4UP5A

Crystal structure of the pygo2 phd finger in complex with the b9l hd1 domain and a chemical fragment
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
85
Chain Sequence
GVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCVYVFTTHLANTAAEAVLQGRADSILAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Competitive Binding of a Benzimidazole to the Histone-Binding Pocket of the Pygo Phd Finger.
pubmed doi rcsb
molecule keywords PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN
molecule tags Transcription
source organism Homo sapiens
total genus 25
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2014-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 4up5A00
3SOXA 3ZVYA 3ZTGA 2LGKA 3QZVA 4L58A 2H0DA 3LQJA 2FUUA 5C11A 2LV9A 4FJCA 3O33A 1WEMA 2CT2A 5H1TA 4GNGA 3C6WA 5LKZA 1WEUA 5H1UA 3ZNIA 3PHDA 1T1HA 2HDPA 2Y1MA 4Q6FA 2L80A 1WEWA 2NAAA 2VNFA 4IC2A 2VPDA 4A49A 2L43A 5LKTA 4ZQLA 2YQMA 2ECGA 5EYAF 3LQIA 3RPGB 4A0CD 2YQLA 1LDKC 2QIZA 5D1LB 3DQVR 4YADA 4I7DA 4GB0A 3C5KA 2JMJA 2LGGA 4ZDTA 2IDAA 2L75A 5LCWB 2MA5A 2KE1A 2Y1NA 1LDJB 1Z6UA 2MD8C 2EODA 4YC9A 1JM7A 2MNZA 4FIPA 4QF3A 4AUQB 5C13A 2XEUA 1E4UA 5TRBA 3N9MA 4GNFA 2KREA 3SOWA 5AIUA 5FB0A 1JM7B 3N9QA 3L1ZB 4B7YC 1XWHA 3N9NA 3LQHA 1WEVA 5FEYA 4N4FA 3RPGC 3L1XA 3O37A 2YYRA 2D8SA 2YUCA 2AN6A 4BHWA 3KV5A 5LKXA 2G45A 3ASLA 2CSZA 1ZBDB 3U5OA 2JMDA 3M62A 5FERA 4WZ2A 2BAYA 4R2YA 1Z60A 4A4BA 5G04B 4ZUXU 1VFYA 5H9MA 1JOCA 3PURA 3HTKC 3V43A 2HYED 2YSMA 2ECJA 4R7EA 5B75A 2KYUA 4MVTA 2YREA 3N9LA 2XB1A 5DINA 2C2LA 2MIQA 5D1KB 4I7CA 2F6NA 2PUYA 2QICA 3ZYQA 4UP0A 4LADB 1IYMA 5KH9A 5LKUA 2LQ6A 2CSYA 3SOUA 1WE9A 2EGPA 4MSXA 4BBQA 3T6RA 2L0BA 2F42A 3LRQA 2VJFB 4PTBA 3O7AA 5TBNA 1WENA 1WFKA 5D1MB 2JRJA 2LGVA 5B8DA 3RTRB 2CKLA 2KFTA 3O36A 3MHHA 2YHOA 4V3LC 3VK6A 4IC3A 4AYCA 3EB6A 1Z2QA 4YBMA 3M63A 1X4UA 2LN0A 2KWOA 2JMIA 2UZGA 2CKLB 4CCGX 5B76A 3MHSA 1WGMA 4AVXA 2VP7A 1FP0A 4QF2A 4AYCB 5FB1A 1WIMA 2KGGA 4PPEA 5TABA 4WZ0A 4C9ZA 1X4IA 2LGLA 4YAXA 4YATA 4YABA 4FO9A 2ECNA 4A4CA 4WA6A 2M85A 2ECIA 2F6JA 4FK5A 3IHPA 1G25A 3N9OA 2LDRA 2DX8A 2YW8A 2RSDA 2YHNA 2YSJA 2YURA 3PUQA 4TKPB 2G43A 3O35A 2QJ0A 4P5OB 2ECVA 5B78A 3O70A 2MA6A 1VD4A 2LXHC 2FUIA 2I50A 4R8PK 2K4DA 4LJNA 4S3OB 3T7LA 2K1JA 2YT5A 2M6MA 4CA1A 4O64A 3L11A 1WEEA 2LRIC 2KWNA 2YU4A 2VJEA 2ECTA 2L5UA 5H1VA 5J3XA 3GL6A 2E6RA 2ECWA 3U5PA 3HCSA 2VJFA 1HYJA 1X4JA 2PNXA 1CHCA 4X3GA 4XI1A 2VJEB 2H0DB 3ZVZB 