5B77A

Crystal structrue of moz double phd finger in complex with histone h3 propionylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
116
structure length
116
Chain Sequence
EKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
molecule keywords Histone acetyltransferase KAT6A
molecule tags Transferase
source organism Homo sapiens
total genus 26
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b77A00
4UP5A 4YADA 1RMDA 4UP0A 4PTBA 4FJCA 4LLBA 5TDWA 2Y1MA 1WFKA 3MHHA 4FK5A 4C9ZA 2LRIC 1U6GB 1T1HA 5LKXA 5EYAF 1HYJA 1X4UA 2QICA 1WE9A 2KE1A 3QZVA 4WZ2A 4CA1A 4I7CA 4R8PK 1HYIA 2LDRA 2CSZA 1LDJB 1WEWA 2PNXA 2VJFA 3HCTA 3EB6A 1VD4A 1LDKC 3T6RA 5G05B 2LXPC 2OXQC 1FBVA 3U5PA 2DX8A 5KH3A 4LADB 1WIMA 5C11A 2VPGA 5FB0A 2KGGA 1MM2A 2EODA 1Z60A 2MD8C 5AIUA 3SHBA 3N9QA 3L1XA 3L1ZB 3GL6A 4L7XA 2ECWA 2KIZA 2FUIA 2VPEA 2KR4A 3LQHA 4ZUXU 1X4IA 4LJNA 2G45A 1IYMA 2YW8A 4FIPA 2HYED 2YURA 1WEEA 4NN2A 2LGVA 2H0DB 2D8SA 3V43A 3VK6A 2NAAA 3L11A 5C13A 3O70A 4GNDA 2F6JA 2QIZA 5B77A 1WEQA 4IC3A 3O34A 3DQVR 1WILA 3ZVZB 4YAXA 4AUQB 3M99A 3SOXA 1X4JA 2M85A 2K4DA 2C2VS 3U5OA 2VPBA 3M63A 3PUQA 3N9OA 4WZ0A 2VPDA 2VJFB 4YABA 2YHOA 1WGMA 4I7BA 3PURA 4YATA 3U5NA 3O37A 4MVTA 2VJEA 5H1VA 2L5UA 5TBNA 2AN6A 3ZPVE 4A49A 4P5OB 2K1JA 5LKUA 1MM3A 4ZQLA 4XI1A 4A4BA 1F62A 3KV5A 5DKAA 2PUYA 2YUCA 2L80A 1Z6UA 4V3LC 2VNFA 1VYXA 4AP4A 2CKLA 2L43A 3U5MA 2MNZA 2LGKA 5KH7A 2EGPA 3N9LA 4GB0A 3N9PA 3NG2A 2ECJA 5J3XA 4S3OC 2Y43A 2KWNA 1JM7A 2LXHC 2G6QA 2MA5A 2YT5A 3RPGB 4AYCA 2Y1NA 2KREA 2XEUA 1WESA 2EA6A 4WA6A 4MSXA 3ZTGA 2KWJA 5FB1A 3HCSA 2FUUA 5TABA 4A4CA 1G25A 1VFYA 2BAYA 5D1LB 2YHNA 1FP0A 1V87A 4AVXA 2CSYA 2MNYA 2LGGA 2JRJA 2YQLA 2G43A 1Z2QA 1WEUA 2F6NA 2VJEB 4PPEA 3FL2A 4W4UA 2F42A 4IC2A 2MIQA 3ZPV1 1DVPA 5FERA 2RSDA 2ECNA 2M3HA 3KNVA 3MHSA 3PHDA 2XB1A 5LCWB 5LKTA 3O36A 1E4UA 3ASLA 2ECIA 4GNFA 2ECGA 4Q6FA 2LV9A 1WEPA 1N87A 3RTRB 2YYRA 5B8DA 3GV4A 4B86C 4BBQA 2JMDA 2KYUA 3N9MA 2KGIA 2KFTA 2CT2A 5TDRA 2MUMA 4AYCB 4R7EA 1JOCA 2HDPA 2H0DA 4FO9A 4TKPB 1XWHA 3T7LA 2K16A 2KWKA 3LQIA 3IHPA 2LGLA 5B75A 5G0FA 2KU3A 3HTKC 3KV6A 2ECTA 4F52B 1WENA 5LKZA 4YBMA 3O7AA 3SOUA 4QF3A 1ZBDB 2E6SA 2MA6A 2YQMA 1WEMA 2L0BA 5H9MA 2C2LA 2JMIA 4N3WA 2M6MA 4V3KC 1BORA 3KQIA 2I50A 4CCGX 4I7DA 5H1UA 4O64A 3EB5A 5FEYA 2M1RA 2K17A 4N4FA 3O35A 2RI7A 3N9NA 5D1KB 3ZVYA 1K2FA 2YREA 3LQJA 4WZ3B 4X3GA 4GNEA 4LKAA 2YU4A 3ZNIA 2LQ6A 3M62A 2YSJA 5G04B 1WEVA 5B78A 4YC9A 3C6WA 4UI9B 1CHCA 5H1TA 2L75A 5TRBA 2QJ0A 2KWOA 2VP7A 4QF2A 2LN0A 2MT5A 2UZGA 4YBSA 4S3OB 3HCUA 4A0CD 2ECVA 3I2DA 2CKLB 5DINA 5B79A 5KH9A 3SOWA 5I3LA 2YSMA 4YBTA 2E6RA 2ZETC 2FSAA 3DPLR 4R2YA 4B7YC 3LRQA 3ZYQA 2IDAA 2JMJA 4LK9A 5AITA 4ZDTA 4BHWA 4L58A 1JM7B 2MD7B 3C5KA 5D1MB 5JG6A 3O33A 4GNGA 1WEOA 5B76A 3RPGC
