4B7YC

Crystal structure of the msl1-msl2 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
115
structure length
115
Chain Sequence
MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTCKGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Msl1-Mediated Dimerization of the Dosage Compensation Complex is Essential for Male X-Chromosome Regulation in Drosophila.
pubmed doi rcsb
molecule keywords MALE-SPECIFIC LETHAL 1 HOMOLOG
molecule tags Gene regulation
source organism Homo sapiens
total genus 33
structure length 115
sequence length 115
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF16685 zf-RING_10 zinc RING finger of MSL2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4b7yC00
3O33A 5G04B 1X4IA 2YYRA 2KGIA 2VJEA 4YC9A 3RPGB 3N9NA 3ZVYA 5FEYA 5TABA 2EA6A 3T7LA 2VNFA 2VJFA 5TRBA 5D1KB 1N87A 5TBNA 3DPLR 2YQLA 2MT5A 3KV5A 2VJEB 4L58A 2XB1A 3N9QA 4Q6FA 4YBSA 1BORA 1WILA 2PNXA 2VJFB 4YBTA 3O70A 4L7XA 3T6RA 5B77A 3QZVA 2M3HA 3U5MA 2VP7A 2OXQC 2RI7A 4MVTA 5DINA 5FB1A 3HCTA 2ECNA 1WEOA 2YREA 2KIZA 4WZ3B 1WEMA 3ZNIA 3U5NA 4R2YA 1LDKC 2G45A 2CSZA 2JMIA 2Y1NA 2I50A 1WEWA 2KWNA 2Y43A 2FUIA 2K17A 2M85A 2MA6A 2YHOA 5G05B 4BHWA 5KH3A 2L43A 2KR4A 4YABA 2K1JA 2HYED 2VPGA 2KWKA 2DX8A 2KFTA 1HYIA 3M99A 2C2LA 3M62A 2LXPC 3ZTGA 4CCGX 1XWHA 4LK9A 2LV9A 4X3GA 1WIMA 2ECJA 3ZVZB 1JM7A 2YW8A 2F6JA 2MNZA 4I7BA 4GNFA 3O37A 4A49A 5I3LA 2M6MA 4MSXA 4S3OB 1X4UA 2D8SA 4PTBA 3SHBA 4QF2A 2KWOA 5FERA 2MNYA 2LDRA 2LGVA 3PHDA 1HYJA 1JM7B 3IHPA 1WESA 3HCUA 4O64A 3EB6A 1MM3A 4N4FA 5B78A 2UZGA 4I7CA 1V87A 4LADB 3LQHA 5H9MA 3L11A 5KH9A 2C2VS 1ZBDB 2ECVA 3HTKC 3N9OA 2QICA 2BAYA 5LKUA 1CHCA 2LRIC 4R8PK 5H1TA 1VYXA 3EB5A 5JG6A 2MA5A 4UP0A 3C6WA 2JMJA 2MD7B 3ASLA 4LLBA 4YBMA 4GNGA 1LDJB 2LN0A 5KH7A 4GB0A 4AUQB 2FSAA 4IC3A 3LRQA 2MUMA 2KGGA 4WZ0A 2LQ6A 5LKTA 2YSMA 4CA1A 2F42A 5B75A 1Z2QA 2CSYA 3L1ZB 3MHSA 3KQIA 5AITA 2L80A 4W4UA 1Z60A 2YSJA 5B76A 3DQVR 2QJ0A 4V3LC 1WEVA 2KE1A 4QF3A 4IC2A 5B8DA 4AVXA 1F62A 2YT5A 4A4BA 3O7AA 3U5OA 2FUUA 2L0BA 4S3OC 2AN6A 5FB0A 2VPDA 3ZYQA 4C9ZA 4UI9B 4AYCA 5C11A 4GNEA 5TDRA 2H0DA 3N9PA 5LCWB 2L75A 2Y1MA 2XEUA 3O35A 4ZQLA 4R7EA 5LKXA 1K2FA 1X4JA 4FJCA 4B86C 2EODA 3FL2A 4FIPA 2LXHC 1IYMA 1WEQA 5D1MB 2IDAA 3ZPV1 3MHHA 5H1VA 4N3WA 2ECTA 4AYCB 5LKZA 4UP5A 4LJNA 1MM2A 3M63A 2QIZA 4F52B 5D1LB 2H0DB 2YQMA 5EYAF 4PPEA 3RTRB 4P5OB 4A0CD 1WGMA 3VK6A 4A4CA 3KNVA 3NG2A 1WENA 4YATA 5C13A 4TKPB 3L1XA 4NN2A 