4CCGX

Structure of an e2-e3 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
EKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
pubmed doi rcsb
molecule keywords UBIQUITIN-CONJUGATING ENZYME E2 T
molecule tags Ligase
source organism Homo sapiens
total genus 10
structure length 75
sequence length 75
chains with identical sequence Y
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF11793 FANCL_C FANCL C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4ccgX00
4IC2A 4N3WA 3HCTA 2K4DA 3FL2A 3MHSA 2YT5A 1WILA 1RMDA 1WEPA 2CKLA 4R8PK 5G0FA 4YATA 4AUQB 3LQIA 4GNFA 1N87A 5KH3A 3HCUA 1X4JA 2VJFB 4V3LC 2KIZA 2YHOA 4LKAA 2VNFA 3ZNIA 2M1RA 2KWOA 2YUCA 1F62A 2F6NA 4C9ZA 1BORA 3LQHA 2MA6A 3KV6A 3ASLA 3N9PA 1MM3A 3GV4A 2DX8A 1K2FA 4FJCA 4LJNA 4UI9B 4W4UA 3VK6A 2ECGA 5DINA 2IDAA 2LXPC 2QIZA 4WZ3B 4WA6A 5B78A 4GNGA 2F42A 1JOCA 2XB1A 2YHNA 2JMIA 5LKUA 4B86C 1WEUA 1WEEA 2CT2A 2RI7A 4UP5A 2MNZA 5TABA 3EB6A 2G43A 5AIUA 2MT5A 1VYXA 2NAAA 2K17A 3I2DA 2HYED 4R2YA 2KGIA 3ZTGA 2E6RA 4TKPB 4L58A 1JM7A 1DVPA 2ECIA 5FB0A 2M6MA 2MA5A 2MIQA 2LDRA 4CA1A 2F6JA 3ZVZB 1HYIA 1WESA 2FUUA 4S3OB 2H0DB 2EA6A 3DPLR 2MD8C 4A4CA 3O70A 1WEOA 2AN6A 3EB5A 5JG6A 3L11A 4AYCB 2MUMA 1MM2A 1VD4A 1WIMA 4S3OC 5H1TA 2VPEA 5LKZA 4NN2A 2YURA 2M3HA 2EODA 4LK9A 2Y43A 2G45A 2VJFA 5DKAA 4YADA 4BBQA 3ZVYA 2YREA 1WEMA 3RPGB 4ZQLA 3O33A 3N9MA 1E4UA 2LV9A 2L0BA 4PPEA 1WENA 3RPGC 2LGGA 2QICA 2EGPA 2YSMA 3O36A 3N9QA 4GNEA 2YSJA 4V3KC 4YAXA 1HYJA 4F52B 2VJEB 2KWJA 4I7BA 2K16A 4O64A 4B7YC 4XI1A 3L1ZB 1XWHA 2YYRA 5J3XA 3NG2A 2LQ6A 2JMJA 3ZPV1 4FIPA 4AVXA 3KQIA 4FO9A 4LLBA 3PHDA 4MSXA 3SOWA 1VFYA 2FUIA 2I50A 4A4BA 4QF2A 5B77A 4YBSA 5B75A 1Z6UA 5D1MB 3ZYQA 2CSZA 4I7CA 4MVTA 5TRBA 3O35A 5LCWB 2KWKA 2PUYA 5FB1A 4BHWA 1ZBDB 5H1VA 1IYMA 2JRJA 1G25A 1LDJB 3O34A 3DQVR 2ECVA 4IC3A 5TDWA 5G05B 2JMDA 3HCSA 3N9NA 1X4UA 5FEYA 4YBTA 3M63A 4WZ2A 4AYCA 1Z2QA 5FERA 2KFTA 2Y1NA 2LXHC 3LQJA 5D1LB 1WFKA 2OXQC 4FK5A 3IHPA 2KU3A 2L75A 3HTKC 2LGLA 1FP0A 2D8SA 1WEWA 3GL6A 2VPBA 4LADB 4A0CD 3U5MA 4A49A 4Q6FA 4UP0A 2C2LA 1X4IA 2K1JA 4I7DA 4CCGX 3N9LA 3ZPVE 3MHHA 2XEUA 3U5PA 3SHBA 1LDKC 2LN0A 2KYUA 3V43A 3RTRB 4WZ0A 2ECJA 2LGVA 2MNYA 5KH7A 2QJ0A 2CKLB 2YU4A 5EYAF 5TBNA 5I3LA 3U5NA 2CSYA 3L1XA 1FBVA 2ECTA 2E6SA 2VJEA 2C2VS 4ZUXU 2Y1MA 1WEQA 4X3GA 5KH9A 3U5OA 2G6QA 2L80A 1WE9A 2UZGA 2VPGA 5TDRA 4PTBA 1CHCA 4QF3A 4P5OB 2ZETC 2KREA 3PUQA 2BAYA 4L7XA 2KWNA 2ECWA 5G04B 2FSAA 3O7AA 2LGKA 3KNVA 3O37A 1U6GB 3KV5A 2YQLA 5LKTA 5H1UA 1Z60A 5H9MA 5B8DA 3LRQA 5C13A 2YQMA 1V87A 3QZVA 4ZDTA 3N9OA 3SOUA 4YABA 4GNDA 4N4FA 5C11A 2M85A 2LRIC 3T6RA 1T1HA 2RSDA 2VP7A 4R7EA 2H0DA 2KGGA 5D1KB 3T7LA 2VPDA 4YBMA 3M99A 4AP4A 2HDPA 2L5UA 2L43A 2PNXA 5LKXA 5AITA 4YC9A 3SOXA 2KE1A 3C5KA 2KR4A 1WEVA 1JM7B 2MD7B 3PURA 4GB0A 3C6WA 2YW8A 2ECNA 1WGMA 3M62A 5B79A 5B76A
chains in the Genus database with same CATH superfamily
4IC2A 4N3WA 3HCTA 3Q1DA 2K4DA 3FL2A 3MHSA 2YT5A 1WILA 1RMDA 1WEPA 2CKLA 4R8PK 5G0FA 2E61A 4YATA 4AUQB 3LQIA 4GNFA 4OGEA 1N87A 5KH3A 3HCUA 1X4JA 2FD4A 2VJFB 4V3LC 3KDEC 2KIZA 2YHOA 4LKAA 2VNFA 2XOCA 2XOYA 3ZNIA 3LVQE 2M1RA 2KWOA 2YUCA 1F62A 2F6NA 4C9ZA 1BORA 3LQHA 5SVIA 2MA6A 3KV6A 3ASLA 3N9PA 1MM3A 3GV4A 2DX8A 2JM3A 4Z0RA 1K2FA 4FJCA 4LJNA 4UI9B 4W4UA 3VK6A 2ECGA 5DINA 2IDAA 2LXPC 5SVYA 2QIZA 4WZ3B 4WA6A 5B78A 4GNGA 2F42A 1JOCA 4OGCA 2CRWA 2XB1A 2YHNA 2JMIA 5LKUA 4B86C 1WEUA 1WEEA 2CT2A 2RI7A 4UP5A 2MNZA 5TABA 2M13A 3EB6A 2G43A 5AIUA 2MT5A 1VYXA 3E2DA 2NAAA 2K17A 3I2DA 2HYED 4R2YA 2KGIA 3JUEA 3ZTGA 2E6RA 4TKPB 4L58A 1JM7A 1DVPA 2ECIA 5FB0A 2EXUA 2M6MA 2MA5A 2MIQA 2LDRA 4CA1A 2F6JA 3FAOA 3ZVZB 1HYIA 4QQ4A 1WESA 1DCQA 2FUUA 2DJAA 4S3OB 2H0DB 3H7HA 2EA6A 3DPLR 2MD8C 4A4CA 3O70A 1WEOA 2AN6A 3EB5A 5JG6A 3L11A 4AYCB 2MUMA 1MM2A 1VD4A 1WIMA 4S3OC 5H1TA 2VPEA 5LKZA 4NN2A 2YURA 2M3HA 2EODA 4LK9A 2Y43A 2G45A 2VJFA 5DKAA 4YADA 4BBQA 3ZVYA 2YREA 1WEMA 3RPGB 4ZQLA 3O33A 2KKYA 3LDYA 3N9MA 1E4UA 2LV9A 3LVRE 2L0BA 4PPEA 1WENA 3RPGC 2LGGA 2QICA 3LJUX 2EGPA 2LAUA 2YSMA 3O36A 3N9QA 2CONA 3FJUB 4GNEA 2L7PA 2YSJA 4V3KC 4YAXA 5K3QA 1HYJA 4F52B 2VJEB 2KWJA 4I7BA 2K16A 2KKXA 2CSVA 4O64A 4B7YC 4XI1A 3L1ZB 1XWHA 2YYRA 2D8UA 5J3XA 3NG2A 2LQ6A 3FM8C 2JMJA 3ZPV1 4FIPA 4AVXA 3KQIA 4FO9A 4LLBA 3PHDA 4MSXA 3SOWA 2FFWA 1VFYA 2FUIA 2I50A 4A4BA 4QF2A 5B77A 4YBSA 5B75A 1Z6UA 2DSMA 5D1MB 3ZYQA 2CSZA 4I7CA 4MVTA 5TRBA 3O35A 5LCWB 2KWKA 2PUYA 5FB1A 4BHWA 1ZBDB 5H1VA 1IYMA 3PLWA 2JRJA 1G25A 1LDJB 2JUNA 2MKEA 3O34A 3DQVR 2ECVA 4IC3A 5TDWA 5G05B 2JMDA 3HCSA 3N9NA 1X4UA 5FEYA 4YBTA 3M63A 4WZ2A 4AYCA 1Z2QA 5FERA 2KFTA 2Y1NA 3M7KA 2LXHC 3LQJA 5D1LB 1WFKA 2OXQC 4FK5A 3IHPA 3T9KA 2KU3A 2L75A 2B0OE 3HTKC 2LGLA 1FP0A 2CRRA 2D8SA 5SVXA 1WEWA 3GL6A 2VPBA 4LADB 4A0CD 3U5MA 4A49A 4Q6FA 4UP0A 2C2LA 1X4IA 2K1JA 4I7DA 3O47A 3N9LA 3ZPVE 3MHHA 4CCGX 2XEUA 2XP0A 3U5PA 3DWDA 3SHBA 1LDKC 