chains in the Genus database with same CATH superfamily
4UP5A 4YADA 1RMDA 4UP0A 4PTBA 3T9KA 4FJCA 4LLBA 5TDWA 2Y1MA 2YVRA 1WFKA 3MHHA 4FK5A 5K3QA 4C9ZA 2FD4A 2LRIC 1U6GB 1T1HA 5LKXA 5EYAF 1HYJA 4OGEA 1X4UA 2QICA 2DSMA 1WE9A 2KE1A 3QZVA 4WZ2A 4CA1A 3FJUB 5SVXA 4I7CA 4R8PK 1HYIA 2P57A 2LDRA 3Q1DA 2CSZA 2MKEA 1LDJB 1WEWA 2PNXA 2VJFA 3HCTA 3EB6A 1VD4A 1LDKC 3T6RA 5G05B 2LXPC 2OXQC 1FBVA 3U5PA 2DX8A 5KH3A 4LADB 1WIMA 5C11A 2VPGA 5FB0A 2KGGA 3FEHA 1MM2A 2LAUA 2EODA 1Z60A 2MD8C 5AIUA 3SHBA 2KKYA 3N9QA 3L1XA 3L1ZB 3GL6A 4L7XA 2ECWA 2KIZA 3SUBA 2FUIA 2VPEA 2KR4A 3LQHA 4ZUXU 1X4IA 4LJNA 2G45A 2RR4A 1IYMA 2YW8A 4FIPA 2HYED 2YURA 1WEEA 4NN2A 2LGVA 2D8UA 2H0DB 2D8SA 3V43A 3VK6A 2NAAA 3L11A 5C13A 3O70A 4GNDA 2F6JA 2QIZA 5B77A 1WEQA 4IC3A 3M7KA 3O34A 2XOYA 3DQVR 1WILA 3ZVZB 4YAXA 4AUQB 3M99A 3SOXA 1X4JA 2M85A 2K4DA 2C2VS 3U5OA 2VPBA 3M63A 3PUQA 3N9OA 4WZ0A 2VPDA 2VJFB 4YABA 4Z0OA 2YHOA 1WGMA 4I7BA 3PURA 4YATA 3U5NA 3O37A 4MVTA 2VJEA 5H1VA 2L5UA 5TBNA 2EXUA 2AN6A 3ZPVE 4QQ4A 4A49A 4P5OB 2K1JA 5LKUA 1MM3A 4ZQLA 4XI1A 4A4BA 1F62A 3KV5A 5DKAA 2PUYA 2YUCA 2L80A 1Z6UA 2E61A 4V3LC 2VNFA 1VYXA 4AP4A 2CKLA 5SVYA 2L43A 3U5MA 2MNZA 2LGKA 5KH7A 2EGPA 3N9LA 4GB0A 3N9PA 3NG2A 2ECJA 5J3XA 4S3OC 2Y43A 2DJAA 2KWNA 1JM7A 2LXHC 2G6QA 2MA5A 2YT5A 3LJUX 3RPGB 4AYCA 2Y1NA 2KREA 2XEUA 1WESA 2EA6A 4WA6A 4MSXA 3ZTGA 2KWJA 5FB1A 3FM8C 2JUNA 3HCSA 3PLWA 2FUUA 5TABA 4A4CA 1G25A 1VFYA 2BAYA 5SVIA 5D1LB 2YHNA 1FP0A 1V87A 4AVXA 2CSYA 2MNYA 2LGGA 2JRJA 2YQLA 2G43A 1Z2QA 2M13A 1WEUA 2F6NA 2VJEB 4PPEA 3KDEC 3FL2A 3LVQE 4W4UA 2F42A 4IC2A 3FAOA 2MIQA 3ZPV1 1DVPA 5FERA 2RSDA 2ECNA 2M3HA 3KNVA 3MHSA 3PHDA 2XB1A 5LCWB 5LKTA 2OWAA 3O36A 1E4UA 2KKXA 3ASLA 2ECIA 4GNFA 2ECGA 2CONA 2FFWA 4Q6FA 2LV9A 1WEPA 2XP0A 1N87A 2XOZA 3RTRB 2YYRA 5B8DA 3GV4A 4B86C 4BBQA 2JMDA 2KYUA 3N9MA 2CRWA 2KGIA 2IQJA 3LVRE 2KFTA 2CT2A 5TDRA 2MUMA 4AYCB 4R7EA 2JM3A 1JOCA 4OGCA 2HDPA 2H0DA 4FO9A 5SVIB 4TKPB 1XWHA 3T7LA 2K16A 2KWKA 3LQIA 4F1PA 3IHPA 2LGLA 5B75A 5G0FA 2KU3A 3HTKC 2CSVA 2EGMA 3KV6A 2ECTA 4F52B 3LDYA 