB1 A;  5KH9 A;  3GV4 A;  2LN0 A;  4A4B A;  3ZNI A;  2YHN A;  5KH3 A;  5TBN A;  3HCU A;  1X4J A;  2MA5 A;  2XEU A;  3U5O A;  2LRI C;  2YUR A;  5C13 A;  2JRJ A;  1JM7 B;  1X4U A;  2C2L A;  2VPE A;  3LQJ A;  2LQ6 A;  4WZ0 A;  5LKT A;  3RTR B;  3MHH A;  4X3G A;  5TRB A;  2BAY A;  4QF3 A;  2KIZ A;  1BOR A;  2H0D A;  4ZQL A;  2F42 A;  2EA6 A;  4YAD A;  2QIZ A;  2YUC A;  4A49 A;  2LXH C;  1Z60 A;  1X4I A;  2M6M A;  5H1T A;  2KGI A;  4PTB A;  4V3K C;  5TDR A;  1WEW A;  2L5U A;  3U5N A;  3HCS A;  2YYR A;  5B79 A;  1VD4 A;  4LKA A;  2MD7 B;  4I7B A;  3RPG C;  1WEP A;  4F52 B;  5LKX A;  5KH7 A;  2KR4 A;  4YAX A;  1WGM A;  4R7E A;  2LDR A;  4AVX A;  2RSD A;  4CCG X;  1DVP A;  2K17 A;  2CKL A;  2G45 A;  2M1R A;  1V87 A;  5B75 A;  5G05 B;  4IC2 A;  4YAT A;  5EYA F;  3I2D A;  5D1M B;  5FER A;  5D1L B;  3O33 A;  4B7Y C;  4Q6F A;  1LDJ B;  3EB5 A;  1FP0 A;  3N9N A;  4ZUX U;  4BHW A;  4FIP A;  2LGG A;  4L7X A;  5I3L A;  2LGL A;  1JOC A;  2VJE B;  1HYI A;  5JG6 A;  1WEV A;  5H9M A;  2FSA A;  4QF2 A;  2M3H A;  1WE9 A;  3T7L A;  3N9M A;  4W4U A;  2IDA A;  3L1X A;  4GNE A;  3SHB A;  1VYX A;  4UP0 A;  1CHC A;  2G43 A;  1WEE A;  2KYU A;  4A4C A;  4WZ2 A;  1Z2Q A;  5G0F A;  3KQI A;  2PNX A;  3O70 A;  1E4U A;  2K16 A;  5J3X A;  4O64 A;  2VP7 A;  5B77 A;  2QIC A;  4TKP B;  4AUQ B;  5C11 A;  2F6J A;  3O34 A;  4AYC A;  2YSJ A; 
#chains in the Genus database with same CATH topology
 3M99 A;  2JM3 A;  2MIQ A;  3FM8 C;  2MT5 A;  4WZ3 B;  1WEU A;  2ZET C;  4F1P A;  2MNZ A;  2Y1M A;  4S3O B;  2FUU A;  5LCW B;  1ZBD B;  3O47 A;  2VJF B;  3T9K A;  2KRE A;  3EB6 A;  5H1V A;  5SVI B;  2HYE D;  2OWA A;  2KFT A;  3O37 A;  2L80 A;  3N9P A;  3ZVY A;  3N9L A;  2L7P A;  1T1H A;  2L75 A;  5AIT A;  2PUY A;  2MNY A;  5FB0 A;  1MM2 A;  3PUR A;  3JUE A;  2ECT A;  3ZVZ B;  2JMJ A;  3IHP A;  5B78 A;  4R2Y A;  4L58 A;  5B76 A;  4YAB A;  4LK9 A;  5TAB A;  4WA6 A;  4LLB A;  3ZPV E;  3O7A A;  3SOU A;  3T6R A;  4OGE A;  4YBT A;  3N9O A;  2KE1 A;  1JM7 A;  2CSZ A;  4QQ4 A;  2VNF A;  3ASL A;  4YBM A;  4UI9 B;  2K4D A;  2YT5 A;  1WEQ A;  3HTK C;  3KNV A;  2KWN A;  3H7H A;  4A0C D;  4PPE A;  1G25 A;  3RPG B;  2VPB A;  2VPG A;  1HYJ A;  5LKU A;  2LAU A;  3SOX A;  4ZDT A;  3ZPV 1;  2ECV A;  3SOW A;  2MD8 C;  5LKZ A;  2Y43 A;  2KKX A;  3GL6 A;  1MM3 A;  2YQL A;  2VPD A;  2L0B A;  3NG2 A;  2KWK A;  2HDP A;  2KWO A;  3M62 A;  2IQJ A;  2YU4 A;  4XI1 A;  1RMD A;  4P5O B;  2LGV A;  2C2V S;  4YC9 A;  5B8D A;  2M85 A;  5K3Q A;  2RI7 A;  4AP4 A;  3KV5 A;  2CKL B;  1Z6U A;  3O35 A;  1WES A;  1VFY A;  5D1K B;  3O36 A;  5SVX A;  2CON A;  1WIL A;  1WFK A;  4FK5 A;  1XWH A;  3DWD A;  4MSX A;  1F62 A;  2NAA A;  3U5P A;  3C6W A;  4R8P K;  3QZV A;  4B86 C;  2EGM A;  2KU3 A;  3PHD A;  4CA1 A;  3DQV R;  2OXQ C;  1WIM A;  2EOD A;  3LRQ A;  2E6R A;  2EGP A;  3ZTG A;  3KDE C;  4LAD B;  4GNF A;  4GND A;  4NN2 A;  2KWJ A;  2VJE A;  2UZG A;  3E2D A;  2F6N A;  4GB0 A;  2JUN A;  1WEN A;  2CSY A;  3LQI A;  3KV6 A;  4O62 A;  4I7C A;  3M7K A;  5G04 B;  3M63 A;  4V3L C;  3L11 A;  2Y1N A;  3DPL R;  2LXP C;  1K2F A;  3Q1D A;  2G6Q A;  2CSV A;  4AYC B;  2KGG A;  4FO9 A;  1FBV A;  4IC3 A;  4UP5 A;  5DIN A;  1WEM A;  3DDT A;  3VK6 A;  2CRW A;  2CT2 A;  3N9Q A;  1N87 A;  3U5M A;  2FUI A;  1U6G B;  2LV9 A;  4FJC A;  5AIU A;  3FEH A;  2ECN A;  3MHS A;  1IYM A;  2YRE A;  4MVT A;  2XOC A;  2H0D B;  3V43 A;  2FD4 A;  3HCT A;  3LVQ E;  5SVY A;  2MUM A;  5TDW A;  3C5K A;  2K1J A;  3LJU X;  2YSM A;  5FEY A;  3L1Z B;  2EXU A;  2JMI A;  4I7D A;  2VJF A;  4H9D A;  2ECW A;  2E6S A;  2YQM A;  2YW8 A;  5SVI A;  3FL2 A;  4YBS A;  2YHO A;  4BBQ A;  1WEO A;  3ZYQ A;  3PUQ A;  2ECG A;  3LQH A;  1MBM A;  4GNG A;  4LJN A;  2QJ0 A;  2ECJ A;  4C9Z A;  2KKY A;  2JMD A;  2MA6 A;  2DX8 A;  5DKA A;  2D8S A;  2L43 A;  2AN6 A;  5FB1 A;  5H1U A;  4N3W A;  2RR4 A;  2B0O E;  2DJA A;  2XOY A;  2I50 A;  4N4F A;  1LDK C;  2LGK A;  4S3O C;  2ECI A;  2XB1 A;  5KH9 A;  3GV4 A;  2LN0 A;  4A4B A;  3ZNI A;  2XP0 A;  2YHN A;  5KH3 A;  5TBN A;  3HCU A;  1X4J A;  2MA5 A;  2XEU A;  3U5O A;  2LRI C;  2YUR A;  5C13 A;  2JRJ A;  1JM7 B;  1X4U A;  3FAO A;  2C2L A;  2VPE A;  3LQJ A;  1DCQ A;  2LQ6 A;  4WZ0 A;  5LKT A;  2E61 A;  3RTR B;  3MHH A;  4X3G A;  5TRB A;  2BAY A;  4QF3 A;  2KIZ A;  4OGC A;  1BOR A;  2H0D A;  4ZQL A;  2F42 A;  2EA6 A;  4YAD A;  2QIZ A;  2YUC A;  4A49 A;  2LXH C;  3FJU B;  1Z60 A;  1X4I A;  2M6M A;  5H1T A;  2KGI A;  4PTB A;  4V3K C;  5TDR A;  1WEW A;  2L5U A;  3MDB C;  3U5N A;  3HCS A;  2YYR A;  2YVR A;  5B79 A;  1VD4 A;  