3N9MA 3U5PA 4AP4A 4FK5A 3I2DA 3LQIA 3KV6A 4LKAA 2KYUA 2K16A 2LGKA 3N9LA 4ZDTA 1FP0A 3GL6A 2VPEA 3O34A 1WFKA 4FO9A 2LGLA 2EGPA 5AIUA 2YURA 2ECWA 3V43A 4YAXA 5H1UA 2F6NA 4YADA 2CKLA 1JOCA 1WEUA 1VFYA 5G0FA 1U6GB 2G6QA 3SOUA 2KU3A 3PURA 2ZETC 4WZ2A 1G25A 2HDPA 1T1HA 2MD8C 4I7DA 4WA6A 5B79A 2ECGA 3SOWA 2NAAA 2YHNA 1FBVA 2RSDA 4BBQA 3ZPVE 2LGGA 2CKLB 2G43A 4B7YC 1E4UA 2MIQA 3LQJA 4GNDA 1WE9A 4XI1A 2KWJA 2JRJA 2CT2A 4V3KC 1VD4A 1WEEA 1RMDA 5TDWA 2PUYA 3SOXA 2VPBA 5DKAA 5J3XA 3PUQA 2JMDA 4ZUXU 3RPGC 3GV4A 2YUCA 1DVPA 1Z6UA 3HCSA 2E6RA 2M1RA 2E6SA 2K4DA 3C5KA 2YU4A 1WEPA 2KREA 2ECIA 2L5UA 3O36A
chains in the Genus database with same CATH superfamily
2KKYA 3O33A 5G04B 1X4IA 2YYRA 2KGIA 2VJEA 4YC9A 3Q1DA 3N9NA 3RPGB 3ZVYA 4F1PA 5FEYA 5TABA 2EA6A 3T7LA 2VNFA 2VJFA 5TRBA 5SVIA 5D1KB 1N87A 5TBNA 3DPLR 2YQLA 2MT5A 2YVRA 3KV5A 2CRRA 2VJEB 4L58A 2XB1A 3O47A 3N9QA 4Q6FA 4YBSA 1BORA 1WILA 2PNXA 2VJFB 4YBTA 3O70A 5SVIB 4L7XA 3T6RA 5B77A 3QZVA 5SVXA 2M3HA 2IQJA 3U5MA 2VP7A 2OXQC 2RI7A 4MVTA 5DINA 5FB1A 3HCTA 2ECNA 1WEOA 2YREA 2KIZA 4O62A 4WZ3B 1WEMA 3DDTA 3M7KA 3ZNIA 3U5NA 4R2YA 2P57A 1LDKC 3T9KA 2DJAA 2G45A 2CSZA 2JMIA 2Y1NA 2I50A 2CONA 1WEWA 2KWNA 2Y43A 2FUIA 3FAOA 3LJUX 2K17A 2M85A 1DCQA 2MA6A 2B0OE 2YHOA 5G05B 4BHWA 5KH3A 2L43A 2KR4A 4YABA 2K1JA 2HYED 2VPGA 2KWKA 2DX8A 2KFTA 3PLWA 1HYIA 2E61A 2C2LA 3M99A 3M62A 5SVYA 3SUBA 2LXPC 3DWDA 3ZTGA 4CCGX 1XWHA 4LK9A 2LV9A 4X3GA 1WIMA 2ECJA 3ZVZB 1JM7A 2YW8A 2F6JA 2MNZA 4I7BA 4GNFA 3O37A 4A49A 2FD4A 5I3LA 2M6MA 4MSXA 4S3OB 1X4UA 2D8SA 4PTBA 1MBMA 3SHBA 4QF2A 2KWOA 5FERA 2MNYA 2LDRA 2LGVA 3PHDA 1HYJA 1JM7B 3IHPA 1WESA 3HCUA 4O64A 2FFWA 3EB6A 1MM3A 2JM3A 4N4FA 5B78A 4H9DA 2UZGA 4I7CA 1V87A 4LADB 3LQHA 5H9MA 3L11A 5KH9A 2C2VS 1ZBDB 2ECVA 3HTKC 3N9OA 2QICA 2BAYA 5LKUA 1CHCA 2LRIC 4R8PK 5H1TA 1VYXA 3EB5A 5JG6A 2MA5A 2M13A 4UP0A 3C6WA 2JMJA 2MD7B 3ASLA 4LLBA 4YBMA 4GNGA 1LDJB 2LN0A 5KH7A 4GB0A 4AUQB 2FSAA 3LRQA 4IC3A 2MUMA 2KGGA 3E2DA 4WZ0A 2LQ6A 5LKTA 2YSMA 4CA1A 2F42A 5B75A 2LAUA 1Z2QA 2CSYA 3L1ZB 3MHSA 3KQIA 5AITA 2L80A 4W4UA 1Z60A 2YSJA 5B76A 3DQVR 2QJ0A 2KKXA 4V3LC 1WEVA 2KE1A 4QF3A 4IC2A 5B8DA 4AVXA 1F62A 2YT5A 3FEHA 4A4BA 3O7AA 3U5OA 2FUUA 2EGMA 2L0BA 4S3OC 2AN6A 5FB0A 2VPDA 3ZYQA 4C9ZA 4UI9B 2XOYA 4AYCA 5C11A 2OWAA 2RR4A 4GNEA 5TDRA 2H0DA 3N9PA 5LCWB 2L75A 2DSMA 2Y1MA 2XEUA 3O35A 4ZQLA 4R7EA 3MDBC 5LKXA 1K2FA 1X4JA 4FJCA 4B86C 2EODA 3FL2A 4FIPA 2LXHC 1IYMA 1WEQA 5D1MB 2IDAA 