1WENA 5LKZA 4YBMA 3O7AA 3SOUA 4QF3A 1ZBDB 2E6SA 2MA6A 2YQMA 3E2DA 2B0OE 1WEMA 2L0BA 5H9MA 2C2LA 2JMIA 4N3WA 2M6MA 4V3KC 1BORA 3KQIA 2I50A 4CCGX 4I7DA 5H1UA 4O64A 3EB5A 5FEYA 2M1RA 4H9DA 2K17A 4N4FA 3O35A 1DCQA 2RI7A 3N9NA 5D1KB 3ZVYA 1K2FA 2YREA 3LQJA 4WZ3B 4X3GA 4GNEA 4LKAA 2YU4A 3ZNIA 2LQ6A 3M62A 2YSJA 5G04B 1WEVA 2CRRA 3O47A 5B78A 4YC9A 3C6WA 4UI9B 3H7HA 1CHCA 2L7PA 5H1TA 2L75A 5TRBA 2QJ0A 3DWDA 3FANA 2KWOA 2VP7A 2XOCA 4QF2A 2LN0A 2MT5A 2UZGA 4YBSA 4S3OB 3HCUA 4A0CD 2ECVA 3I2DA 2CKLB 5DINA 5B79A 5KH9A 3SOWA 1MBMA 5I3LA 3DDTA 2YSMA 4YBTA 2E6RA 2ZETC 2FSAA 4Z0RA 3DPLR 4R2YA 4B7YC 3LRQA 3ZYQA 2IDAA 2JMJA 4LK9A 5AITA 4ZDTA 4BHWA 4L58A 1JM7B 2MD7B 3JUEA 3C5KA 5D1MB 5JG6A 3O33A 4GNGA 3MDBC 1WEOA 5B76A 3RPGC 4O62A
chains in the Genus database with same CATH topology
4UP5A 4YADA 1RMDA 4UP0A 4PTBA 4FJCA 4LLBA 5TDWA 2Y1MA 1WFKA 3MHHA 4FK5A 4C9ZA 2LRIC 1U6GB 1T1HA 5LKXA 5EYAF 1HYJA 1X4UA 2QICA 1WE9A 2KE1A 3QZVA 4WZ2A 4CA1A 4I7CA 4R8PK 1HYIA 2LDRA 2CSZA 1LDJB 1WEWA 2PNXA 2VJFA 3HCTA 3EB6A 1VD4A 1LDKC 3T6RA 5G05B 2LXPC 2OXQC 1FBVA 3U5PA 2DX8A 5KH3A 4LADB 1WIMA 5C11A 2VPGA 5FB0A 2KGGA 1MM2A 2EODA 1Z60A 2MD8C 5AIUA 3SHBA 3N9QA 3L1XA 3L1ZB 3GL6A 4L7XA 2ECWA 2KIZA 2FUIA 2VPEA 2KR4A 3LQHA 4ZUXU 1X4IA 4LJNA 2G45A 1IYMA 2YW8A 4FIPA 2HYED 2YURA 1WEEA 4NN2A 2LGVA 2H0DB 2D8SA 3V43A 3VK6A 2NAAA 3L11A 5C13A 3O70A 4GNDA 2F6JA 2QIZA 5B77A 1WEQA 4IC3A 3O34A 3DQVR 1WILA 3ZVZB 4YAXA 4AUQB 3M99A 3SOXA 1X4JA 2M85A 2K4DA 2C2VS 3U5OA 2VPBA 3M63A 3PUQA 3N9OA 4WZ0A 2VPDA 2VJFB 4YABA 2YHOA 1WGMA 4I7BA 3PURA 4YATA 3U5NA 3O37A 4MVTA 2VJEA 5H1VA 2L5UA 5TBNA 2AN6A 3ZPVE 4A49A 4P5OB 2K1JA 5LKUA 1MM3A 4ZQLA 4XI1A 4A4BA 1F62A 3KV5A 5DKAA 2PUYA 2YUCA 2L80A 1Z6UA 4V3LC 2VNFA 1VYXA 4AP4A 2CKLA 2L43A 3U5MA 2MNZA 2LGKA 5KH7A 2EGPA 3N9LA 4GB0A 3N9PA 3NG2A 2ECJA 5J3XA 4S3OC 2Y43A 2KWNA 1JM7A 2LXHC 2G6QA 2MA5A 2YT5A 3RPGB 4AYCA 2Y1NA 2KREA 2XEUA 1WESA 2EA6A 4WA6A 4MSXA 3ZTGA 2KWJA 5FB1A 3HCSA 2FUUA 5TABA 4A4CA 1G25A 1VFYA 2BAYA 5D1LB 2YHNA 1FP0A 1V87A 4AVXA 2CSYA 2MNYA 2LGGA 2JRJA 2YQLA 2G43A 1Z2QA 1WEUA 2F6NA 2VJEB 4PPEA 3FL2A 4W4UA 2F42A 4IC2A 2MIQA 3ZPV1 1DVPA 5FERA 2RSDA 2ECNA 2M3HA 3KNVA 3MHSA 3PHDA 2XB1A 5LCWB 5LKTA 3O36A 1E4UA 3ASLA 2ECIA 4GNFA 2ECGA 4Q6FA 2LV9A 1WEPA 1N87A 3RTRB 2YYRA 5B8DA 3GV4A 4B86C 4BBQA 2JMDA 2KYUA 3N9MA 2KGIA 2KFTA 2CT2A 5TDRA 2MUMA 4AYCB 4R7EA 1JOCA 2HDPA 2H0DA 4FO9A 4TKPB 1XWHA 3T7LA 