4LKA A;  2MD7 B;  4I7B A;  3RPG C;  1WEP A;  4F52 B;  5LKX A;  5KH7 A;  2KR4 A;  4YAX A;  1WGM A;  4R7E A;  2LDR A;  4AVX A;  2RSD A;  4CCG X;  1DVP A;  2K17 A;  2CKL A;  2G45 A;  4Z0O A;  2M1R A;  1V87 A;  2XOZ A;  5B75 A;  5G05 B;  4IC2 A;  4YAT A;  5EYA F;  3FAN A;  3I2D A;  5D1M B;  5FER A;  5D1L B;  3O33 A;  2M13 A;  4B7Y C;  4Q6F A;  1LDJ B;  3EB5 A;  1FP0 A;  3N9N A;  4ZUX U;  2P57 A;  3SUB A;  2D8U A;  4BHW A;  4FIP A;  2LGG A;  4Z0R A;  4L7X A;  5I3L A;  2LGL A;  1JOC A;  2VJE B;  1HYI A;  5JG6 A;  1WEV A;  5H9M A;  3PLW A;  2FSA A;  2DSM A;  4QF2 A;  2M3H A;  1WE9 A;  3T7L A;  2CRR A;  2MKE A;  3N9M A;  4W4U A;  2IDA A;  3L1X A;  4GNE A;  3SHB A;  3LVR E;  1VYX A;  4UP0 A;  1CHC A;  2G43 A;  1WEE A;  2KYU A;  4A4C A;  4WZ2 A;  1Z2Q A;  5G0F A;  3KQI A;  2PNX A;  3O70 A;  1E4U A;  2K16 A;  5J3X A;  4O64 A;  2VP7 A;  5B77 A;  2QIC A;  4TKP B;  4AUQ B;  5C11 A;  2F6J A;  3O34 A;  4AYC A;  2FFW A;  2YSJ A;  3LDY A; 
#chains in the Genus database with same CATH homology
 3M99 A;  2MIQ A;  2MT5 A;  4WZ3 B;  1WEU A;  2ZET C;  2MNZ A;  2Y1M A;  4S3O B;  2FUU A;  5LCW B;  1ZBD B;  2VJF B;  2KRE A;  3EB6 A;  5H1V A;  2HYE D;  2KFT A;  3O37 A;  2L80 A;  3N9P A;  3ZVY A;  3N9L A;  1T1H A;  2L75 A;  5AIT A;  2PUY A;  2MNY A;  5FB0 A;  1MM2 A;  3PUR A;  2ECT A;  3ZVZ B;  2JMJ A;  3IHP A;  5B78 A;  4R2Y A;  4L58 A;  5B76 A;  4YAB A;  4LK9 A;  5TAB A;  4WA6 A;  4LLB A;  3ZPV E;  3O7A A;  3SOU A;  3T6R A;  4YBT A;  3N9O A;  2KE1 A;  1JM7 A;  2CSZ A;  2VNF A;  3ASL A;  4YBM A;  4UI9 B;  2K4D A;  2YT5 A;  1WEQ A;  3HTK C;  3KNV A;  2KWN A;  4A0C D;  4PPE A;  1G25 A;  3RPG B;  2VPB A;  2VPG A;  1HYJ A;  5LKU A;  3SOX A;  4ZDT A;  3ZPV 1;  2ECV A;  3SOW A;  2MD8 C;  5LKZ A;  2Y43 A;  3GL6 A;  1MM3 A;  2YQL A;  2VPD A;  2L0B A;  3NG2 A;  2KWK A;  2HDP A;  2KWO A;  3M62 A;  2YU4 A;  4XI1 A;  1RMD A;  4P5O B;  2LGV A;  2C2V S;  4YC9 A;  5B8D A;  2M85 A;  2RI7 A;  4AP4 A;  3KV5 A;  2CKL B;  1Z6U A;  3O35 A;  1WES A;  1VFY A;  5D1K B;  3O36 A;  1WIL A;  1WFK A;  4FK5 A;  1XWH A;  4MSX A;  1F62 A;  2NAA A;  3U5P A;  3C6W A;  4R8P K;  3QZV A;  4B86 C;  2KU3 A;  3PHD A;  4CA1 A;  3DQV R;  2OXQ C;  1WIM A;  2EOD A;  3LRQ A;  2E6R A;  2EGP A;  3ZTG A;  4LAD B;  4GNF A;  