2LN0A 2KYUA 2P57A 3V43A 3RTRB 4WZ0A 2ECJA 2LGVA 2MNYA 5KH7A 2QJ0A 2CKLB 4O62A 2YVRA 2YU4A 2XOZA 5EYAF 5TBNA 2EGMA 5I3LA 3U5NA 2CSYA 3L1XA 1FBVA 2ECTA 2E6SA 2VJEA 2C2VS 4ZUXU 2Y1MA 1WEQA 4X3GA 5KH9A 3U5OA 3FEHA 2IQJA 2G6QA 4H9DA 2L80A 1WE9A 2UZGA 2VPGA 5TDRA 4PTBA 1CHCA 4QF3A 4P5OB 2ZETC 2KREA 3PUQA 2BAYA 4L7XA 2KWNA 3MDBC 2ECWA 5SVIB 5G04B 2FSAA 3O7AA 2LGKA 3KNVA 3O37A 4Z0OA 1U6GB 3KV5A 2YQLA 5LKTA 5H1UA 1Z60A 3SUBA 5H9MA 5B8DA 3LRQA 5C13A 2YQMA 1V87A 3DDTA 3QZVA 4ZDTA 3N9OA 3SOUA 4YABA 4GNDA 4N4FA 5C11A 2M85A 2LRIC 3T6RA 1T1HA 2RSDA 2VP7A 4R7EA 2H0DA 2KGGA 2OWAA 5D1KB 3T7LA 2VPDA 3FANA 4YBMA 3M99A 4AP4A 2HDPA 4F1PA 2L5UA 1MBMA 2L43A 2RR4A 2PNXA 5LKXA 5AITA 4YC9A 3SOXA 2KE1A 3C5KA 2KR4A 1WEVA 1JM7B 2MD7B 3PURA 4GB0A 3C6WA 2YW8A 2ECNA 1WGMA 3M62A 5B79A 5B76A
chains in the Genus database with same CATH topology
4IC2A 4N3WA 3HCTA 2K4DA 3FL2A 3MHSA 2YT5A 1WILA 1RMDA 1WEPA 2CKLA 4R8PK 5G0FA 4YATA 4AUQB 3LQIA 4GNFA 1N87A 5KH3A 3HCUA 1X4JA 2VJFB 4V3LC 2KIZA 2YHOA 4LKAA 2VNFA 3ZNIA 2M1RA 2KWOA 2YUCA 1F62A 2F6NA 4C9ZA 1BORA 3LQHA 2MA6A 3KV6A 3ASLA 3N9PA 1MM3A 3GV4A 2DX8A 1K2FA 4FJCA 4LJNA 4UI9B 4W4UA 3VK6A 2ECGA 5DINA 2IDAA 2LXPC 2QIZA 4WZ3B 4WA6A 5B78A 4GNGA 2F42A 1JOCA 2XB1A 2YHNA 2JMIA 5LKUA 4B86C 1WEUA 1WEEA 2CT2A 2RI7A 4UP5A 2MNZA 5TABA 3EB6A 2G43A 5AIUA 2MT5A 1VYXA 2NAAA 2K17A 3I2DA 2HYED 4R2YA 2KGIA 3ZTGA 2E6RA 4TKPB 4L58A 1JM7A 1DVPA 2ECIA 5FB0A 2M6MA 2MA5A 2MIQA 2LDRA 4CA1A 2F6JA 3ZVZB 1HYIA 1WESA 2FUUA 4S3OB 2H0DB 2EA6A 3DPLR 2MD8C 4A4CA 3O70A 1WEOA 2AN6A 3EB5A 5JG6A 3L11A 4AYCB 2MUMA 1MM2A 1VD4A 1WIMA 4S3OC 5H1TA 2VPEA 5LKZA 4NN2A 2YURA 2M3HA 2EODA 4LK9A 2Y43A 2G45A 2VJFA 5DKAA 4YADA 4BBQA 3ZVYA 2YREA 1WEMA 3RPGB 4ZQLA 3O33A 3N9MA 1E4UA 2LV9A 2L0BA 4PPEA 1WENA 3RPGC 2LGGA 2QICA 2EGPA 2YSMA 3O36A 3N9QA 4GNEA 2YSJA 4V3KC 4YAXA 1HYJA 4F52B 2VJEB 2KWJA 4I7BA 2K16A 4O64A 4B7YC 4XI1A 3L1ZB 1XWHA 2YYRA 5J3XA 3NG2A 2LQ6A 2JMJA 3ZPV1 4FIPA 4AVXA 3KQIA 4FO9A 4LLBA 3PHDA 4MSXA 3SOWA 1VFYA 2FUIA 2I50A 4A4BA 4QF2A 5B77A 4YBSA 5B75A 1Z6UA 5D1MB 3ZYQA 2CSZA 4I7CA 4MVTA 5TRBA 3O35A 5LCWB 2KWKA 2PUYA 5FB1A 4BHWA 1ZBDB 5H1VA 1IYMA 2JRJA 1G25A 1LDJB 3O34A 3DQVR 2ECVA 4IC3A 5TDWA 5G05B 2JMDA 3HCSA 3N9NA 1X4UA 5FEYA 4YBTA 3M63A 4WZ2A 4AYCA 1Z2QA 5FERA 2KFTA 2Y1NA 2LXHC 3LQJA 5D1LB 1WFKA 2OXQC 4FK5A 3IHPA 2KU3A 2L75A 3HTKC 2LGLA 1FP0A 2D8SA 1WEWA 3GL6A 2VPBA 4LADB 4A0CD 3U5MA 4A49A 4Q6FA 4UP0A 