2K16A 2KWKA 3LQIA 3IHPA 2LGLA 5B75A 5G0FA 2KU3A 3HTKC 3KV6A 2ECTA 4F52B 1WENA 5LKZA 4YBMA 3O7AA 3SOUA 4QF3A 1ZBDB 2E6SA 2MA6A 2YQMA 1WEMA 2L0BA 5H9MA 2C2LA 2JMIA 4N3WA 2M6MA 4V3KC 1BORA 3KQIA 2I50A 4CCGX 4I7DA 5H1UA 4O64A 3EB5A 5FEYA 2M1RA 2K17A 4N4FA 3O35A 2RI7A 3N9NA 5D1KB 3ZVYA 1K2FA 2YREA 3LQJA 4WZ3B 4X3GA 4GNEA 4LKAA 2YU4A 3ZNIA 2LQ6A 3M62A 2YSJA 5G04B 1WEVA 5B78A 4YC9A 3C6WA 4UI9B 1CHCA 5H1TA 2L75A 5TRBA 2QJ0A 2KWOA 2VP7A 4QF2A 2LN0A 2MT5A 2UZGA 4YBSA 4S3OB 3HCUA 4A0CD 2ECVA 3I2DA 2CKLB 5DINA 5B79A 5KH9A 3SOWA 5I3LA 2YSMA 4YBTA 2E6RA 2ZETC 2FSAA 3DPLR 4R2YA 4B7YC 3LRQA 3ZYQA 2IDAA 2JMJA 4LK9A 5AITA 4ZDTA 4BHWA 4L58A 1JM7B 2MD7B 3C5KA 5D1MB 5JG6A 3O33A 4GNGA 1WEOA 5B76A 3RPGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP5 A;  4YAD A;  1RMD A;  4UP0 A;  4PTB A;  4FJC A;  4LLB A;  5TDW A;  2Y1M A;  1WFK A;  3MHH A;  4FK5 A;  4C9Z A;  2LRI C;  1U6G B;  1T1H A;  5LKX A;  5EYA F;  1HYJ A;  1X4U A;  2QIC A;  1WE9 A;  2KE1 A;  3QZV A;  4WZ2 A;  4CA1 A;  4I7C A;  4R8P K;  1HYI A;  2LDR A;  2CSZ A;  1LDJ B;  1WEW A;  2PNX A;  2VJF A;  3HCT A;  3EB6 A;  1VD4 A;  1LDK C;  3T6R A;  5G05 B;  2LXP C;  2OXQ C;  1FBV A;  3U5P A;  2DX8 A;  5KH3 A;  4LAD B;  1WIM A;  5C11 A;  2VPG A;  5FB0 A;  2KGG A;  1MM2 A;  2EOD A;  1Z60 A;  2MD8 C;  5AIU A;  3SHB A;  3N9Q A;  3L1X A;  3L1Z B;  3GL6 A;  4L7X A;  2ECW A;  2KIZ A;  2FUI A;  2VPE A;  2KR4 A;  3LQH A;  4ZUX U;  1X4I A;  4LJN A;  2G45 A;  1IYM A;  2YW8 A;  4FIP A;  2HYE D;  2YUR A;  1WEE A;  4NN2 A;  2LGV A;  2H0D B;  2D8S A;  3V43 A;  3VK6 A;  2NAA A;  3L11 A;  5C13 A;  3O70 A;  4GND A;  2F6J A;  2QIZ A;  5B77 A;  1WEQ A;  4IC3 A;  3O34 A;  3DQV R;  1WIL A;  3ZVZ B;  4YAX A;  4AUQ B;  3M99 A;  3SOX A;  1X4J A;  2M85 A;  2K4D A;  2C2V S;  3U5O A;  2VPB A;  3M63 A;  3PUQ A;  3N9O A;  4WZ0 A;  2VPD A;  2VJF B;  4YAB A;  2YHO A;  1WGM A;  4I7B A;  3PUR A;  4YAT A;  3U5N A;  3O37 A;  4MVT A;  2VJE A;  5H1V A;  2L5U A;  5TBN A;  2AN6 A;  3ZPV E;  4A49 A;  4P5O B;  2K1J A;  5LKU A;  1MM3 A;  4ZQL A;  4XI1 A;  4A4B A;  1F62 A;  3KV5 A;  5DKA A;  2PUY A;  2YUC A;  2L80 A;  1Z6U A;  4V3L C;  2VNF A;  1VYX A;  4AP4 A;  2CKL A;  2L43 A;  3U5M A;  2MNZ A;  2LGK A;  5KH7 A;  2EGP A;  3N9L A;  4GB0 A;  3N9P A;  3NG2 A;  2ECJ A;  5J3X A;  4S3O C;  2Y43 A;  2KWN A;  1JM7 A;  2LXH C;  2G6Q A;  2MA5 A;  2YT5 A;  3RPG B;  4AYC A;  2Y1N