2KWKA 4B86C 3HCUA 5TDRA 3ZPV1 2G6QA 1BORA 2KR4A 3HCTA 2Y43A 2MT5A 4WZ3B 2RI7A 4LK9A 3DPLR 2K17A 3ZPVE 2VPBA 2KIZA 1U6GB 2ZETC 4S3OC 2OXQC 1HYIA 4I7BA 1MM2A 5I3LA 3U5MA 5TDWA 3FL2A 4UP5A 3O34A 3N9PA 4V3KC 4F52B 2KU3A 3SHBA 3GV4A 4GNDA 2FSAA 4YBSA 4LKAA 5JG6A 4AP4A 2VPGA 2KWJA 5DKAA 1DVPA 4LLBA 1FBVA 1WEQA 2MUMA 5G05B 1F62A 2LXPC 5B77A 5KH7A 3NG2A 1MM3A 2C2VS 2KGIA 4NN2A 3KNVA 2EA6A 1VYXA 4W4UA 4L7XA 1WEOA 2M3HA 1K2FA 1V87A 3KV6A 2VPEA 4UI9B 2MNYA 5B79A 4YBTA 2E6SA 1N87A 4N3WA 3I2DA 1RMDA 5KH3A 5AITA 3U5NA 1WILA 3EB5A 2K16A 2M1RA 3KQIA 1WESA 1WEPA 2MD7B 3M99A 5G0FA 4GNEA
chains in the Genus database with same CATH superfamily
2XP0A 3SOXA 3ZVYA 3ZTGA 2LGKA 3QZVA 2CONA 4L58A 2H0DA 3LQJA 2FUUA 5C11A 2LV9A 4FJCA 3O33A 1WEMA 2CT2A 5H1TA 2JUNA 4GNGA 3C6WA 5LKZA 2IQJA 1WEUA 5H1UA 3ZNIA 3PHDA 1T1HA 2HDPA 2Y1MA 4Q6FA 2L80A 1WEWA 2NAAA 2VNFA 3SUBA 4IC2A 2VPDA 4A49A 2L43A 5LKTA 4ZQLA 2FFWA 2XOCA 2YQMA 2ECGA 5EYAF 3LDYA 4QQ4A 3LQIA 3RPGB 4A0CD 2YQLA 1LDKC 2QIZA 5D1LB 3DQVR 4YADA 4I7DA 4GB0A 3C5KA 2B0OE 4Z0RA 4O62A 2JMJA 2LGGA 3FANA 4ZDTA 2IDAA 2L75A 5LCWB 2MA5A 2KE1A 2Y1NA 1LDJB 1Z6UA 2MD8C 2EODA 4YC9A 1JM7A 2MNZA 4FIPA 4QF3A 4AUQB 5C13A 3PLWA 2XEUA 1E4UA 5TRBA 3N9MA 4GNFA 2KREA 3SOWA 5AIUA 2DSMA 4Z0OA 5FB0A 1JM7B 3N9QA 3E2DA 3L1ZB 4B7YC 1XWHA 3N9NA 3LQHA 1WEVA 5FEYA 4N4FA 3RPGC 3FEHA 2CRWA 3L1XA 3O37A 2YYRA 2D8SA 2YUCA 2AN6A 4BHWA 3KV5A 5LKXA 2G45A 3ASLA 2CSZA 1ZBDB 3U5OA 2JMDA 2LAUA 3M62A 2KKXA 5FERA 4WZ2A 2BAYA 4R2YA 1Z60A 4A4BA 5G04B 4ZUXU 1VFYA 5H9MA 1JOCA 3PURA 3HTKC 3V43A 2HYED 2YSMA 2ECJA 4R7EA 5B75A 2KYUA 4MVTA 5K3QA 2YREA 3N9LA 2XB1A 5DINA 2C2LA 2MIQA 5D1KB 4I7CA 2F6NA 2PUYA 2QICA 3ZYQA 4UP0A 4LADB 1IYMA 5KH9A 5LKUA 2LQ6A 2XOZA 3FJUB 2CSYA 3SOUA 1WE9A 2FD4A 2EGPA 2JM3A 4MSXA 4BBQA 3T6RA 2L0BA 2F42A 3LRQA 2VJFB 4PTBA 2OWAA 3O7AA 5TBNA 1WENA 1WFKA 3DDTA 5D1MB 2JRJA 2LGVA 5B8DA 3RTRB 2CKLA 2KFTA 3O36A 4F1PA 3MHHA 2YHOA 4V3LC 3VK6A 4IC3A 4AYCA 3EB6A 1Z2QA 2DJAA 4YBMA 3M63A 1X4UA 2LN0A 2KWOA 2CRRA 2JMIA 2UZGA 2CKLB 4CCGX 5B76A 3MHSA 1WGMA 3LVQE 4AVXA 2VP7A 1FP0A 4QF2A 3FAOA 5FB1A 4AYCB 3KDEC 1WIMA 2KGGA 4PPEA 5TABA 1MBMA 3T9KA 4WZ0A 4C9ZA 2E61A 1X4IA 2LGLA 4YAXA 4YATA 4YABA 4FO9A 2M13A 2ECNA 4A4CA 4WA6A 5SVIA 2M85A 2ECIA 2F6JA 4FK5A 3IHPA 1G25A 3N9OA 2LDRA 3DWDA 2DX8A 2YW8A 4OGEA 2RSDA 2YHNA 2YSJA 2YURA 3PUQA 4TKPB 2G43A 5SVIB 2RR4A 3O35A 2QJ0A 4P5OB 2ECVA 5B78A 3O70A 2MA6A 1VD4A 2LXHC 2FUIA 2CSVA 2I50A 