2C2LA 1X4IA 2K1JA 4I7DA 4CCGX 3N9LA 3ZPVE 3MHHA 2XEUA 3U5PA 3SHBA 1LDKC 2LN0A 2KYUA 3V43A 3RTRB 4WZ0A 2ECJA 2LGVA 2MNYA 5KH7A 2QJ0A 2CKLB 2YU4A 5EYAF 5TBNA 5I3LA 3U5NA 2CSYA 3L1XA 1FBVA 2ECTA 2E6SA 2VJEA 2C2VS 4ZUXU 2Y1MA 1WEQA 4X3GA 5KH9A 3U5OA 2G6QA 2L80A 1WE9A 2UZGA 2VPGA 5TDRA 4PTBA 1CHCA 4QF3A 4P5OB 2ZETC 2KREA 3PUQA 2BAYA 4L7XA 2KWNA 2ECWA 5G04B 2FSAA 3O7AA 2LGKA 3KNVA 3O37A 1U6GB 3KV5A 2YQLA 5LKTA 5H1UA 1Z60A 5H9MA 5B8DA 3LRQA 5C13A 2YQMA 1V87A 3QZVA 4ZDTA 3N9OA 3SOUA 4YABA 4GNDA 4N4FA 5C11A 2M85A 2LRIC 3T6RA 1T1HA 2RSDA 2VP7A 4R7EA 2H0DA 2KGGA 5D1KB 3T7LA 2VPDA 4YBMA 3M99A 4AP4A 2HDPA 2L5UA 2L43A 2PNXA 5LKXA 5AITA 4YC9A 3SOXA 2KE1A 3C5KA 2KR4A 1WEVA 1JM7B 2MD7B 3PURA 4GB0A 3C6WA 2YW8A 2ECNA 1WGMA 3M62A 5B79A 5B76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IC2 A;  4N3W A;  3HCT A;  2K4D A;  3FL2 A;  3MHS A;  2YT5 A;  1WIL A;  1RMD A;  1WEP A;  2CKL A;  4R8P K;  5G0F A;  4YAT A;  4AUQ B;  3LQI A;  4GNF A;  1N87 A;  5KH3 A;  3HCU A;  1X4J A;  2VJF B;  4V3L C;  2KIZ A;  2YHO A;  4LKA A;  2VNF A;  3ZNI A;  2M1R A;  2KWO A;  2YUC A;  1F62 A;  2F6N A;  4C9Z A;  1BOR A;  3LQH A;  2MA6 A;  3KV6 A;  3ASL A;  3N9P A;  1MM3 A;  3GV4 A;  2DX8 A;  1K2F A;  4FJC A;  4LJN A;  4UI9 B;  4W4U A;  3VK6 A;  2ECG A;  5DIN A;  2IDA A;  2LXP C;  2QIZ A;  4WZ3 B;  4WA6 A;  5B78 A;  4GNG A;  2F42 A;  1JOC A;  2XB1 A;  2YHN A;  2JMI A;  5LKU A;  4B86 C;  1WEU A;  1WEE A;  2CT2 A;  2RI7 A;  4UP5 A;  2MNZ A;  5TAB A;  3EB6 A;  2G43 A;  5AIU A;  2MT5 A;  1VYX A;  2NAA A;  2K17 A;  3I2D A;  2HYE D;  4R2Y A;  2KGI A;  3ZTG A;  2E6R A;  4TKP B;  4L58 A;  1JM7 A;  1DVP A;  2ECI A;  5FB0 A;  2M6M A;  2MA5 A;  2MIQ A;  2LDR A;  4CA1 A;  2F6J A;  3ZVZ B;  1HYI A;  1WES A;  2FUU A;  4S3O B;  2H0D B;  2EA6 A;  3DPL R;  2MD8 C;  4A4C A;  3O70 A;  1WEO A;  2AN6 A;  3EB5 A;  5JG6 A;  3L11 A;  4AYC B;  2MUM A;  1MM2 A;  1VD4 A;  1WIM A;  4S3O C;  5H1T A;  2VPE A;  5LKZ A;  4NN2 A;  2YUR A;  2M3H A;  2EOD A;  4LK9 A;  2Y43 A;  2G45 A;  2VJF A;  5DKA A;  4YAD A;  4BBQ A;  3ZVY A;  2YRE A;  1WEM A;  3RPG B;  4ZQL A;  3O33 A;  3N9M A;  1E4U A;  2LV9 A;  2L0B A;  4PPE A;  1WEN A;  3RPG C;  2LGG A;  2QIC A;  2EGP A;  2YSM A;  3O36 A;  3N9Q A;  4GNE A;  2YSJ A;  4V3K C;  4YAX A;  1HYJ A;  4F52 B;  2VJE B;  2KWJ A;  4I7B A;  2K16 A;  4O64 A;  4B7Y C;  4XI1 A;  3L1Z B;  1XWH A;  2YYR A;  5J3X A;  3NG2 A;  2LQ6 A;  2JMJ A;  3ZPV 1;  4FIP A;  4AVX A;  3KQI A;  4FO9 A;  4LLB A;  3PHD A;  4MSX A;  3SOW A;  1VFY A;  2FUI A;  2I50 A;  4A4B A;  4QF2 A;  5B77 A;  4YBS A;  5B75 A;  1Z6U A;  5D1M B;  3ZYQ A;  2CSZ A;  4I7C A;  4MVT A;  5TRB A;  3O35 A;  5LCW B;  2KWK A;  2PUY A;  5FB1 A;  4BHW A;  1ZBD B;  5H1V A;  1IYM A;  2JRJ A;  1G25 A;  1LDJ B;  3O34 A;  3DQV R;  2ECV A;  4IC3 A;  5TDW A;  5G05 B;  2JMD A;  3HCS A;  3N9N A;  1X4U A;  5FEY A;  4YBT A;  3M63 A;  4WZ2 A;  4AYC A;  1Z2Q A;  5FER A;  2KFT A;  2Y1N A;  2LXH C;  3LQJ A;  5D1L B;  1WFK A;  2OXQ C;  4FK5 A;  3IHP A;  2KU3 A;  2L75 A;  3HTK C;  2LGL A;  1FP0 A;  2D8S A;  1WEW A;  3GL6 A;  2VPB A;  4LAD B;  4A0C D;  3U5M A;  4A49 A;  4Q6F A;  4UP0 A;  2C2L A;  1X4I A;  2K1J A;  4I7D A;  4CCG X;  3N9L A;  3ZPV E;  3MHH A;  2XEU A;  3U5P A;  3SHB A;  1LDK C;  2LN0 A;  2KYU A;  3V43 A;  3RTR B;  4WZ0 A;  2ECJ A;  2LGV A;  2MNY A;  5KH7 A;  2QJ0 A;  2CKL B;  2YU4 A;  5EYA F;  5TBN A;  5I3L A;  3U5N A;  2CSY A;  3L1X A;  1FBV A;  2ECT A;  2E6S A;  2VJE A;  2C2V S;  4ZUX U;  2Y1M A;  1WEQ A;  4X3G A;  5KH9 A;  3U5O A;  2G6Q A;  2L80 A;  1WE9 A;  2UZG A;  2VPG A;  5TDR A;  4PTB A;  1CHC A;  4QF3 A;  4P5O B;  2ZET C;  2KRE A;  3PUQ A;  2BAY A;  4L7X A;  2KWN A;  2ECW A;  5G04 B;  2FSA A;  3O7A A;  2LGK A;  3KNV A;  3O37 A;  1U6G B;  3KV5 A;  2YQL A;  5LKT A;  5H1U A;  1Z60 A;  5H9M A;  5B8D A;  3LRQ A;  5C13 A;  2YQM A;  1V87 A;  3QZV A;  4ZDT A;  3N9O A;  3SOU A;  4YAB A;  4GND A;  4N4F A;  5C11 A;  2M85 A;  2LRI C;  3T6R A;  1T1H A;  2RSD A;  2VP7 A;  4R7E A;  2H0D A;  2KGG A;  5D1K B;  3T7L A;  2VPD A;  4YBM A;  3M99 A;  4AP4 A;  2HDP A;  2L5U A;  2L43 A;  2PNX A;  5LKX A;  5AIT A;  4YC9 A;  3SOX A;  2KE1 A;  3C5K A;  2KR4 A;  1WEV A;  1JM7 B;  2MD7 B;  3PUR A;  4GB0 A;  3C6W A;  2YW8 A;  2ECN A;  1WGM A;  3M62 A;  5B79 A;  5B76 A; 
#chains in the Genus database with same CATH topology
 4IC2 A;  4N3W A;  3HCT A;  3Q1D A;  2K4D A;  3FL2 A;  3MHS A;  2YT5 A;  1WIL A;  1RMD A;  1WEP A;  2CKL A;  4R8P K;  5G0F A;  2E61 A;  4YAT A;  4AUQ B;  3LQI A;  4GNF A;  4OGE A;  1N87 A;  5KH3 A;  3HCU A;  1X4J A;  2FD4 A;  2VJF B;  4V3L C;  3KDE C;  2KIZ A;  2YHO A;  4LKA A;  2VNF A;  2XOC A;  2XOY A;  3ZNI A;  3LVQ E;  2M1R A;  2KWO A;  2YUC A;  1F62 A;  2F6N A;  4C9Z A;  1BOR A;  3LQH A;  5SVI A;  2MA6 A;  3KV6 A;  3ASL A;  3N9P A;  1MM3 A;  