3ZPV1 2L7PA 3MHHA 5H1VA 4N3WA 2XP0A 2ECTA 4AYCB 5LKZA 4UP5A 4LJNA 1MM2A 3M63A 2QIZA 2CRWA 4F52B 5D1LB 2H0DB 2YQMA 5EYAF 4PPEA 3RTRB 4P5OB 4A0CD 1WGMA 3VK6A 4A4CA 3KNVA 4Z0RA 3NG2A 1WENA 2EXUA 4YATA 5C13A 4TKPB 3L1XA 4NN2A 3N9MA 3U5PA 4AP4A 3H7HA 4FK5A 3I2DA 3LQIA 3KV6A 4LKAA 2KYUA 2K16A 2LGKA 3N9LA 4ZDTA 3FANA 2D8UA 1FP0A 2XOCA 3GL6A 2VPEA 3O34A 1WFKA 4FO9A 2LGLA 2EGPA 5AIUA 2YURA 2ECWA 4OGEA 2CSVA 3V43A 2XOZA 4YAXA 3FM8C 5H1UA 2F6NA 4YADA 2CKLA 1JOCA 1WEUA 1VFYA 5G0FA 1U6GB 2G6QA 3SOUA 2JUNA 2KU3A 3PURA 2ZETC 4WZ2A 5K3QA 1G25A 2MKEA 2HDPA 1T1HA 2MD8C 4I7DA 4WA6A 5B79A 3LDYA 3FJUB 2ECGA 3SOWA 2NAAA 2YHNA 1FBVA 2RSDA 4BBQA 3ZPVE 4Z0OA 2LGGA 2CKLB 3LVQE 2G43A 4B7YC 1E4UA 2MIQA 3LQJA 4GNDA 1WE9A 4XI1A 2KWJA 2JRJA 2CT2A 4V3KC 1VD4A 1WEEA 1RMDA 5TDWA 2PUYA 3SOXA 3JUEA 4QQ4A 2VPBA 5DKAA 5J3XA 3LVRE 3PUQA 2JMDA 4ZUXU 3RPGC 3GV4A 2YUCA 1DVPA 4OGCA 1Z6UA 3HCSA 2E6RA 2M1RA 2E6SA 2K4DA 3C5KA 2YU4A 1WEPA 3KDEC 2KREA 2ECIA 2L5UA 3O36A
chains in the Genus database with same CATH topology
3O33A 5G04B 1X4IA 2YYRA 2KGIA 2VJEA 4YC9A 3RPGB 3N9NA 3ZVYA 5FEYA 5TABA 2EA6A 3T7LA 2VNFA 2VJFA 5TRBA 5D1KB 1N87A 5TBNA 3DPLR 2YQLA 2MT5A 3KV5A 2VJEB 4L58A 2XB1A 3N9QA 4Q6FA 4YBSA 1BORA 1WILA 2PNXA 2VJFB 4YBTA 3O70A 4L7XA 3T6RA 5B77A 3QZVA 2M3HA 3U5MA 2VP7A 2OXQC 2RI7A 4MVTA 5DINA 5FB1A 3HCTA 2ECNA 1WEOA 2YREA 2KIZA 4WZ3B 1WEMA 3ZNIA 3U5NA 4R2YA 1LDKC 2G45A 2CSZA 2JMIA 2Y1NA 2I50A 1WEWA 2KWNA 2Y43A 2FUIA 2K17A 2M85A 2MA6A 2YHOA 5G05B 4BHWA 5KH3A 2L43A 2KR4A 4YABA 2K1JA 2HYED 2VPGA 2KWKA 2DX8A 2KFTA 1HYIA 3M99A 2C2LA 3M62A 2LXPC 3ZTGA 4CCGX 1XWHA 4LK9A 2LV9A 4X3GA 1WIMA 2ECJA 3ZVZB 1JM7A 2YW8A 2F6JA 2MNZA 4I7BA 4GNFA 3O37A 4A49A 5I3LA 2M6MA 4MSXA 4S3OB 1X4UA 2D8SA 4PTBA 3SHBA 4QF2A 2KWOA 5FERA 2MNYA 2LDRA 2LGVA 3PHDA 1HYJA 1JM7B 3IHPA 1WESA 3HCUA 4O64A 3EB6A 1MM3A 4N4FA 5B78A 2UZGA 4I7CA 1V87A 4LADB 3LQHA 5H9MA 3L11A 5KH9A 2C2VS 1ZBDB 2ECVA 3HTKC 3N9OA 2QICA 2BAYA 5LKUA 1CHCA 2LRIC 4R8PK 5H1TA 1VYXA 3EB5A 5JG6A 2MA5A 4UP0A 3C6WA 2JMJA 2MD7B 3ASLA 4LLBA 4YBMA 4GNGA 1LDJB 2LN0A 5KH7A 4GB0A 4AUQB 2FSAA 4IC3A 3LRQA 2MUMA 2KGGA 4WZ0A 2LQ6A 5LKTA 2YSMA 4CA1A 2F42A 5B75A 1Z2QA 2CSYA 3L1ZB 3MHSA 3KQIA 5AITA 2L80A 4W4UA 1Z60A 2YSJA 5B76A 3DQVR 2QJ0A 4V3LC 1WEVA 2KE1A 4QF3A 4IC2A 5B8DA 4AVXA 1F62A 2YT5A 4A4BA 3O7AA 3U5OA 2FUUA 2L0BA 4S3OC 2AN6A 5FB0A 2VPDA 3ZYQA 4C9ZA 4UI9B 4AYCA 5C11A 4GNEA 5TDRA 2H0DA 3N9PA 5LCWB 2L75A 2Y1MA 2XEUA 3O35A 4ZQLA 