2K4DA 4R8PK 4LJNA 4S3OB 3M7KA 3MDBC 2K1JA 3T7LA 2YT5A 2M6MA 4CA1A 4O64A 3L11A 3H7HA 2EGMA 1WEEA 2LRIC 2KWNA 2YU4A 2VJEA 2ECTA 2L5UA 5H1VA 5J3XA 3GL6A 2E6RA 1DCQA 2ECWA 3U5PA 3HCSA 2VJFA 1HYJA 3Q1DA 1X4JA 2PNXA 1CHCA 4X3GA 4XI1A 2VJEB 2H0DB 3ZVZB 2KWKA 4B86C 3HCUA 5TDRA 3ZPV1 2G6QA 1BORA 2KR4A 3HCTA 2L7PA 2Y43A 2MKEA 2MT5A 4WZ3B 2RI7A 4LK9A 3DPLR 2K17A 3ZPVE 2VPBA 2KIZA 1U6GB 2ZETC 4S3OC 2OXQC 1HYIA 4I7BA 1MM2A 5I3LA 3U5MA 5TDWA 2YVRA 3FL2A 4UP5A 3O34A 2P57A 3N9PA 4H9DA 4V3KC 4F52B 2KU3A 3SHBA 3GV4A 4GNDA 2FSAA 4YBSA 4LKAA 5JG6A 4AP4A 2VPGA 2KWJA 5DKAA 1DVPA 4LLBA 5SVYA 1FBVA 1WEQA 2MUMA 5G05B 1F62A 2LXPC 5B77A 5KH7A 3LJUX 3NG2A 3O47A 1MM3A 2C2VS 2KGIA 4NN2A 2D8UA 2EXUA 3KNVA 2EA6A 1VYXA 4OGCA 4W4UA 5SVXA 4L7XA 1WEOA 2M3HA 1K2FA 1V87A 3KV6A 2VPEA 4UI9B 3LVRE 3FM8C 2MNYA 3JUEA 5B79A 4YBTA 2E6SA 1N87A 4N3WA 3I2DA 1RMDA 5KH3A 5AITA 3U5NA 1WILA 3EB5A 2K16A 2XOYA 2M1RA 3KQIA 1WESA 1WEPA 2MD7B 3M99A 5G0FA 2KKYA 4GNEA
chains in the Genus database with same CATH topology
3SOXA 3ZVYA 3ZTGA 2LGKA 3QZVA 4L58A 2H0DA 3LQJA 2FUUA 5C11A 2LV9A 4FJCA 3O33A 1WEMA 2CT2A 5H1TA 4GNGA 3C6WA 5LKZA 1WEUA 5H1UA 3ZNIA 3PHDA 1T1HA 2HDPA 2Y1MA 4Q6FA 2L80A 1WEWA 2NAAA 2VNFA 4IC2A 2VPDA 4A49A 2L43A 5LKTA 4ZQLA 2YQMA 2ECGA 5EYAF 3LQIA 3RPGB 4A0CD 2YQLA 1LDKC 2QIZA 5D1LB 3DQVR 4YADA 4I7DA 4GB0A 3C5KA 2JMJA 2LGGA 4ZDTA 2IDAA 2L75A 5LCWB 2MA5A 2KE1A 2Y1NA 1LDJB 1Z6UA 2MD8C 2EODA 4YC9A 1JM7A 2MNZA 4FIPA 4QF3A 4AUQB 5C13A 2XEUA 1E4UA 5TRBA 3N9MA 4GNFA 2KREA 3SOWA 5AIUA 5FB0A 1JM7B 3N9QA 3L1ZB 4B7YC 1XWHA 3N9NA 3LQHA 1WEVA 5FEYA 4N4FA 3RPGC 3L1XA 3O37A 2YYRA 2D8SA 2YUCA 2AN6A 4BHWA 3KV5A 5LKXA 2G45A 3ASLA 2CSZA 1ZBDB 3U5OA 2JMDA 3M62A 5FERA 4WZ2A 2BAYA 4R2YA 1Z60A 4A4BA 5G04B 4ZUXU 1VFYA 5H9MA 1JOCA 3PURA 3HTKC 3V43A 2HYED 2YSMA 2ECJA 4R7EA 5B75A 2KYUA 4MVTA 2YREA 3N9LA 2XB1A 5DINA 2C2LA 2MIQA 5D1KB 4I7CA 2F6NA 2PUYA 2QICA 3ZYQA 4UP0A 4LADB 1IYMA 5KH9A 5LKUA 2LQ6A 2CSYA 3SOUA 1WE9A 2EGPA 4MSXA 4BBQA 3T6RA 2L0BA 2F42A 3LRQA 2VJFB 4PTBA 3O7AA 5TBNA 1WENA 1WFKA 5D1MB 2JRJA 2LGVA 5B8DA 3RTRB 2CKLA 2KFTA 3O36A 3MHHA 2YHOA 4V3LC 3VK6A 4IC3A 4AYCA 3EB6A 1Z2QA 4YBMA 3M63A 1X4UA 2LN0A 2KWOA 2JMIA 2UZGA 2CKLB 4CCGX 5B76A 3MHSA 1WGMA 4AVXA 2VP7A 1FP0A 4QF2A 4AYCB 5FB1A 1WIMA 2KGGA 4PPEA 5TABA 4WZ0A 4C9ZA 1X4IA 2LGLA 4YAXA 4YATA 4YABA 4FO9A 2ECNA 4A4CA 4WA6A 2M85A 2ECIA 2F6JA 4FK5A 3IHPA 1G25A 3N9OA 2LDRA 2DX8A 2YW8A 2RSDA 2YHNA 2YSJA 2YURA 3PUQA 