3GV4 A;  2DX8 A;  2JM3 A;  4Z0R A;  1K2F A;  4FJC A;  4LJN A;  4UI9 B;  4W4U A;  3VK6 A;  2ECG A;  5DIN A;  2IDA A;  2LXP C;  5SVY A;  2QIZ A;  4WZ3 B;  4WA6 A;  5B78 A;  4GNG A;  2F42 A;  1JOC A;  4OGC A;  2CRW A;  2XB1 A;  2YHN A;  2JMI A;  5LKU A;  4B86 C;  1WEU A;  1WEE A;  2CT2 A;  2RI7 A;  4UP5 A;  2MNZ A;  5TAB A;  2M13 A;  3EB6 A;  2G43 A;  5AIU A;  2MT5 A;  1VYX A;  3E2D A;  2NAA A;  2K17 A;  3I2D A;  2HYE D;  4R2Y A;  2KGI A;  3JUE A;  3ZTG A;  2E6R A;  4TKP B;  4L58 A;  1JM7 A;  1DVP A;  2ECI A;  5FB0 A;  2EXU A;  2M6M A;  2MA5 A;  2MIQ A;  2LDR A;  4CA1 A;  2F6J A;  3FAO A;  3ZVZ B;  1HYI A;  4QQ4 A;  1WES A;  1DCQ A;  2FUU A;  2DJA A;  4S3O B;  2H0D B;  3H7H A;  2EA6 A;  3DPL R;  2MD8 C;  4A4C A;  3O70 A;  1WEO A;  2AN6 A;  3EB5 A;  5JG6 A;  3L11 A;  4AYC B;  2MUM A;  1MM2 A;  1VD4 A;  1WIM A;  4S3O C;  5H1T A;  2VPE A;  5LKZ A;  4NN2 A;  2YUR A;  2M3H A;  2EOD A;  4LK9 A;  2Y43 A;  2G45 A;  2VJF A;  5DKA A;  4YAD A;  4BBQ A;  3ZVY A;  2YRE A;  1WEM A;  3RPG B;  4ZQL A;  3O33 A;  2KKY A;  3LDY A;  3N9M A;  1E4U A;  2LV9 A;  3LVR E;  2L0B A;  4PPE A;  1WEN A;  3RPG C;  2LGG A;  2QIC A;  3LJU X;  2EGP A;  2LAU A;  2YSM A;  3O36 A;  3N9Q A;  2CON A;  3FJU B;  4GNE A;  2L7P A;  2YSJ A;  4V3K C;  4YAX A;  5K3Q A;  1HYJ A;  4F52 B;  2VJE B;  2KWJ A;  4I7B A;  2K16 A;  2KKX A;  2CSV A;  4O64 A;  4B7Y C;  4XI1 A;  3L1Z B;  1XWH A;  2YYR A;  2D8U A;  5J3X A;  3NG2 A;  2LQ6 A;  3FM8 C;  2JMJ A;  3ZPV 1;  4FIP A;  4AVX A;  3KQI A;  4FO9 A;  4LLB A;  3PHD A;  4MSX A;  3SOW A;  2FFW A;  1VFY A;  2FUI A;  2I50 A;  4A4B A;  4QF2 A;  5B77 A;  4YBS A;  5B75 A;  1Z6U A;  2DSM A;  5D1M B;  3ZYQ A;  2CSZ A;  4I7C A;  4MVT A;  5TRB A;  3O35 A;  5LCW B;  2KWK A;  2PUY A;  5FB1 A;  4BHW A;  1ZBD B;  5H1V A;  1IYM A;  3PLW A;  2JRJ A;  1G25 A;  1LDJ B;  2JUN A;  2MKE A;  3O34 A;  3DQV R;  2ECV A;  4IC3 A;  5TDW A;  5G05 B;  2JMD A;  3HCS A;  3N9N A;  1X4U A;  5FEY A;  4YBT A;  3M63 A;  4WZ2 A;  4AYC A;  1Z2Q A;  5FER A;  2KFT A;  2Y1N A;  3M7K A;  2LXH C;  3LQJ A;  5D1L B;  1WFK A;  2OXQ C;  4FK5 A;  3IHP A;  3T9K A;  2KU3 A;  2L75 A;  2B0O E;  3HTK C;  2LGL A;  1FP0 A;  2CRR A;  2D8S A;  5SVX A;  1WEW A;  3GL6 A;  2VPB A;  4LAD B;  4A0C D;  3U5M A;  4A49 A;  4Q6F A;  4UP0 A;  2C2L A;  1X4I A;  2K1J A;  4I7D A;  3O47 A;  3N9L A;  3ZPV E;  3MHH A;  4CCG X;  2XEU A;  2XP0 A;  3U5P A;  