A;  2KRE A;  2XEU A;  1WES A;  2EA6 A;  4WA6 A;  4MSX A;  3ZTG A;  2KWJ A;  5FB1 A;  3HCS A;  2FUU A;  5TAB A;  4A4C A;  1G25 A;  1VFY A;  2BAY A;  5D1L B;  2YHN A;  1FP0 A;  1V87 A;  4AVX A;  2CSY A;  2MNY A;  2LGG A;  2JRJ A;  2YQL A;  2G43 A;  1Z2Q A;  1WEU A;  2F6N A;  2VJE B;  4PPE A;  3FL2 A;  4W4U A;  2F42 A;  4IC2 A;  2MIQ A;  3ZPV 1;  1DVP A;  5FER A;  2RSD A;  2ECN A;  2M3H A;  3KNV A;  3MHS A;  3PHD A;  2XB1 A;  5LCW B;  5LKT A;  3O36 A;  1E4U A;  3ASL A;  2ECI A;  4GNF A;  2ECG A;  4Q6F A;  2LV9 A;  1WEP A;  1N87 A;  3RTR B;  2YYR A;  5B8D A;  3GV4 A;  4B86 C;  4BBQ A;  2JMD A;  2KYU A;  3N9M A;  2KGI A;  2KFT A;  2CT2 A;  5TDR A;  2MUM A;  4AYC B;  4R7E A;  1JOC A;  2HDP A;  2H0D A;  4FO9 A;  4TKP B;  1XWH A;  3T7L A;  2K16 A;  2KWK A;  3LQI A;  3IHP A;  2LGL A;  5B75 A;  5G0F A;  2KU3 A;  3HTK C;  3KV6 A;  2ECT A;  4F52 B;  1WEN A;  5LKZ A;  4YBM A;  3O7A A;  3SOU A;  4QF3 A;  1ZBD B;  2E6S A;  2MA6 A;  2YQM A;  1WEM A;  2L0B A;  5H9M A;  2C2L A;  2JMI A;  4N3W A;  2M6M A;  4V3K C;  1BOR A;  3KQI A;  2I50 A;  4CCG X;  4I7D A;  5H1U A;  4O64 A;  3EB5 A;  5FEY A;  2M1R A;  2K17 A;  4N4F A;  3O35 A;  2RI7 A;  3N9N A;  5D1K B;  3ZVY A;  1K2F A;  2YRE A;  3LQJ A;  4WZ3 B;  4X3G A;  4GNE A;  4LKA A;  2YU4 A;  3ZNI A;  2LQ6 A;  3M62 A;  2YSJ A;  5G04 B;  1WEV A;  5B78 A;  4YC9 A;  3C6W A;  4UI9 B;  1CHC A;  5H1T A;  2L75 A;  5TRB A;  2QJ0 A;  2KWO A;  2VP7 A;  4QF2 A;  2LN0 A;  2MT5 A;  2UZG A;  4YBS A;  4S3O B;  3HCU A;  4A0C D;  2ECV A;  3I2D A;  2CKL B;  5DIN A;  5B79 A;  5KH9 A;  3SOW A;  5I3L A;  2YSM A;  4YBT A;  2E6R A;  2ZET C;  2FSA A;  3DPL R;  4R2Y A;  4B7Y C;  3LRQ A;  3ZYQ A;  2IDA A;  2JMJ A;  4LK9 A;  5AIT A;  4ZDT A;  4BHW A;  4L58 A;  1JM7 B;  2MD7 B;  3C5K A;  5D1M B;  5JG6 A;  3O33 A;  4GNG A;  1WEO A;  5B76 A;  3RPG C; 
#chains in the Genus database with same CATH topology
 4UP5 A;  4YAD A;  1RMD A;  4UP0 A;  4PTB A;  3T9K A;  4FJC A;  4LLB A;  5TDW A;  2Y1M A;  2YVR A;  1WFK A;  3MHH A;  4FK5 A;  5K3Q A;  4C9Z A;  2FD4 A;  2LRI C;  1U6G B;  1T1H A;  5LKX A;  5EYA F;  1HYJ A;  4OGE A;  1X4U A;  2QIC A;  2DSM A;  1WE9 A;  2KE1 A;  3QZV A;  4WZ2 A;  4CA1 A;  3FJU B;  5SVX A;  4I7C A;  4R8P K;  1HYI A;  2P57 A;  2LDR A;  3Q1D A;  2CSZ A;  2MKE A;  1LDJ B;  1WEW A;  2PNX A;  2VJF A;  3HCT A;  3EB6 A;  1VD4 A;  1LDK C;  3T6R A;  5G05 B;  2LXP