4TKPB 2G43A 3O35A 2QJ0A 4P5OB 2ECVA 5B78A 3O70A 2MA6A 1VD4A 2LXHC 2FUIA 2I50A 4R8PK 2K4DA 4LJNA 4S3OB 3T7LA 2K1JA 2YT5A 2M6MA 4CA1A 4O64A 3L11A 1WEEA 2LRIC 2KWNA 2YU4A 2VJEA 2ECTA 2L5UA 5H1VA 5J3XA 3GL6A 2E6RA 2ECWA 3U5PA 3HCSA 2VJFA 1HYJA 1X4JA 2PNXA 1CHCA 4X3GA 4XI1A 2VJEB 2H0DB 3ZVZB 2KWKA 4B86C 3HCUA 5TDRA 3ZPV1 2G6QA 1BORA 2KR4A 3HCTA 2Y43A 2MT5A 4WZ3B 2RI7A 4LK9A 3DPLR 2K17A 3ZPVE 2VPBA 2KIZA 1U6GB 2ZETC 4S3OC 2OXQC 1HYIA 4I7BA 1MM2A 5I3LA 3U5MA 5TDWA 3FL2A 4UP5A 3O34A 3N9PA 4V3KC 4F52B 2KU3A 3SHBA 3GV4A 4GNDA 2FSAA 4YBSA 4LKAA 5JG6A 4AP4A 2VPGA 2KWJA 5DKAA 1DVPA 4LLBA 1FBVA 1WEQA 2MUMA 5G05B 1F62A 2LXPC 5B77A 5KH7A 3NG2A 1MM3A 2C2VS 2KGIA 4NN2A 3KNVA 2EA6A 1VYXA 4W4UA 4L7XA 1WEOA 2M3HA 1K2FA 1V87A 3KV6A 2VPEA 4UI9B 2MNYA 5B79A 4YBTA 2E6SA 1N87A 4N3WA 3I2DA 1RMDA 5KH3A 5AITA 3U5NA 1WILA 3EB5A 2K16A 2M1RA 3KQIA 1WESA 1WEPA 2MD7B 3M99A 5G0FA 4GNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SOX A;  3ZVY A;  3ZTG A;  2LGK A;  3QZV A;  4L58 A;  2H0D A;  3LQJ A;  2FUU A;  5C11 A;  2LV9 A;  4FJC A;  3O33 A;  1WEM A;  2CT2 A;  5H1T A;  4GNG A;  3C6W A;  5LKZ A;  1WEU A;  5H1U A;  3ZNI A;  3PHD A;  1T1H A;  2HDP A;  2Y1M A;  4Q6F A;  2L80 A;  1WEW A;  2NAA A;  2VNF A;  4IC2 A;  2VPD A;  4A49 A;  2L43 A;  5LKT A;  4ZQL A;  2YQM A;  2ECG A;  5EYA F;  3LQI A;  3RPG B;  4A0C D;  2YQL A;  1LDK C;  2QIZ A;  5D1L B;  3DQV R;  4YAD A;  4I7D A;  4GB0 A;  3C5K A;  2JMJ A;  2LGG A;  4ZDT A;  2IDA A;  2L75 A;  5LCW B;  2MA5 A;  2KE1 A;  2Y1N A;  1LDJ B;  1Z6U A;  2MD8 C;  2EOD A;  4YC9 A;  1JM7 A;  2MNZ A;  4FIP A;  4QF3 A;  4AUQ B;  5C13 A;  2XEU A;  1E4U A;  5TRB A;  3N9M A;  4GNF A;  2KRE A;  3SOW A;  5AIU A;  5FB0 A;  1JM7 B;  3N9Q A;  3L1Z B;  4B7Y C;  1XWH A;  3N9N A;  3LQH A;  1WEV A;  5FEY A;  4N4F A;  3RPG C;  3L1X A;  3O37 A;  2YYR A;  2D8S A;  2YUC A;  2AN6 A;  4BHW A;  3KV5 A;  5LKX A;  2G45 A;  3ASL A;  2CSZ A;  1ZBD B;  3U5O A;  2JMD A;  3M62 A;  5FER A;  4WZ2 A;  2BAY A;  4R2Y A;  1Z60 A;  4A4B A;  5G04 B;  4ZUX U;  1VFY A;  5H9M A;  1JOC A;  3PUR A;  3HTK C;  3V43 A;  2HYE D;  2YSM A;  2ECJ A;  4R7E A;  5B75 A;  2KYU A;  4MVT A;  2YRE A;  3N9L A;  2XB1 A;  5DIN A;  2C2L A;  2MIQ A;  5D1K B;  4I7C A;  2F6N A;  2PUY A;  2QIC A;  3ZYQ A;  4UP0 A;  4LAD B;  1IYM A;  5KH9 A;  5LKU A;  2LQ6 A;  2CSY A;  3SOU A;  1WE9 A;  2EGP A;  4MSX A;  4BBQ A;  3T6R A;  2L0B A;  2F42 A;  3LRQ A;  2VJF B;  4PTB