4GND A;  4NN2 A;  2KWJ A;  2VJE A;  2UZG A;  2F6N A;  4GB0 A;  1WEN A;  2CSY A;  3LQI A;  3KV6 A;  4I7C A;  5G04 B;  3M63 A;  4V3L C;  3L11 A;  2Y1N A;  3DPL R;  2LXP C;  1K2F A;  2G6Q A;  4AYC B;  2KGG A;  4FO9 A;  1FBV A;  4IC3 A;  4UP5 A;  5DIN A;  1WEM A;  3VK6 A;  2CT2 A;  3N9Q A;  3U5M A;  1N87 A;  2FUI A;  1U6G B;  2LV9 A;  4FJC A;  5AIU A;  2ECN A;  3MHS A;  1IYM A;  2YRE A;  4MVT A;  2H0D B;  3V43 A;  3HCT A;  2MUM A;  5TDW A;  3C5K A;  2K1J A;  2YSM A;  5FEY A;  3L1Z B;  2JMI A;  4I7D A;  2VJF A;  2ECW A;  2E6S A;  2YQM A;  2YW8 A;  3FL2 A;  4YBS A;  2YHO A;  4BBQ A;  1WEO A;  3ZYQ A;  3PUQ A;  2ECG A;  3LQH A;  4GNG A;  4LJN A;  2QJ0 A;  2ECJ A;  4C9Z A;  2JMD A;  2MA6 A;  2DX8 A;  5DKA A;  2D8S A;  2L43 A;  2AN6 A;  5FB1 A;  5H1U A;  4N3W A;  2I50 A;  4N4F A;  1LDK C;  2LGK A;  4S3O C;  2ECI A;  2XB1 A;  5KH9 A;  3GV4 A;  2LN0 A;  4A4B A;  3ZNI A;  2YHN A;  5KH3 A;  5TBN A;  3HCU A;  1X4J A;  2MA5 A;  2XEU A;  3U5O A;  2LRI C;  2YUR A;  5C13 A;  2JRJ A;  1JM7 B;  1X4U A;  2C2L A;  2VPE A;  3LQJ A;  2LQ6 A;  4WZ0 A;  5LKT A;  3RTR B;  3MHH A;  4X3G A;  5TRB A;  2BAY A;  4QF3 A;  2KIZ A;  1BOR A;  2H0D A;  4ZQL A;  2F42 A;  2EA6 A;  4YAD A;  2QIZ A;  2YUC A;  4A49 A;  2LXH C;  1Z60 A;  1X4I A;  2M6M A;  5H1T A;  2KGI A;  4PTB A;  4V3K C;  5TDR A;  1WEW A;  2L5U A;  3U5N A;  3HCS A;  2YYR A;  5B79 A;  1VD4 A;  4LKA A;  2MD7 B;  4I7B A;  3RPG C;  1WEP A;  4F52 B;  5LKX A;  5KH7 A;  2KR4 A;  4YAX A;  1WGM A;  4R7E A;  2LDR A;  4AVX A;  2RSD A;  4CCG X;  1DVP A;  2K17 A;  2CKL A;  2G45 A;  2M1R A;  1V87 A;  5B75 A;  5G05 B;  4IC2 A;  4YAT A;  5EYA F;  3I2D A;  5D1M B;  5FER A;  5D1L B;  3O33 A;  4B7Y C;  4Q6F A;  1LDJ B;  3EB5 A;  1FP0 A;  3N9N A;  4ZUX U;  4BHW A;  4FIP A;  2LGG A;  4L7X A;  5I3L A;  2LGL A;  1JOC A;  2VJE B;  1HYI A;  5JG6 A;  1WEV A;  5H9M A;  2FSA A;  4QF2 A;  2M3H A;  1WE9 A;  3T7L A;  3N9M A;  4W4U A;  2IDA A;  3L1X A;  4GNE A;  3SHB A;  1VYX A;  4UP0 A;  1CHC A;  2G43 A;  1WEE A;  2KYU A;  4A4C A;  4WZ2 A;  1Z2Q A;  5G0F A;  3KQI A;  2PNX A;  3O70 A;  1E4U A;  2K16 A;  5J3X A;  4O64 A;  2VP7 A;  5B77 A;  2QIC A;  4TKP B;  4AUQ B;  5C11 A;  2F6J A;  3O34 A;  4AYC A;  2YSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...