C;  2OXQ C;  1FBV A;  3U5P A;  2DX8 A;  5KH3 A;  4LAD B;  1WIM A;  5C11 A;  2VPG A;  5FB0 A;  2KGG A;  3FEH A;  1MM2 A;  2LAU A;  2EOD A;  1Z60 A;  2MD8 C;  5AIU A;  3SHB A;  2KKY A;  3N9Q A;  3L1X A;  3L1Z B;  3GL6 A;  4L7X A;  2ECW A;  2KIZ A;  3SUB A;  2FUI A;  2VPE A;  2KR4 A;  3LQH A;  4ZUX U;  1X4I A;  4LJN A;  2G45 A;  2RR4 A;  1IYM A;  2YW8 A;  4FIP A;  2HYE D;  2YUR A;  1WEE A;  4NN2 A;  2LGV A;  2D8U A;  2H0D B;  2D8S A;  3V43 A;  3VK6 A;  2NAA A;  3L11 A;  5C13 A;  3O70 A;  4GND A;  2F6J A;  2QIZ A;  5B77 A;  1WEQ A;  4IC3 A;  3M7K A;  3O34 A;  2XOY A;  3DQV R;  1WIL A;  3ZVZ B;  4YAX A;  4AUQ B;  3M99 A;  3SOX A;  1X4J A;  2M85 A;  2K4D A;  2C2V S;  3U5O A;  2VPB A;  3M63 A;  3PUQ A;  3N9O A;  4WZ0 A;  2VPD A;  2VJF B;  4YAB A;  4Z0O A;  2YHO A;  1WGM A;  4I7B A;  3PUR A;  4YAT A;  3U5N A;  3O37 A;  4MVT A;  2VJE A;  5H1V A;  2L5U A;  5TBN A;  2EXU A;  2AN6 A;  3ZPV E;  4QQ4 A;  4A49 A;  4P5O B;  2K1J A;  5LKU A;  1MM3 A;  4ZQL A;  4XI1 A;  4A4B A;  1F62 A;  3KV5 A;  5DKA A;  2PUY A;  2YUC A;  2L80 A;  1Z6U A;  2E61 A;  4V3L C;  2VNF A;  1VYX A;  4AP4 A;  2CKL A;  5SVY A;  2L43 A;  3U5M A;  2MNZ A;  2LGK A;  5KH7 A;  2EGP A;  3N9L A;  4GB0 A;  3N9P A;  3NG2 A;  2ECJ A;  5J3X A;  4S3O C;  2Y43 A;  2DJA A;  2KWN A;  1JM7 A;  2LXH C;  2G6Q A;  2MA5 A;  2YT5 A;  3LJU X;  3RPG B;  4AYC A;  2Y1N A;  2KRE A;  2XEU A;  1WES A;  2EA6 A;  4WA6 A;  4MSX A;  3ZTG A;  2KWJ A;  5FB1 A;  3FM8 C;  2JUN A;  3HCS A;  3PLW A;  2FUU A;  5TAB A;  4A4C A;  1G25 A;  1VFY A;  2BAY A;  5SVI A;  5D1L B;  2YHN A;  1FP0 A;  1V87 A;  4AVX A;  2CSY A;  2MNY A;  2LGG A;  2JRJ A;  2YQL A;  2G43 A;  1Z2Q A;  2M13 A;  1WEU A;  2F6N A;  2VJE B;  4PPE A;  3KDE C;  3FL2 A;  3LVQ E;  4W4U A;  2F42 A;  4IC2 A;  3FAO A;  2MIQ A;  3ZPV 1;  1DVP A;  5FER A;  2RSD A;  2ECN A;  2M3H A;  3KNV A;  3MHS A;  3PHD A;  2XB1 A;  5LCW B;  5LKT A;  2OWA A;  3O36 A;  1E4U A;  2KKX A;  3ASL A;  2ECI A;  4GNF A;  2ECG A;  2CON A;  2FFW A;  4Q6F A;  2LV9 A;  1WEP A;  2XP0 A;  1N87 A;  2XOZ A;  3RTR B;  2YYR A;  5B8D A;  3GV4 A;  4B86 C;  4BBQ A;  2JMD A;  2KYU A;  3N9M A;  2CRW A;  2KGI A;  2IQJ A;  3LVR E;  2KFT A;  2CT2 A;  5TDR A;  2MUM A;  4AYC B;  4R7E A;  2JM3 A;  1JOC A;  4OGC A;  2HDP A;  2H0D A;  4FO9 A;  5SVI B;  4TKP B;  1XWH A;  3T7L A;  2K16 A;  2KWK A;  3LQI A;  4F1P A;  3IHP A;  2LGL A;  5B75 