A;  3O7A A;  5TBN A;  1WEN A;  1WFK A;  5D1M B;  2JRJ A;  2LGV A;  5B8D A;  3RTR B;  2CKL A;  2KFT A;  3O36 A;  3MHH A;  2YHO A;  4V3L C;  3VK6 A;  4IC3 A;  4AYC A;  3EB6 A;  1Z2Q A;  4YBM A;  3M63 A;  1X4U A;  2LN0 A;  2KWO A;  2JMI A;  2UZG A;  2CKL B;  4CCG X;  5B76 A;  3MHS A;  1WGM A;  4AVX A;  2VP7 A;  1FP0 A;  4QF2 A;  4AYC B;  5FB1 A;  1WIM A;  2KGG A;  4PPE A;  5TAB A;  4WZ0 A;  4C9Z A;  1X4I A;  2LGL A;  4YAX A;  4YAT A;  4YAB A;  4FO9 A;  2ECN A;  4A4C A;  4WA6 A;  2M85 A;  2ECI A;  2F6J A;  4FK5 A;  3IHP A;  1G25 A;  3N9O A;  2LDR A;  2DX8 A;  2YW8 A;  2RSD A;  2YHN A;  2YSJ A;  2YUR A;  3PUQ A;  4TKP B;  2G43 A;  3O35 A;  2QJ0 A;  4P5O B;  2ECV A;  5B78 A;  3O70 A;  2MA6 A;  1VD4 A;  2LXH C;  2FUI A;  2I50 A;  4R8P K;  2K4D A;  4LJN A;  4S3O B;  3T7L A;  2K1J A;  2YT5 A;  2M6M A;  4CA1 A;  4O64 A;  3L11 A;  1WEE A;  2LRI C;  2KWN A;  2YU4 A;  2VJE A;  2ECT A;  2L5U A;  5H1V A;  5J3X A;  3GL6 A;  2E6R A;  2ECW A;  3U5P A;  3HCS A;  2VJF A;  1HYJ A;  1X4J A;  2PNX A;  1CHC A;  4X3G A;  4XI1 A;  2VJE B;  2H0D B;  3ZVZ B;  2KWK A;  4B86 C;  3HCU A;  5TDR A;  3ZPV 1;  2G6Q A;  1BOR A;  2KR4 A;  3HCT A;  2Y43 A;  2MT5 A;  4WZ3 B;  2RI7 A;  4LK9 A;  3DPL R;  2K17 A;  3ZPV E;  2VPB A;  2KIZ A;  1U6G B;  2ZET C;  4S3O C;  2OXQ C;  1HYI A;  4I7B A;  1MM2 A;  5I3L A;  3U5M A;  5TDW A;  3FL2 A;  4UP5 A;  3O34 A;  3N9P A;  4V3K C;  4F52 B;  2KU3 A;  3SHB A;  3GV4 A;  4GND A;  2FSA A;  4YBS A;  4LKA A;  5JG6 A;  4AP4 A;  2VPG A;  2KWJ A;  5DKA A;  1DVP A;  4LLB A;  1FBV A;  1WEQ A;  2MUM A;  5G05 B;  1F62 A;  2LXP C;  5B77 A;  5KH7 A;  3NG2 A;  1MM3 A;  2C2V S;  2KGI A;  4NN2 A;  3KNV A;  2EA6 A;  1VYX A;  4W4U A;  4L7X A;  1WEO A;  2M3H A;  1K2F A;  1V87 A;  3KV6 A;  2VPE A;  4UI9 B;  2MNY A;  5B79 A;  4YBT A;  2E6S A;  1N87 A;  4N3W A;  3I2D A;  1RMD A;  5KH3 A;  5AIT A;  3U5N A;  1WIL A;  3EB5 A;  2K16 A;  2M1R A;  3KQI A;  1WES A;  1WEP A;  2MD7 B;  3M99 A;  5G0F A;  4GNE A; 
#chains in the Genus database with same CATH topology
 2XP0 A;  3SOX A;  3ZVY A;  3ZTG A;  2LGK A;  3QZV A;  2CON A;  4L58 A;  2H0D A;  3LQJ A;  2FUU A;  5C11 A;  2LV9 A;  4FJC A;  3O33 A;  1WEM A;  2CT2 A;  5H1T A;  2JUN A;  4GNG A;  3C6W A;  5LKZ A;  2IQJ A;  1WEU A;  5H1U A;  3ZNI A;  3PHD A;  1T1H A;  2HDP A;  2Y1M A;  4Q6F A;  2L80 A;  1WEW A;  2NAA A;  2VNF A;  3SUB A;  4IC2 A;  2VPD A;  4A49 A;  2L43 A;  5LKT A;  