4R7EA 5LKXA 1K2FA 1X4JA 4FJCA 4B86C 2EODA 3FL2A 4FIPA 2LXHC 1IYMA 1WEQA 5D1MB 2IDAA 3ZPV1 3MHHA 5H1VA 4N3WA 2ECTA 4AYCB 5LKZA 4UP5A 4LJNA 1MM2A 3M63A 2QIZA 4F52B 5D1LB 2H0DB 2YQMA 5EYAF 4PPEA 3RTRB 4P5OB 4A0CD 1WGMA 3VK6A 4A4CA 3KNVA 3NG2A 1WENA 4YATA 5C13A 4TKPB 3L1XA 4NN2A 3N9MA 3U5PA 4AP4A 4FK5A 3I2DA 3LQIA 3KV6A 4LKAA 2KYUA 2K16A 2LGKA 3N9LA 4ZDTA 1FP0A 3GL6A 2VPEA 3O34A 1WFKA 4FO9A 2LGLA 2EGPA 5AIUA 2YURA 2ECWA 3V43A 4YAXA 5H1UA 2F6NA 4YADA 2CKLA 1JOCA 1WEUA 1VFYA 5G0FA 1U6GB 2G6QA 3SOUA 2KU3A 3PURA 2ZETC 4WZ2A 1G25A 2HDPA 1T1HA 2MD8C 4I7DA 4WA6A 5B79A 2ECGA 3SOWA 2NAAA 2YHNA 1FBVA 2RSDA 4BBQA 3ZPVE 2LGGA 2CKLB 2G43A 4B7YC 1E4UA 2MIQA 3LQJA 4GNDA 1WE9A 4XI1A 2KWJA 2JRJA 2CT2A 4V3KC 1VD4A 1WEEA 1RMDA 5TDWA 2PUYA 3SOXA 2VPBA 5DKAA 5J3XA 3PUQA 2JMDA 4ZUXU 3RPGC 3GV4A 2YUCA 1DVPA 1Z6UA 3HCSA 2E6RA 2M1RA 2E6SA 2K4DA 3C5KA 2YU4A 1WEPA 2KREA 2ECIA 2L5UA 3O36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O33 A;  5G04 B;  1X4I A;  2YYR A;  2KGI A;  2VJE A;  4YC9 A;  3RPG B;  3N9N A;  3ZVY A;  5FEY A;  5TAB A;  2EA6 A;  3T7L A;  2VNF A;  2VJF A;  5TRB A;  5D1K B;  1N87 A;  5TBN A;  3DPL R;  2YQL A;  2MT5 A;  3KV5 A;  2VJE B;  4L58 A;  2XB1 A;  3N9Q A;  4Q6F A;  4YBS A;  1BOR A;  1WIL A;  2PNX A;  2VJF B;  4YBT A;  3O70 A;  4L7X A;  3T6R A;  5B77 A;  3QZV A;  2M3H A;  3U5M A;  2VP7 A;  2OXQ C;  2RI7 A;  4MVT A;  5DIN A;  5FB1 A;  3HCT A;  2ECN A;  1WEO A;  2YRE A;  2KIZ A;  4WZ3 B;  1WEM A;  3ZNI A;  3U5N A;  4R2Y A;  1LDK C;  2G45 A;  2CSZ A;  2JMI A;  2Y1N A;  2I50 A;  1WEW A;  2KWN A;  2Y43 A;  2FUI A;  2K17 A;  2M85 A;  2MA6 A;  2YHO A;  5G05 B;  4BHW A;  5KH3 A;  2L43 A;  2KR4 A;  4YAB A;  2K1J A;  2HYE D;  2VPG A;  2KWK A;  2DX8 A;  2KFT A;  1HYI A;  3M99 A;  2C2L A;  3M62 A;  2LXP C;  3ZTG A;  4CCG X;  1XWH A;  4LK9 A;  2LV9 A;  4X3G A;  1WIM A;  2ECJ A;  3ZVZ B;  1JM7 A;  2YW8 A;  2F6J A;  2MNZ A;  4I7B A;  4GNF A;  3O37 A;  4A49 A;  5I3L A;  2M6M A;  4MSX A;  4S3O B;  1X4U A;  2D8S A;  4PTB A;  3SHB A;  4QF2 A;  2KWO A;  5FER A;  2MNY A;  2LDR A;  2LGV A;  3PHD A;  1HYJ A;  1JM7 B;  3IHP A;  1WES A;  3HCU A;  4O64 A;  3EB6 A;  1MM3 A;  4N4F A;  5B78 A;  2UZG A;  4I7C A;  1V87 A;  4LAD B;  3LQH A;  5H9M A;  3L11 A;  5KH9 A;  2C2V S;  1ZBD B;  2ECV A;  3HTK C;  3N9O A;  2QIC A;  2BAY A;  5LKU A;  1CHC A;  2LRI C;  4R8P K;  5H1T A;  1VYX A;  3EB5 A;  5JG6 A;  2MA5 A;  4UP0 A;  3C6W A;  2JMJ A;  2MD7 B;  3ASL A;  4LLB A;  4YBM A;  4GNG A;  1LDJ B;  2LN0 A;  5KH7 A;  4GB0 A;  4AUQ B;  2FSA A;  4IC3 A;  3LRQ A;  2MUM A;  2KGG A;  4WZ0 A;  2LQ6 A;  5LKT A;  2YSM A;  4CA1 A;  2F42 A;  5B75 A;  1Z2Q A;  2CSY A;  3L1Z B;  3MHS A;  3KQI A;  5AIT A;  2L80 A;  4W4U A;  1Z60 A;  2YSJ A;  5B76 A;  3DQV R;  2QJ0 A;  4V3L C;  1WEV A;  2KE1 A;  4QF3 A;  4IC2 A;  5B8D A;  4AVX A;  1F62 A;  2YT5 A;  4A4B A;  3O7A A;  3U5O A;  2FUU A;  2L0B A;  4S3O C;  2AN6 A;  5FB0 A;  2VPD A;  3ZYQ A;  4C9Z A;  4UI9 B;  4AYC A;  5C11 A;  4GNE A;  5TDR A;  2H0D A;  3N9P A;  5LCW B;  2L75 A;  2Y1M A;  2XEU A;  3O35 A;  4ZQL A;  4R7E A;  5LKX A;  1K2F A;  1X4J A;  4FJC A;  4B86 C;  2EOD A;  3FL2 A;  4FIP A;  2LXH C;  1IYM A;  1WEQ A;  5D1M B;  2IDA A;  3ZPV 1;  3MHH A;  5H1V A;  4N3W A;  2ECT A;  4AYC B;  5LKZ A;  4UP5 A;  4LJN A;  1MM2 A;  3M63 A;  2QIZ A;  4F52 B;  5D1L B;  2H0D B;  2YQM A;  5EYA F;  4PPE A;  3RTR B;  4P5O B;  4A0C D;  1WGM A;  3VK6 A;  4A4C A;  3KNV A;  3NG2 A;  1WEN A;  4YAT A;  5C13 A;  4TKP B;  3L1X A;  4NN2 A;  3N9M A;  3U5P A;  4AP4 A;  4FK5 A;  3I2D A;  3LQI A;  3KV6 A;  4LKA A;  2KYU A;  2K16 A;  2LGK A;  3N9L A;  4ZDT A;  1FP0 A;  3GL6 A;  2VPE A;  3O34 A;  1WFK A;  4FO9 A;  2LGL A;  2EGP A;  5AIU A;  2YUR A;  2ECW A;  3V43 A;  4YAX A;  5H1U A;  2F6N A;  4YAD A;  2CKL A;  1JOC A;  1WEU A;  1VFY A;  5G0F A;  1U6G B;  2G6Q A;  3SOU A;  2KU3 A;  3PUR A;  2ZET C;  4WZ2 A;  1G25 A;  2HDP A;  1T1H A;  2MD8 C;  4I7D A;  4WA6 A;  5B79 A;  2ECG A;  3SOW A;  2NAA A;  2YHN A;  1FBV A;  2RSD A;  4BBQ A;  3ZPV E;  2LGG A;  2CKL B;  2G43 A;  4B7Y C;  1E4U A;  2MIQ A;  3LQJ A;  4GND A;  1WE9 A;  4XI1 A;  2KWJ A;  2JRJ A;  2CT2 A;  4V3K C;  1VD4 A;  1WEE A;  1RMD A;  5TDW A;  2PUY A;  3SOX A;  2VPB A;  5DKA A;  5J3X A;  3PUQ A;  2JMD A;  4ZUX U;  3RPG C;  3GV4 A;  2YUC A;  1DVP A;  1Z6U A;  3HCS A;  2E6R A;  2M1R A;  2E6S A;  2K4D A;  3C5K A;  2YU4 A;  1WEP A;  2KRE A;  2ECI A;  2L5U A;  3O36 A; 
#chains in the Genus database with same CATH topology
 2KKY A;  3O33 A;  5G04 B;  1X4I A;  2YYR A;  2KGI A;  2VJE A;  4YC9 A;  3Q1D A;  3N9N A;  3RPG B;  3ZVY A;  4F1P A;  5FEY A;  5TAB A;  2EA6 A;  3T7L A;  2VNF A;  2VJF A;  5TRB A;  5SVI A;  5D1K B;  1N87 A;  5TBN A;  3DPL R;  2YQL A;  2MT5 A;  2YVR A;  3KV5 A;  2CRR A;  2VJE B;  4L58 A;  2XB1 A;  3O47 A;  3N9Q A;  4Q6F A;  4YBS A;  1BOR A;  1WIL A;  2PNX A;  2VJF