A;  5G0F A;  2KU3 A;  3HTK C;  2CSV A;  2EGM A;  3KV6 A;  2ECT A;  4F52 B;  3LDY A;  1WEN A;  5LKZ A;  4YBM A;  3O7A A;  3SOU A;  4QF3 A;  1ZBD B;  2E6S A;  2MA6 A;  2YQM A;  3E2D A;  2B0O E;  1WEM A;  2L0B A;  5H9M A;  2C2L A;  2JMI A;  4N3W A;  2M6M A;  4V3K C;  1BOR A;  3KQI A;  2I50 A;  4CCG X;  4I7D A;  5H1U A;  4O64 A;  3EB5 A;  5FEY A;  2M1R A;  4H9D A;  2K17 A;  4N4F A;  3O35 A;  1DCQ A;  2RI7 A;  3N9N A;  5D1K B;  3ZVY A;  1K2F A;  2YRE A;  3LQJ A;  4WZ3 B;  4X3G A;  4GNE A;  4LKA A;  2YU4 A;  3ZNI A;  2LQ6 A;  3M62 A;  2YSJ A;  5G04 B;  1WEV A;  2CRR A;  3O47 A;  5B78 A;  4YC9 A;  3C6W A;  4UI9 B;  3H7H A;  1CHC A;  2L7P A;  5H1T A;  2L75 A;  5TRB A;  2QJ0 A;  3DWD A;  3FAN A;  2KWO A;  2VP7 A;  2XOC A;  4QF2 A;  2LN0 A;  2MT5 A;  2UZG A;  4YBS A;  4S3O B;  3HCU A;  4A0C D;  2ECV A;  3I2D A;  2CKL B;  5DIN A;  5B79 A;  5KH9 A;  3SOW A;  1MBM A;  5I3L A;  3DDT A;  2YSM A;  4YBT A;  2E6R A;  2ZET C;  2FSA A;  4Z0R A;  3DPL R;  4R2Y A;  4B7Y C;  3LRQ A;  3ZYQ A;  2IDA A;  2JMJ A;  4LK9 A;  5AIT A;  4ZDT A;  4BHW A;  4L58 A;  1JM7 B;  2MD7 B;  3JUE A;  3C5K A;  5D1M B;  5JG6 A;  3O33 A;  4GNG A;  3MDB C;  1WEO A;  5B76 A;  3RPG C;  4O62 A; 
#chains in the Genus database with same CATH homology
 4UP5 A;  4YAD A;  1RMD A;  4UP0 A;  4PTB A;  4FJC A;  4LLB A;  5TDW A;  2Y1M A;  1WFK A;  3MHH A;  4FK5 A;  4C9Z A;  2LRI C;  1U6G B;  1T1H A;  5LKX A;  5EYA F;  1HYJ A;  1X4U A;  2QIC A;  1WE9 A;  2KE1 A;  3QZV A;  4WZ2 A;  4CA1 A;  4I7C A;  4R8P K;  1HYI A;  2LDR A;  2CSZ A;  1LDJ B;  1WEW A;  2PNX A;  2VJF A;  3HCT A;  3EB6 A;  1VD4 A;  1LDK C;  3T6R A;  5G05 B;  2LXP C;  2OXQ C;  1FBV A;  3U5P A;  2DX8 A;  5KH3 A;  4LAD B;  1WIM A;  5C11 A;  2VPG A;  5FB0 A;  2KGG A;  1MM2 A;  2EOD A;  1Z60 A;  2MD8 C;  5AIU A;  3SHB A;  3N9Q A;  3L1X A;  3L1Z B;  3GL6 A;  4L7X A;  2ECW A;  2KIZ A;  2FUI A;  2VPE A;  2KR4 A;  3LQH A;  4ZUX U;  1X4I A;  4LJN A;  2G45 A;  1IYM A;  2YW8 A;  4FIP A;  2HYE D;  2YUR A;  1WEE A;  4NN2 A;  2LGV A;  2H0D B;  2D8S A;  3V43 A;  3VK6 A;  2NAA A;  3L11 A;  5C13 A;  3O70 A;  4GND A;  2F6J A;  2QIZ A;  5B77 A;  1WEQ A;  4IC3 A;  3O34 A;  3DQV R;  1WIL A;  3ZVZ B;  4YAX A;  4AUQ B;  3M99 A;  3SOX A;  1X4J A;  2M85 A;  2K4D A;  2C2V S;  3U5O A;  2VPB A;  3M63 A;  3PUQ A;  3N9O A;  4WZ0 A;  2VPD A;  2VJF B;  4YAB A;  2YHO A;  1WGM A;  4I7B A;  3PUR