4ZQL A;  2FFW A;  2XOC A;  2YQM A;  2ECG A;  5EYA F;  3LDY A;  4QQ4 A;  3LQI A;  3RPG B;  4A0C D;  2YQL A;  1LDK C;  2QIZ A;  5D1L B;  3DQV R;  4YAD A;  4I7D A;  4GB0 A;  3C5K A;  2B0O E;  4Z0R A;  4O62 A;  2JMJ A;  2LGG A;  3FAN A;  4ZDT A;  2IDA A;  2L75 A;  5LCW B;  2MA5 A;  2KE1 A;  2Y1N A;  1LDJ B;  1Z6U A;  2MD8 C;  2EOD A;  4YC9 A;  1JM7 A;  2MNZ A;  4FIP A;  4QF3 A;  4AUQ B;  5C13 A;  3PLW A;  2XEU A;  1E4U A;  5TRB A;  3N9M A;  4GNF A;  2KRE A;  3SOW A;  5AIU A;  2DSM A;  4Z0O A;  5FB0 A;  1JM7 B;  3N9Q A;  3E2D A;  3L1Z B;  4B7Y C;  1XWH A;  3N9N A;  3LQH A;  1WEV A;  5FEY A;  4N4F A;  3RPG C;  3FEH A;  2CRW A;  3L1X A;  3O37 A;  2YYR A;  2D8S A;  2YUC A;  2AN6 A;  4BHW A;  3KV5 A;  5LKX A;  2G45 A;  3ASL A;  2CSZ A;  1ZBD B;  3U5O A;  2JMD A;  2LAU A;  3M62 A;  2KKX A;  5FER A;  4WZ2 A;  2BAY A;  4R2Y A;  1Z60 A;  4A4B A;  5G04 B;  4ZUX U;  1VFY A;  5H9M A;  1JOC A;  3PUR A;  3HTK C;  3V43 A;  2HYE D;  2YSM A;  2ECJ A;  4R7E A;  5B75 A;  2KYU A;  4MVT A;  5K3Q A;  2YRE A;  3N9L A;  2XB1 A;  5DIN A;  2C2L A;  2MIQ A;  5D1K B;  4I7C A;  2F6N A;  2PUY A;  2QIC A;  3ZYQ A;  4UP0 A;  4LAD B;  1IYM A;  5KH9 A;  5LKU A;  2LQ6 A;  2XOZ A;  3FJU B;  2CSY A;  3SOU A;  1WE9 A;  2FD4 A;  2EGP A;  2JM3 A;  4MSX A;  4BBQ A;  3T6R A;  2L0B A;  2F42 A;  3LRQ A;  2VJF B;  4PTB A;  2OWA A;  3O7A A;  5TBN A;  1WEN A;  1WFK A;  3DDT A;  5D1M B;  2JRJ A;  2LGV A;  5B8D A;  3RTR B;  2CKL A;  2KFT A;  3O36 A;  4F1P A;  3MHH A;  2YHO A;  4V3L C;  3VK6 A;  4IC3 A;  4AYC A;  3EB6 A;  1Z2Q A;  2DJA A;  4YBM A;  3M63 A;  1X4U A;  2LN0 A;  2KWO A;  2CRR A;  2JMI A;  2UZG A;  2CKL B;  4CCG X;  5B76 A;  3MHS A;  1WGM A;  3LVQ E;  4AVX A;  2VP7 A;  1FP0 A;  4QF2 A;  3FAO A;  5FB1 A;  4AYC B;  3KDE C;  1WIM A;  2KGG A;  4PPE A;  5TAB A;  1MBM A;  3T9K A;  4WZ0 A;  4C9Z A;  2E61 A;  1X4I A;  2LGL A;  4YAX A;  4YAT A;  4YAB A;  4FO9 A;  2M13 A;  2ECN A;  4A4C A;  4WA6 A;  5SVI A;  2M85 A;  2ECI A;  2F6J A;  4FK5 A;  3IHP A;  1G25 A;  3N9O A;  2LDR A;  3DWD A;  2DX8 A;  2YW8 A;  4OGE A;  2RSD A;  2YHN A;  2YSJ A;  2YUR A;  3PUQ A;  4TKP B;  2G43 A;  5SVI B;  2RR4 A;  3O35 A;  2QJ0 A;  4P5O B;  2ECV A;  5B78 A;  3O70 A;  2MA6 A;  1VD4 A;  2LXH C;  2FUI A;  2CSV A;  2I50 A;  2K4D A;  4R8P K;  4LJN A;  4S3O B;  3M7K A;  3MDB C;  2K1J A;  3T7L A;  2YT5 A;  2M6M A;  4CA1 A;  4O64 A;  3L11 A;  3H7H A;  2EGM A;  1WEE A;  2LRI C;  