B;  4YBT A;  3O70 A;  5SVI B;  4L7X A;  3T6R A;  5B77 A;  3QZV A;  5SVX A;  2M3H A;  2IQJ A;  3U5M A;  2VP7 A;  2OXQ C;  2RI7 A;  4MVT A;  5DIN A;  5FB1 A;  3HCT A;  2ECN A;  1WEO A;  2YRE A;  2KIZ A;  4O62 A;  4WZ3 B;  1WEM A;  3DDT A;  3M7K A;  3ZNI A;  3U5N A;  4R2Y A;  2P57 A;  1LDK C;  3T9K A;  2DJA A;  2G45 A;  2CSZ A;  2JMI A;  2Y1N A;  2I50 A;  2CON A;  1WEW A;  2KWN A;  2Y43 A;  2FUI A;  3FAO A;  3LJU X;  2K17 A;  2M85 A;  1DCQ A;  2MA6 A;  2B0O E;  2YHO A;  5G05 B;  4BHW A;  5KH3 A;  2L43 A;  2KR4 A;  4YAB A;  2K1J A;  2HYE D;  2VPG A;  2KWK A;  2DX8 A;  2KFT A;  3PLW A;  1HYI A;  2E61 A;  2C2L A;  3M99 A;  3M62 A;  5SVY A;  3SUB A;  2LXP C;  3DWD A;  3ZTG A;  4CCG X;  1XWH A;  4LK9 A;  2LV9 A;  4X3G A;  1WIM A;  2ECJ A;  3ZVZ B;  1JM7 A;  2YW8 A;  2F6J A;  2MNZ A;  4I7B A;  4GNF A;  3O37 A;  4A49 A;  2FD4 A;  5I3L A;  2M6M A;  4MSX A;  4S3O B;  1X4U A;  2D8S A;  4PTB A;  1MBM A;  3SHB A;  4QF2 A;  2KWO A;  5FER A;  2MNY A;  2LDR A;  2LGV A;  3PHD A;  1HYJ A;  1JM7 B;  3IHP A;  1WES A;  3HCU A;  4O64 A;  2FFW A;  3EB6 A;  1MM3 A;  2JM3 A;  4N4F A;  5B78 A;  4H9D A;  2UZG A;  4I7C A;  1V87 A;  4LAD B;  3LQH A;  5H9M A;  3L11 A;  5KH9 A;  2C2V S;  1ZBD B;  2ECV A;  3HTK C;  3N9O A;  2QIC A;  2BAY A;  5LKU A;  1CHC A;  2LRI C;  4R8P K;  5H1T A;  1VYX A;  3EB5 A;  5JG6 A;  2MA5 A;  2M13 A;  4UP0 A;  3C6W A;  2JMJ A;  2MD7 B;  3ASL A;  4LLB A;  4YBM A;  4GNG A;  1LDJ B;  2LN0 A;  5KH7 A;  4GB0 A;  4AUQ B;  2FSA A;  3LRQ A;  4IC3 A;  2MUM A;  2KGG A;  3E2D A;  4WZ0 A;  2LQ6 A;  5LKT A;  2YSM A;  4CA1 A;  2F42 A;  5B75 A;  2LAU A;  1Z2Q A;  2CSY A;  3L1Z B;  3MHS A;  3KQI A;  5AIT A;  2L80 A;  4W4U A;  1Z60 A;  2YSJ A;  5B76 A;  3DQV R;  2QJ0 A;  2KKX A;  4V3L C;  1WEV A;  2KE1 A;  4QF3 A;  4IC2 A;  5B8D A;  4AVX A;  1F62 A;  2YT5 A;  3FEH A;  4A4B A;  3O7A A;  3U5O A;  2FUU A;  2EGM A;  2L0B A;  4S3O C;  2AN6 A;  5FB0 A;  2VPD A;  3ZYQ A;  4C9Z A;  4UI9 B;  2XOY A;  4AYC A;  5C11 A;  2OWA A;  2RR4 A;  4GNE A;  5TDR A;  2H0D A;  3N9P A;  5LCW B;  2L75 A;  2DSM A;  2Y1M A;  2XEU A;  3O35 A;  4ZQL A;  4R7E A;  3MDB C;  5LKX A;  1K2F A;  1X4J A;  4FJC A;  4B86 C;  2EOD A;  3FL2 A;  4FIP A;  2LXH C;  1IYM A;  1WEQ A;  5D1M B;  2IDA A;  3ZPV 1;  2L7P A;  3MHH A;  5H1V A;  4N3W A;  2XP0 A;  2ECT A;  4AYC B;  5LKZ A;  4UP5 A;  4LJN A;  1MM2 A;  3M63 A;  2QIZ A;  2CRW A;  4F52 B;  5D1L B;  2H0D B;  2YQM