A;  4YAT A;  3U5N A;  3O37 A;  4MVT A;  2VJE A;  5H1V A;  2L5U A;  5TBN A;  2AN6 A;  3ZPV E;  4A49 A;  4P5O B;  2K1J A;  5LKU A;  1MM3 A;  4ZQL A;  4XI1 A;  4A4B A;  1F62 A;  3KV5 A;  5DKA A;  2PUY A;  2YUC A;  2L80 A;  1Z6U A;  4V3L C;  2VNF A;  1VYX A;  4AP4 A;  2CKL A;  2L43 A;  3U5M A;  2MNZ A;  2LGK A;  5KH7 A;  2EGP A;  3N9L A;  4GB0 A;  3N9P A;  3NG2 A;  2ECJ A;  5J3X A;  4S3O C;  2Y43 A;  2KWN A;  1JM7 A;  2LXH C;  2G6Q A;  2MA5 A;  2YT5 A;  3RPG B;  4AYC A;  2Y1N A;  2KRE A;  2XEU A;  1WES A;  2EA6 A;  4WA6 A;  4MSX A;  3ZTG A;  2KWJ A;  5FB1 A;  3HCS A;  2FUU A;  5TAB A;  4A4C A;  1G25 A;  1VFY A;  2BAY A;  5D1L B;  2YHN A;  1FP0 A;  1V87 A;  4AVX A;  2CSY A;  2MNY A;  2LGG A;  2JRJ A;  2YQL A;  2G43 A;  1Z2Q A;  1WEU A;  2F6N A;  2VJE B;  4PPE A;  3FL2 A;  4W4U A;  2F42 A;  4IC2 A;  2MIQ A;  3ZPV 1;  1DVP A;  5FER A;  2RSD A;  2ECN A;  2M3H A;  3KNV A;  3MHS A;  3PHD A;  2XB1 A;  5LCW B;  5LKT A;  3O36 A;  1E4U A;  3ASL A;  2ECI A;  4GNF A;  2ECG A;  4Q6F A;  2LV9 A;  1WEP A;  1N87 A;  3RTR B;  2YYR A;  5B8D A;  3GV4 A;  4B86 C;  4BBQ A;  2JMD A;  2KYU A;  3N9M A;  2KGI A;  2KFT A;  2CT2 A;  5TDR A;  2MUM A;  4AYC B;  4R7E A;  1JOC A;  2HDP A;  2H0D A;  4FO9 A;  4TKP B;  1XWH A;  3T7L A;  2K16 A;  2KWK A;  3LQI A;  3IHP A;  2LGL A;  5B75 A;  5G0F A;  2KU3 A;  3HTK C;  3KV6 A;  2ECT A;  4F52 B;  1WEN A;  5LKZ A;  4YBM A;  3O7A A;  3SOU A;  4QF3 A;  1ZBD B;  2E6S A;  2MA6 A;  2YQM A;  1WEM A;  2L0B A;  5H9M A;  2C2L A;  2JMI A;  4N3W A;  2M6M A;  4V3K C;  1BOR A;  3KQI A;  2I50 A;  4CCG X;  4I7D A;  5H1U A;  4O64 A;  3EB5 A;  5FEY A;  2M1R A;  2K17 A;  4N4F A;  3O35 A;  2RI7 A;  3N9N A;  5D1K B;  3ZVY A;  1K2F A;  2YRE A;  3LQJ A;  4WZ3 B;  4X3G A;  4GNE A;  4LKA A;  2YU4 A;  3ZNI A;  2LQ6 A;  3M62 A;  2YSJ A;  5G04 B;  1WEV A;  5B78 A;  4YC9 A;  3C6W A;  4UI9 B;  1CHC A;  5H1T A;  2L75 A;  5TRB A;  2QJ0 A;  2KWO A;  2VP7 A;  4QF2 A;  2LN0 A;  2MT5 A;  2UZG A;  4YBS A;  4S3O B;  3HCU A;  4A0C D;  2ECV A;  3I2D A;  2CKL B;  5DIN A;  5B79 A;  5KH9 A;  3SOW A;  5I3L A;  2YSM A;  4YBT A;  2E6R A;  2ZET C;  2FSA A;  3DPL R;  4R2Y A;  4B7Y C;  3LRQ A;  3ZYQ A;  2IDA A;  2JMJ A;  4LK9 A;  5AIT A;  4ZDT A;  4BHW A;  4L58 A;  1JM7 B;  2MD7 B;  3C5K A;  5D1M B;  5JG6 A;  3O33 A;  4GNG A;  1WEO A;  5B76 A;  3RPG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...