1CN7A

Yeast ribosomal protein l30
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
104
structure length
104
Chain Sequence
APVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S RIBOSOMAL PROTEIN L30E
publication title Local folding coupled to RNA binding in the yeast ribosomal protein L30.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 44
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 1999-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1cn7A00
3N4YA 3E20B 1X7PA 2QI2A 3WXMB 1NJIH 3NMUC 2OTJF 3CCLF 1Q82H 2WALA 1VQNF 3LWOC 5GIOC 1VQMF 1RA4A 1JJ2F 1E7KA 3I55F 3NK6A 3RA6A 1W42A 1GO0A 1VQKF 1KD1H 1K73H 3CMAF 3ON1A 2FC3A 3CCQF 4BW0B 3CCUF 3OBWA 2KTUA 2JNBA 1YIJF 1Q86H 1KC8H 2VGMA 3JCMM 1Q81H 3LWRC 1DT9A 3CMEF 1QVGF 5G4UC 2KTVA 5GIPC 2LBXA 1W3EX 1X7OA 3FFMA 4TZZA 3OW2F 3NVKE 3CC4F 3PAFA 1PXWA 2QA4F 2OTLF 3CPQA 5DCVA 1VQ6F 1YJWF 3CC2F 3CPWF 4BY9D 5EO3A 3LWVC 5G4VC 2BO1A 3E1YA 1VQ7F 1YI2F 3VI6A 3CCJF 5GANK 2ALEA 3CCMF 2KG4A 1N8RH 1M1KH 5GAPK 1VQLF 3CCVF 3G6EF 3SIUA 1W2BF 4X3LA 1YJNF 2OZBA 1KQSF 1W41A 3N4ZA 1M90H 1VQ4F 1VQOF 1CN7A 2HVYD 3PLAC 5GINC 3CXCF 1YJ9F 3G4SF 3CC7F 5A2QM 3HAXD 3GYQA 1GZ0A 3SIVA 1RLGA 1VQ5F 1W40A 3J7AR 1GO1A 3J81M 3CD6F 3LFOA 1S72F 1YITF 1CK2A 1QVFF 3JAMM 3MCAB 1SDSA 3CCEF 3NK7A 3I56F 3RA5A 1IPAA 1XBIA 2I6DA 3IR9A 1YHQF 3G71F 2VGNA 1K9MH 3CCRF 5IT9M 3LWPC 5EWRA 1ZWZA 1VQPF 1Q7YH 2LBWA 3NVIB 3CCSF 4C4WC 2QEXF 2OHWA 4X3MA 3AGKA 1NMUB 3OBYA 3V7QA 3J80M 2CZWA 5FLXM 1X52A 3CG6A 5FJ4C 3LWQC 4LCKA 3O85A 3HJWC 1T0KB 2AIFA 3VMFB 3V7EA 4NUTA 1K8AH 1VQ9F 1H7MA 1VQ8F
chains in the Genus database with same CATH superfamily
3N4YA 4G4YA 1PF5A 2ZVYA 3JARA 3MQWA 1X7PA 3NMUC 1NJIH 4I55A 4C8IA 3RYIB 4EB6B 3D54A 3LWOC 1QD9A 5BMVA 2IG8A 1VQMF 1E7KA 1XV2A 2PMPA 5CA0B 1W42A 3FD6A 3S0HA 4B46A 1VQKF 5JCOC 1U40A 3WJRA 3D01A 2OTMA 3KJJA 3M84A 5JH7B 2JNBA 5LYJB 2KGWA 4O4HA 3WGLA 3JATB 1W59A 4ZI7B 1KC8H 2RHLA 3K14A 2CSLA 1DT9A 4M8IA 1TVKB 2RHOA 4KWEA 5MN5A 3CMEF 4LNUB 3L7QA 4IIJB 1Z5WA 1X7OA 5CB4A 4O4IB 5HP7A 3S02A 4U39A 4C82A 3OW2F 5AVMA 4RQOA 5KX5B 4I4TA 3S0YA 2AMTA 2QA4F 2HRUA 4BT2A 5LP6B 4TUYA 