3DWD A;  3SHB A;  1LDK C;  2LN0 A;  2KYU A;  2P57 A;  3V43 A;  3RTR B;  4WZ0 A;  2ECJ A;  2LGV A;  2MNY A;  5KH7 A;  2QJ0 A;  2CKL B;  4O62 A;  2YVR A;  2YU4 A;  2XOZ A;  5EYA F;  5TBN A;  2EGM A;  5I3L A;  3U5N A;  2CSY A;  3L1X A;  1FBV A;  2ECT A;  2E6S A;  2VJE A;  2C2V S;  4ZUX U;  2Y1M A;  1WEQ A;  4X3G A;  5KH9 A;  3U5O A;  3FEH A;  2IQJ A;  2G6Q A;  4H9D A;  2L80 A;  1WE9 A;  2UZG A;  2VPG A;  5TDR A;  4PTB A;  1CHC A;  4QF3 A;  4P5O B;  2ZET C;  2KRE A;  3PUQ A;  2BAY A;  4L7X A;  2KWN A;  3MDB C;  2ECW A;  5SVI B;  5G04 B;  2FSA A;  3O7A A;  2LGK A;  3KNV A;  3O37 A;  4Z0O A;  1U6G B;  3KV5 A;  2YQL A;  5LKT A;  5H1U A;  1Z60 A;  3SUB A;  5H9M A;  5B8D A;  3LRQ A;  5C13 A;  2YQM A;  1V87 A;  3DDT A;  3QZV A;  4ZDT A;  3N9O A;  3SOU A;  4YAB A;  4GND A;  4N4F A;  5C11 A;  2M85 A;  2LRI C;  3T6R A;  1T1H A;  2RSD A;  2VP7 A;  4R7E A;  2H0D A;  2KGG A;  2OWA A;  5D1K B;  3T7L A;  2VPD A;  3FAN A;  4YBM A;  3M99 A;  4AP4 A;  2HDP A;  4F1P A;  2L5U A;  1MBM A;  2L43 A;  2RR4 A;  2PNX A;  5LKX A;  5AIT A;  4YC9 A;  3SOX A;  2KE1 A;  3C5K A;  2KR4 A;  1WEV A;  1JM7 B;  2MD7 B;  3PUR A;  4GB0 A;  3C6W A;  2YW8 A;  2ECN A;  1WGM A;  3M62 A;  5B79 A;  5B76 A; 
#chains in the Genus database with same CATH homology
 4IC2 A;  4N3W A;  3HCT A;  2K4D A;  3FL2 A;  3MHS A;  2YT5 A;  1WIL A;  1RMD A;  1WEP A;  2CKL A;  4R8P K;  5G0F A;  4YAT A;  4AUQ B;  3LQI A;  4GNF A;  1N87 A;  5KH3 A;  3HCU A;  1X4J A;  2VJF B;  4V3L C;  2KIZ A;  2YHO A;  4LKA A;  2VNF A;  3ZNI A;  2M1R A;  2KWO A;  2YUC A;  1F62 A;  2F6N A;  4C9Z A;  1BOR A;  3LQH A;  2MA6 A;  3KV6 A;  3ASL A;  3N9P A;  1MM3 A;  3GV4 A;  2DX8 A;  1K2F A;  4FJC A;  4LJN A;  4UI9 B;  4W4U A;  3VK6 A;  2ECG A;  5DIN A;  2IDA A;  2LXP C;  2QIZ A;  4WZ3 B;  4WA6 A;  5B78 A;  4GNG A;  2F42 A;  1JOC A;  2XB1 A;  2YHN A;  2JMI A;  5LKU A;  4B86 C;  1WEU A;  1WEE A;  2CT2 A;  2RI7 A;  4UP5 A;  2MNZ A;  5TAB A;  3EB6 A;  2G43 A;  5AIU A;  2MT5 A;  1VYX A;  2NAA A;  2K17 A;  3I2D A;  2HYE D;  4R2Y A;  2KGI A;  3ZTG A;  2E6R A;  4TKP B;  4L58 A;  1JM7 A;  1DVP A;  2ECI A;  5FB0 A;  2M6M A;  2MA5 A;  2MIQ A;  2LDR A;  4CA1 A;  2F6J A;  3ZVZ B;  1HYI A;  1WES A;  2FUU A;  4S3O B;  2H0D B;  2EA6 A;  3DPL R;  2MD8 C;  4A4C A;  3O70 A;  1WEO A;  2AN6 A;  3EB5 A;  5JG6 A;  3L11 A;  4AYC B;  2MUM A;  1MM2 A;  1VD4 A;  1WIM A;  4S3O C;  5H1T