A;  5EYA F;  4PPE A;  3RTR B;  4P5O B;  4A0C D;  1WGM A;  3VK6 A;  4A4C A;  3KNV A;  4Z0R A;  3NG2 A;  1WEN A;  2EXU A;  4YAT A;  5C13 A;  4TKP B;  3L1X A;  4NN2 A;  3N9M A;  3U5P A;  4AP4 A;  3H7H A;  4FK5 A;  3I2D A;  3LQI A;  3KV6 A;  4LKA A;  2KYU A;  2K16 A;  2LGK A;  3N9L A;  4ZDT A;  3FAN A;  2D8U A;  1FP0 A;  2XOC A;  3GL6 A;  2VPE A;  3O34 A;  1WFK A;  4FO9 A;  2LGL A;  2EGP A;  5AIU A;  2YUR A;  2ECW A;  4OGE A;  2CSV A;  3V43 A;  2XOZ A;  4YAX A;  3FM8 C;  5H1U A;  2F6N A;  4YAD A;  2CKL A;  1JOC A;  1WEU A;  1VFY A;  5G0F A;  1U6G B;  2G6Q A;  3SOU A;  2JUN A;  2KU3 A;  3PUR A;  2ZET C;  4WZ2 A;  5K3Q A;  1G25 A;  2MKE A;  2HDP A;  1T1H A;  2MD8 C;  4I7D A;  4WA6 A;  5B79 A;  3LDY A;  3FJU B;  2ECG A;  3SOW A;  2NAA A;  2YHN A;  1FBV A;  2RSD A;  4BBQ A;  3ZPV E;  4Z0O A;  2LGG A;  2CKL B;  3LVQ E;  2G43 A;  4B7Y C;  1E4U A;  2MIQ A;  3LQJ A;  4GND A;  1WE9 A;  4XI1 A;  2KWJ A;  2JRJ A;  2CT2 A;  4V3K C;  1VD4 A;  1WEE A;  1RMD A;  5TDW A;  2PUY A;  3SOX A;  3JUE A;  4QQ4 A;  2VPB A;  5DKA A;  5J3X A;  3LVR E;  3PUQ A;  2JMD A;  4ZUX U;  3RPG C;  3GV4 A;  2YUC A;  1DVP A;  4OGC A;  1Z6U A;  3HCS A;  2E6R A;  2M1R A;  2E6S A;  2K4D A;  3C5K A;  2YU4 A;  1WEP A;  3KDE C;  2KRE A;  2ECI A;  2L5U A;  3O36 A; 
#chains in the Genus database with same CATH homology
 3O33 A;  5G04 B;  1X4I A;  2YYR A;  2KGI A;  2VJE A;  4YC9 A;  3RPG B;  3N9N A;  3ZVY A;  5FEY A;  5TAB A;  2EA6 A;  3T7L A;  2VNF A;  2VJF A;  5TRB A;  5D1K B;  1N87 A;  5TBN A;  3DPL R;  2YQL A;  2MT5 A;  3KV5 A;  2VJE B;  4L58 A;  2XB1 A;  3N9Q A;  4Q6F A;  4YBS A;  1BOR A;  1WIL A;  2PNX A;  2VJF B;  4YBT A;  3O70 A;  4L7X A;  3T6R A;  5B77 A;  3QZV A;  2M3H A;  3U5M A;  2VP7 A;  2OXQ C;  2RI7 A;  4MVT A;  5DIN A;  5FB1 A;  3HCT A;  2ECN A;  1WEO A;  2YRE A;  2KIZ A;  4WZ3 B;  1WEM A;  3ZNI A;  3U5N A;  4R2Y A;  1LDK C;  2G45 A;  2CSZ A;  2JMI A;  2Y1N A;  2I50 A;  1WEW A;  2KWN A;  2Y43 A;  2FUI A;  2K17 A;  2M85 A;  2MA6 A;  2YHO A;  5G05 B;  4BHW A;  5KH3 A;  2L43 A;  2KR4 A;  4YAB A;  2K1J A;  2HYE D;  2VPG A;  2KWK A;  2DX8 A;  2KFT A;  1HYI A;  3M99 A;  2C2L A;  3M62 A;  2LXP C;  3ZTG A;  4CCG X;  1XWH A;  4LK9 A;  2LV9 A;  4X3G A;  1WIM A;  2ECJ A;  3ZVZ B;  1JM7 A;  2YW8 A;  2F6J A;  2MNZ A;  4I7B A;  4GNF A;  3O37 A;  4A49 A;  5I3L A;  2M6M A;  4MSX A;  4S3O B;  1X4U A;  2D8S A;  4PTB A;  3SHB A;  4QF2 A;  2KWO A;  5FER