1U3LA 5JVDB 3CC2F 3CPWF 1QAHA 5EO3A 4C8EA 3LWVC 3GHZA 2CW4A 5LXTA 2Z1FA 3VI6A 5GANK 2ALEA 4ZOLB 3VYSC 5IJ9A 5JQGB 2VAMA 4G4WA 4O2BA 1VQVA 2UZHA 3KHNA 4X1YA 1W2BF 4B5CA 1H48A 3ESJA 1FFXA 4YJ2A 3ZO8A 3QTYA 3WGMA 3FBAA 3OONA 3RYCB 1VQ4F 3DDNA 4I50B 2HVYD 5GINC 1DBFA 3G4SF 3CC7F 5A2QM 2LBTA 5J2UB 3WJPA 1VQ5F 1W40A 1SZQA 3RYIA 3J81M 4BT7A 4EB6A 3E22B 5GONB 5CA0A 1COMA 3GTZA 3VYTC 4G4ZA 3D00A 1XBIA 2I6DA 1K9MH 5JH7A 5IT9M 2CVLA 5EWRA 1Q7YH 1VQPF 3JATA 4C8GA 4ZI7A 1IV1A 2OHWA 3Q8HA 2RHJA 3AGKA 1TVKA 3CB2A 4YJ3B 3C8LA 3JASB 2CZWA 3JAWB 4IIJA 4LNUA 5EZYB 1X52A 3CG6A 2ZAUA 4LCKA 1T0KB 3HTNA 1H47A 4BT6A 2HS0A 2HP0A 5LP6A 2CHSA 3S03A 5EB0A 2LCAA 3WXMB 2Z1TA 2G9IA 3WGNA 3CCLF 3BYQA 2H8CA 5EIBC 3K12A 5GIOC 4ZOLA 4BVRA 5JQGA 1JJ2F 1W5AA 3HKBB 1KD1H 3CMAF 3F0DA 1KNJA 2P6YA 2R6R1 3OBWA 3VOBA 1Q86H 4BVSA 2W8BC 3RYCA 4FFBB 3N2GB 2VGMA 4I50A 1FSZA 2PHNA 4HNAB 1J7HA 5HXZA 1GX1A 4TV8A 3HKCB 5J2UA 1W581 2GVIA 3TD5A 3FFMA 3NVKE 3VYUC 3E22A 3PAFA 3DC2A 5GONA 5IJ0B 1YJWF 3MBMA 3IKEA 1R1MA 2HS3A 5EIBD 4X1KB 2I6RA 2KG4A 2UYPA 3UT5B 1M1KH 5GAPK 5MN4A 3G6EF 2DT4A 4ZHQB 3SIUA 4WBNB 3B6NA 4YJ3A 5EZYA 3JAWA 3N4ZA 1M90H 4ERHA 5C8YB 3PLAC 3TD3A 2UYJA 3C9RA 2B33A 3MDOA 3VO8A 5ITZB 1FNKA 1GO1A 3S06A 1W57A 3HKEB 3U0OA 3V3TA 3JAMM 5EAZA 1IV4A 3HKBA 3M4SA 3CCEF 3N2KB 5HP8A 1UI9A 3S0WA 3G71F 5JCOA 3CCRF 5LOVB 3HKDB 3N2GA 4FFBA 5CA1B 3T80A 4C4WC 3RYHB 4HNAA 1SA0B 2Z1UA 3M1XA 1NMUB 1IV3A 3J80M 3HKCA 3KJKA 2HQSC 3LWQC 3O85A 2FGYA 3HJWC 1CLIA 1VK3A 4F6RB 4NUTA 1VQ9F 3F0EA 5IJ0A 1RLUA 4G4VA 3WPWA 4TV9B 4EI7A 3VTIC 4X20B 4X1KA 4ZHVA 4U3JB 4B45A 1UFYA 3C9UA 5LYJA 3UT5A 2Z1EA 3JAKB 3NK6A 4O4LB 3RA6A 4ZHQA 1JFFB 3ZOPA 1GO0A 3RE3A 4WBNA 3ELCA 3VIUA 5KMGB 1K73H 4DXDA 2FC3A 3CCQF 4BW0B 3CCUF 4O4IA 4R40B 2YYEA 1Q81H 5C8YA 1TUBB 3IMPA 5KX5A 2CHTA 3LWRC 3KE1A 3WGKA 1QVGF 1ODEA 2KTVA 2LBXA 5JVDA 3P4EA 1OFUA 4TZZA 4PWTA 4ZK7A 1VHAA 3CC4F 3HKEA 1PXWA 3F0FA 2EWCA 2OTLF 3CPQA 1RQ7A 2Q1XA 5EB1B 3C9SA 4BY9D 2F9ZC 3JALB 3N2KA 5G4VC 3QUWA 1Q8RA 2BO1A 3E1YA 2N48A 3R0PA 3HWUA 2NMUA 3CCMF 2R751 1N8RH 5LOVA 5CA1A 2ZODA 1W5EA 2GLZA 3RYHA 2UYNB 3CYQA 1SA0A 2OZBA 2H6LA 1KQSF 4O2BB 1W55A 