A;  2VPE A;  5LKZ A;  4NN2 A;  2YUR A;  2M3H A;  2EOD A;  4LK9 A;  2Y43 A;  2G45 A;  2VJF A;  5DKA A;  4YAD A;  4BBQ A;  3ZVY A;  2YRE A;  1WEM A;  3RPG B;  4ZQL A;  3O33 A;  3N9M A;  1E4U A;  2LV9 A;  2L0B A;  4PPE A;  1WEN A;  3RPG C;  2LGG A;  2QIC A;  2EGP A;  2YSM A;  3O36 A;  3N9Q A;  4GNE A;  2YSJ A;  4V3K C;  4YAX A;  1HYJ A;  4F52 B;  2VJE B;  2KWJ A;  4I7B A;  2K16 A;  4O64 A;  4B7Y C;  4XI1 A;  3L1Z B;  1XWH A;  2YYR A;  5J3X A;  3NG2 A;  2LQ6 A;  2JMJ A;  3ZPV 1;  4FIP A;  4AVX A;  3KQI A;  4FO9 A;  4LLB A;  3PHD A;  4MSX A;  3SOW A;  1VFY A;  2FUI A;  2I50 A;  4A4B A;  4QF2 A;  5B77 A;  4YBS A;  5B75 A;  1Z6U A;  5D1M B;  3ZYQ A;  2CSZ A;  4I7C A;  4MVT A;  5TRB A;  3O35 A;  5LCW B;  2KWK A;  2PUY A;  5FB1 A;  4BHW A;  1ZBD B;  5H1V A;  1IYM A;  2JRJ A;  1G25 A;  1LDJ B;  3O34 A;  3DQV R;  2ECV A;  4IC3 A;  5TDW A;  5G05 B;  2JMD A;  3HCS A;  3N9N A;  1X4U A;  5FEY A;  4YBT A;  3M63 A;  4WZ2 A;  4AYC A;  1Z2Q A;  5FER A;  2KFT A;  2Y1N A;  2LXH C;  3LQJ A;  5D1L B;  1WFK A;  2OXQ C;  4FK5 A;  3IHP A;  2KU3 A;  2L75 A;  3HTK C;  2LGL A;  1FP0 A;  2D8S A;  1WEW A;  3GL6 A;  2VPB A;  4LAD B;  4A0C D;  3U5M A;  4A49 A;  4Q6F A;  4UP0 A;  2C2L A;  1X4I A;  2K1J A;  4I7D A;  4CCG X;  3N9L A;  3ZPV E;  3MHH A;  2XEU A;  3U5P A;  3SHB A;  1LDK C;  2LN0 A;  2KYU A;  3V43 A;  3RTR B;  4WZ0 A;  2ECJ A;  2LGV A;  2MNY A;  5KH7 A;  2QJ0 A;  2CKL B;  2YU4 A;  5EYA F;  5TBN A;  5I3L A;  3U5N A;  2CSY A;  3L1X A;  1FBV A;  2ECT A;  2E6S A;  2VJE A;  2C2V S;  4ZUX U;  2Y1M A;  1WEQ A;  4X3G A;  5KH9 A;  3U5O A;  2G6Q A;  2L80 A;  1WE9 A;  2UZG A;  2VPG A;  5TDR A;  4PTB A;  1CHC A;  4QF3 A;  4P5O B;  2ZET C;  2KRE A;  3PUQ A;  2BAY A;  4L7X A;  2KWN A;  2ECW A;  5G04 B;  2FSA A;  3O7A A;  2LGK A;  3KNV A;  3O37 A;  1U6G B;  3KV5 A;  2YQL A;  5LKT A;  5H1U A;  1Z60 A;  5H9M A;  5B8D A;  3LRQ A;  5C13 A;  2YQM A;  1V87 A;  3QZV A;  4ZDT A;  3N9O A;  3SOU A;  4YAB A;  4GND A;  4N4F A;  5C11 A;  2M85 A;  2LRI C;  3T6R A;  1T1H A;  2RSD A;  2VP7 A;  4R7E A;  2H0D A;  2KGG A;  5D1K B;  3T7L A;  2VPD A;  4YBM A;  3M99 A;  4AP4 A;  2HDP A;  2L5U A;  2L43 A;  2PNX A;  5LKX A;  5AIT A;  4YC9 A;  3SOX A;  2KE1 A;  3C5K A;  2KR4 A;  1WEV A;  1JM7 B;  2MD7 B;  3PUR A;  4GB0 A;  3C6W A;  2YW8 A;  2ECN A;  1WGM A;  3M62 A;  5B79 A;  5B76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...