2KWN A;  2YU4 A;  2VJE A;  2ECT A;  2L5U A;  5H1V A;  5J3X A;  3GL6 A;  2E6R A;  1DCQ A;  2ECW A;  3U5P A;  3HCS A;  2VJF A;  1HYJ A;  3Q1D A;  1X4J A;  2PNX A;  1CHC A;  4X3G A;  4XI1 A;  2VJE B;  2H0D B;  3ZVZ B;  2KWK A;  4B86 C;  3HCU A;  5TDR A;  3ZPV 1;  2G6Q A;  1BOR A;  2KR4 A;  3HCT A;  2L7P A;  2Y43 A;  2MKE A;  2MT5 A;  4WZ3 B;  2RI7 A;  4LK9 A;  3DPL R;  2K17 A;  3ZPV E;  2VPB A;  2KIZ A;  1U6G B;  2ZET C;  4S3O C;  2OXQ C;  1HYI A;  4I7B A;  1MM2 A;  5I3L A;  3U5M A;  5TDW A;  2YVR A;  3FL2 A;  4UP5 A;  3O34 A;  2P57 A;  3N9P A;  4H9D A;  4V3K C;  4F52 B;  2KU3 A;  3SHB A;  3GV4 A;  4GND A;  2FSA A;  4YBS A;  4LKA A;  5JG6 A;  4AP4 A;  2VPG A;  2KWJ A;  5DKA A;  1DVP A;  4LLB A;  5SVY A;  1FBV A;  1WEQ A;  2MUM A;  5G05 B;  1F62 A;  2LXP C;  5B77 A;  5KH7 A;  3LJU X;  3NG2 A;  3O47 A;  1MM3 A;  2C2V S;  2KGI A;  4NN2 A;  2D8U A;  2EXU A;  3KNV A;  2EA6 A;  1VYX A;  4OGC A;  4W4U A;  5SVX A;  4L7X A;  1WEO A;  2M3H A;  1K2F A;  1V87 A;  3KV6 A;  2VPE A;  4UI9 B;  3LVR E;  3FM8 C;  2MNY A;  3JUE A;  5B79 A;  4YBT A;  2E6S A;  1N87 A;  4N3W A;  3I2D A;  1RMD A;  5KH3 A;  5AIT A;  3U5N A;  1WIL A;  3EB5 A;  2K16 A;  2XOY A;  2M1R A;  3KQI A;  1WES A;  1WEP A;  2MD7 B;  3M99 A;  5G0F A;  2KKY A;  4GNE A; 
#chains in the Genus database with same CATH homology
 3SOX A;  3ZVY A;  3ZTG A;  2LGK A;  3QZV A;  4L58 A;  2H0D A;  3LQJ A;  2FUU A;  5C11 A;  2LV9 A;  4FJC A;  3O33 A;  1WEM A;  2CT2 A;  5H1T A;  4GNG A;  3C6W A;  5LKZ A;  1WEU A;  5H1U A;  3ZNI A;  3PHD A;  1T1H A;  2HDP A;  2Y1M A;  4Q6F A;  2L80 A;  1WEW A;  2NAA A;  2VNF A;  4IC2 A;  2VPD A;  4A49 A;  2L43 A;  5LKT A;  4ZQL A;  2YQM A;  2ECG A;  5EYA F;  3LQI A;  3RPG B;  4A0C D;  2YQL A;  1LDK C;  2QIZ A;  5D1L B;  3DQV R;  4YAD A;  4I7D A;  4GB0 A;  3C5K A;  2JMJ A;  2LGG A;  4ZDT A;  2IDA A;  2L75 A;  5LCW B;  2MA5 A;  2KE1 A;  2Y1N A;  1LDJ B;  1Z6U A;  2MD8 C;  2EOD A;  4YC9 A;  1JM7 A;  2MNZ A;  4FIP A;  4QF3 A;  4AUQ B;  5C13 A;  2XEU A;  1E4U A;  5TRB A;  3N9M A;  4GNF A;  2KRE A;  3SOW A;  5AIU A;  5FB0 A;  1JM7 B;  3N9Q A;  3L1Z B;  4B7Y C;  1XWH A;  3N9N A;  3LQH A;  1WEV A;  5FEY A;  4N4F A;  3RPG C;  3L1X A;  3O37 A;  2YYR A;  2D8S A;  2YUC A;  2AN6 A;  4BHW A;  3KV5 A;  5LKX A;  2G45 A;  3ASL A;  2CSZ A;  1ZBD B;  3U5O A;  2JMD A;  3M62 A;  5FER A;  4WZ2 A;  2BAY A;  4R2Y A;  1Z60 A;  4A4B A;  5G04 B;  4ZUX U;  1VFY