3VOAA 1VQOF 4F6RA 1CN7A 4BT4A 1YJ9F 4YJ2B 5HY0A 5LA6B 3HAXD 5HY4A 3GYQA 1GZ0A 4TV9A 1RLGA 2RB9A 3J7AR 2RHHA 2VAWA 5IYZB 1S72F 4U3JA 3CD6F 3P10A 1Z5VA 2BTUA 3JAKA 4O4LA 3MCAB 4O2AB 4ZHYB 1SDSA 1JFFA 3I56F 3IEQA 5EYPB 1IPAA 5KMGA 2IQQA 1YHQF 3ZP7A 3KIZA 3JASA 5HWEA 3FD5A 3LWPC 3ZP4A 4DRXB 3NVIB 2LBWA 1JD1A 4G88A 3MCQA 3CCSF 1TUBA 4XCQA 4C81A 2QEXF 1XRGA 5J2TB 4X3MA 1JY8A 4BT5A 3I3FA 2ZOVA 2QTPA 5FJ4C 3RYFB 3LDTA 3V7EA 1IV2A 3C9TA 3I7TA 2K1SA 1K8AH 3ERNA 1VQ8F 2V9YA 2DYYA 2BTQB 4E6EA 2MQEA 3E20B 3LMEA 1QU9A 2QI2A 3JALA 5B8FA 1JN1A 2OTJF 3CYPB 1Q82H 2WALA 1VQNF 1RA4A 3I55F 2HP0B 3JVHA 4EI8A 1XHOA 4RHAA 4BVTA 2UYNA 3P0ZA 3ON1A 3K2XA 3EORA 2KTUA 4O4JB 1YIJF 3VCZA 1YQNA 2Q1YA 1ONIA 3JCMM 5FNVB 2UYKA 5G4UC 5GIPC 1W5BA 1W3EX 5LA6A 2YXZA 4X1IB 4IHJB 5HY1A 5IYZA 4NWOB 5LP6C 5DCVA 4B62A 3QHDA 1VQ6F 1U43A 4O2AA 3IEWA 3JARB 1T0AA 2AIZP 2ZVZA 4TV8B 5EYPA 4I55B 4NQ3A 5MN6A 1FNJA 2L26A 1VQ7F 2HP3A 1YI2F 3CCJF 4G4XA 3K0TA 3IKFA 5BMVB 4DRXA 1VQLF 2VXYA 3CCVF 4BT3A 4X3LA 1YJNF 5J2TA 5ITZA 3RYFA 1W5FA 1W41A 2GZLA 4O4HB 4BVQA 2HX0A 1KNKA 3WGJA 3CXCF 2H8EA 1VH8A 4EI9A 5CB4B 2VAPA 3SIVA 2IAFA 2CWJA 3LFOA 4I4TB 3WJQA 1YITF 1CK2A 1QVFF 1OAPA 3F0GA 2BTOA 4TUYB 3HKDA 3NK7A 3TD4A 3RA5A 1RQ2A 5LXTB 1NQ3A 3IR9A 2HRYA 2HS4A 2VGNA 5IJ9B 1YGYA 4O4JA 1ZWZA 3WPXA 2Z01A 4X1YB 5HXUA 5FNVA 3FPIA 1FFXB 1X25A 3V4DA 3OBYA 3V7QA 5FLXM 3F6MA 4X1IA 4IHJA 2ZF8A 2AIFA 4X20A 3VMFB 4ZHWA 5HY2A 3LYBA 1H7MA 1U3PA
chains in the Genus database with same CATH topology
3N4YA 3E20B 1X7PA 2QI2A 3WXMB 1NJIH 3NMUC 4EI7A 2OTJF 3CCLF 1Q82H 2WALA 1VQNF 3LWOC 5GIOC 4BVRA 1VQMF 1RA4A 1JJ2F 1E7KA 3I55F 3NK6A 3RA6A 4EI8A 1W42A 1GO0A 4BVTA 1VQKF 1KD1H 1K73H 3CMAF 3ON1A 2FC3A 3CCQF 4BW0B 3CCUF 3OBWA 2KTUA 2JNBA 1YIJF 1Q86H 4BVSA 1KC8H 2VGMA 3JCMM 1Q81H 3LWRC 1DT9A 3CMEF 1QVGF 5G4UC 2KTVA 5GIPC 2LBXA 5HXZA 1W3EX 1X7OA 3FFMA 5HY1A 4TZZA 3OW2F 3NVKE 3CC4F 3PAFA 1PXWA 2QA4F 2OTLF 3CPQA 5DCVA 1VQ6F 1YJWF 3CC2F 3CPWF 4BY9D 5EO3A 2F9ZC 4NQ3A 3LWVC 5G4VC 2BO1A 3E1YA 1VQ7F 1YI2F 3VI6A 3CCJF 5GANK 2ALEA 3CCMF 2KG4A 1N8RH 1M1KH 5GAPK 1VQLF 3CCVF 3G6EF 3SIUA 1W2BF 4X3LA 1YJNF 2GLZA 2OZBA 