A;  2MNY A;  2LDR A;  2LGV A;  3PHD A;  1HYJ A;  1JM7 B;  3IHP A;  1WES A;  3HCU A;  4O64 A;  3EB6 A;  1MM3 A;  4N4F A;  5B78 A;  2UZG A;  4I7C A;  1V87 A;  4LAD B;  3LQH A;  5H9M A;  3L11 A;  5KH9 A;  2C2V S;  1ZBD B;  2ECV A;  3HTK C;  3N9O A;  2QIC A;  2BAY A;  5LKU A;  1CHC A;  2LRI C;  4R8P K;  5H1T A;  1VYX A;  3EB5 A;  5JG6 A;  2MA5 A;  4UP0 A;  3C6W A;  2JMJ A;  2MD7 B;  3ASL A;  4LLB A;  4YBM A;  4GNG A;  1LDJ B;  2LN0 A;  5KH7 A;  4GB0 A;  4AUQ B;  2FSA A;  4IC3 A;  3LRQ A;  2MUM A;  2KGG A;  4WZ0 A;  2LQ6 A;  5LKT A;  2YSM A;  4CA1 A;  2F42 A;  5B75 A;  1Z2Q A;  2CSY A;  3L1Z B;  3MHS A;  3KQI A;  5AIT A;  2L80 A;  4W4U A;  1Z60 A;  2YSJ A;  5B76 A;  3DQV R;  2QJ0 A;  4V3L C;  1WEV A;  2KE1 A;  4QF3 A;  4IC2 A;  5B8D A;  4AVX A;  1F62 A;  2YT5 A;  4A4B A;  3O7A A;  3U5O A;  2FUU A;  2L0B A;  4S3O C;  2AN6 A;  5FB0 A;  2VPD A;  3ZYQ A;  4C9Z A;  4UI9 B;  4AYC A;  5C11 A;  4GNE A;  5TDR A;  2H0D A;  3N9P A;  5LCW B;  2L75 A;  2Y1M A;  2XEU A;  3O35 A;  4ZQL A;  4R7E A;  5LKX A;  1K2F A;  1X4J A;  4FJC A;  4B86 C;  2EOD A;  3FL2 A;  4FIP A;  2LXH C;  1IYM A;  1WEQ A;  5D1M B;  2IDA A;  3ZPV 1;  3MHH A;  5H1V A;  4N3W A;  2ECT A;  4AYC B;  5LKZ A;  4UP5 A;  4LJN A;  1MM2 A;  3M63 A;  2QIZ A;  4F52 B;  5D1L B;  2H0D B;  2YQM A;  5EYA F;  4PPE A;  3RTR B;  4P5O B;  4A0C D;  1WGM A;  3VK6 A;  4A4C A;  3KNV A;  3NG2 A;  1WEN A;  4YAT A;  5C13 A;  4TKP B;  3L1X A;  4NN2 A;  3N9M A;  3U5P A;  4AP4 A;  4FK5 A;  3I2D A;  3LQI A;  3KV6 A;  4LKA A;  2KYU A;  2K16 A;  2LGK A;  3N9L A;  4ZDT A;  1FP0 A;  3GL6 A;  2VPE A;  3O34 A;  1WFK A;  4FO9 A;  2LGL A;  2EGP A;  5AIU A;  2YUR A;  2ECW A;  3V43 A;  4YAX A;  5H1U A;  2F6N A;  4YAD A;  2CKL A;  1JOC A;  1WEU A;  1VFY A;  5G0F A;  1U6G B;  2G6Q A;  3SOU A;  2KU3 A;  3PUR A;  2ZET C;  4WZ2 A;  1G25 A;  2HDP A;  1T1H A;  2MD8 C;  4I7D A;  4WA6 A;  5B79 A;  2ECG A;  3SOW A;  2NAA A;  2YHN A;  1FBV A;  2RSD A;  4BBQ A;  3ZPV E;  2LGG A;  2CKL B;  2G43 A;  4B7Y C;  1E4U A;  2MIQ A;  3LQJ A;  4GND A;  1WE9 A;  4XI1 A;  2KWJ A;  2JRJ A;  2CT2 A;  4V3K C;  1VD4 A;  1WEE A;  1RMD A;  5TDW A;  2PUY A;  3SOX A;  2VPB A;  5DKA A;  5J3X A;  3PUQ A;  2JMD A;  4ZUX U;  3RPG C;  3GV4 A;  2YUC A;  1DVP A;  1Z6U A;  3HCS A;  2E6R A;  2M1R A;  2E6S A;  2K4D A;  3C5K A;  2YU4 A;  1WEP A;  2KRE A;  2ECI A;  2L5U A;  3O36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...