A;  5H9M A;  1JOC A;  3PUR A;  3HTK C;  3V43 A;  2HYE D;  2YSM A;  2ECJ A;  4R7E A;  5B75 A;  2KYU A;  4MVT A;  2YRE A;  3N9L A;  2XB1 A;  5DIN A;  2C2L A;  2MIQ A;  5D1K B;  4I7C A;  2F6N A;  2PUY A;  2QIC A;  3ZYQ A;  4UP0 A;  4LAD B;  1IYM A;  5KH9 A;  5LKU A;  2LQ6 A;  2CSY A;  3SOU A;  1WE9 A;  2EGP A;  4MSX A;  4BBQ A;  3T6R A;  2L0B A;  2F42 A;  3LRQ A;  2VJF B;  4PTB A;  3O7A A;  5TBN A;  1WEN A;  1WFK A;  5D1M B;  2JRJ A;  2LGV A;  5B8D A;  3RTR B;  2CKL A;  2KFT A;  3O36 A;  3MHH A;  2YHO A;  4V3L C;  3VK6 A;  4IC3 A;  4AYC A;  3EB6 A;  1Z2Q A;  4YBM A;  3M63 A;  1X4U A;  2LN0 A;  2KWO A;  2JMI A;  2UZG A;  2CKL B;  4CCG X;  5B76 A;  3MHS A;  1WGM A;  4AVX A;  2VP7 A;  1FP0 A;  4QF2 A;  4AYC B;  5FB1 A;  1WIM A;  2KGG A;  4PPE A;  5TAB A;  4WZ0 A;  4C9Z A;  1X4I A;  2LGL A;  4YAX A;  4YAT A;  4YAB A;  4FO9 A;  2ECN A;  4A4C A;  4WA6 A;  2M85 A;  2ECI A;  2F6J A;  4FK5 A;  3IHP A;  1G25 A;  3N9O A;  2LDR A;  2DX8 A;  2YW8 A;  2RSD A;  2YHN A;  2YSJ A;  2YUR A;  3PUQ A;  4TKP B;  2G43 A;  3O35 A;  2QJ0 A;  4P5O B;  2ECV A;  5B78 A;  3O70 A;  2MA6 A;  1VD4 A;  2LXH C;  2FUI A;  2I50 A;  4R8P K;  2K4D A;  4LJN A;  4S3O B;  3T7L A;  2K1J A;  2YT5 A;  2M6M A;  4CA1 A;  4O64 A;  3L11 A;  1WEE A;  2LRI C;  2KWN A;  2YU4 A;  2VJE A;  2ECT A;  2L5U A;  5H1V A;  5J3X A;  3GL6 A;  2E6R A;  2ECW A;  3U5P A;  3HCS A;  2VJF A;  1HYJ A;  1X4J A;  2PNX A;  1CHC A;  4X3G A;  4XI1 A;  2VJE B;  2H0D B;  3ZVZ B;  2KWK A;  4B86 C;  3HCU A;  5TDR A;  3ZPV 1;  2G6Q A;  1BOR A;  2KR4 A;  3HCT A;  2Y43 A;  2MT5 A;  4WZ3 B;  2RI7 A;  4LK9 A;  3DPL R;  2K17 A;  3ZPV E;  2VPB A;  2KIZ A;  1U6G B;  2ZET C;  4S3O C;  2OXQ C;  1HYI A;  4I7B A;  1MM2 A;  5I3L A;  3U5M A;  5TDW A;  3FL2 A;  4UP5 A;  3O34 A;  3N9P A;  4V3K C;  4F52 B;  2KU3 A;  3SHB A;  3GV4 A;  4GND A;  2FSA A;  4YBS A;  4LKA A;  5JG6 A;  4AP4 A;  2VPG A;  2KWJ A;  5DKA A;  1DVP A;  4LLB A;  1FBV A;  1WEQ A;  2MUM A;  5G05 B;  1F62 A;  2LXP C;  5B77 A;  5KH7 A;  3NG2 A;  1MM3 A;  2C2V S;  2KGI A;  4NN2 A;  3KNV A;  2EA6 A;  1VYX A;  4W4U A;  4L7X A;  1WEO A;  2M3H A;  1K2F A;  1V87 A;  3KV6 A;  2VPE A;  4UI9 B;  2MNY A;  5B79 A;  4YBT A;  2E6S A;  1N87 A;  4N3W A;  3I2D A;  1RMD A;  5KH3 A;  5AIT A;  3U5N A;  1WIL A;  3EB5 A;  2K16 A;  2M1R A;  3KQI A;  1WES A;  1WEP A;  2MD7 B;  3M99 A;  5G0F A;  4GNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...