1KQSF 1W41A 3N4ZA 1M90H 1VQ4F 1VQOF 4BVQA 1CN7A 2HVYD 3PLAC 5GINC 3CXCF 1YJ9F 3G4SF 5HY0A 3CC7F 5A2QM 3HAXD 5HY4A 4EI9A 3GYQA 1GZ0A 3SIVA 1RLGA 1VQ5F 1W40A 3J7AR 1GO1A 3J81M 3CD6F 3LFOA 1S72F 1YITF 1CK2A 1QVFF 3V3TA 3JAMM 3MCAB 1SDSA 3CCEF 3NK7A 3I56F 3RA5A 3D00A 1IPAA 1XBIA 2I6DA 3IR9A 1YHQF 3G71F 2VGNA 5HWEA 1K9MH 3CCRF 5IT9M 3LWPC 5EWRA 1ZWZA 1VQPF 1Q7YH 2LBWA 3NVIB 3CCSF 4C4WC 4XCQA 2QEXF 2OHWA 5HXUA 4X3MA 3AGKA 1NMUB 3OBYA 3V7QA 3J80M 2CZWA 5FLXM 1X52A 3CG6A 5FJ4C 3LWQC 4LCKA 3O85A 2FGYA 1T0KB 2AIFA 3VMFB 3HJWC 3V7EA 5HY2A 4NUTA 1K8AH 1VQ9F 1H7MA 1VQ8F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Y A;  3E20 B;  1X7P A;  2QI2 A;  3WXM B;  1NJI H;  3NMU C;  2OTJ F;  3CCL F;  1Q82 H;  2WAL A;  1VQN F;  3LWO C;  5GIO C;  1VQM F;  1RA4 A;  1JJ2 F;  1E7K A;  3I55 F;  3NK6 A;  3RA6 A;  1W42 A;  1GO0 A;  1VQK F;  1KD1 H;  1K73 H;  3CMA F;  3ON1 A;  2FC3 A;  3CCQ F;  4BW0 B;  3CCU F;  3OBW A;  2KTU A;  2JNB A;  1YIJ F;  1Q86 H;  1KC8 H;  2VGM A;  3JCM M;  1Q81 H;  3LWR C;  1DT9 A;  3CME F;  1QVG F;  5G4U C;  2KTV A;  5GIP C;  2LBX A;  1W3E X;  1X7O A;  3FFM A;  4TZZ A;  3OW2 F;  3NVK E;  3CC4 F;  3PAF A;  1PXW A;  2QA4 F;  2OTL F;  3CPQ A;  5DCV A;  1VQ6 F;  1YJW F;  3CC2 F;  3CPW F;  4BY9 D;  5EO3 A;  3LWV C;  5G4V C;  2BO1 A;  3E1Y A;  1VQ7 F;  1YI2 F;  3VI6 A;  3CCJ F;  5GAN K;  2ALE A;  3CCM F;  2KG4 A;  1N8R H;  1M1K H;  5GAP K;  1VQL F;  3CCV F;  3G6E F;  3SIU A;  1W2B F;  4X3L A;  1YJN F;  2OZB A;  1KQS F;  1W41 A;  3N4Z A;  1M90 H;  1VQ4 F;  1VQO F;  1CN7 A;  2HVY D;  3PLA C;  5GIN C;  3CXC F;  1YJ9 F;  3G4S F;  3CC7 F;  5A2Q M;  3HAX D;  3GYQ A;  1GZ0 A;  3SIV A;  1RLG A;  1VQ5 F;  1W40 A;  3J7A R;  1GO1 A;  3J81 M;  3CD6 F;  3LFO A;  1S72 F;  1YIT F;  1CK2 A;  1QVF F;  3JAM M;  3MCA B;  1SDS A;  3CCE F;  3NK7 A;  3I56 F;  3RA5 A;  1IPA A;  1XBI A;  2I6D A;  3IR9 A;  1YHQ F;  3G71 F;  2VGN A;  1K9M H;  3CCR F;  5IT9 M;  3LWP C;  5EWR A;  1ZWZ A;  1VQP F;  1Q7Y H;  2LBW A;  3NVI B;  3CCS F;  4C4W C;  2QEX F;  2OHW A;  4X3M A;  3AGK A;  1NMU B;  3OBY A;  3V7Q A;  3J80 M;  2CZW A;  5FLX M;  1X52 A;  3CG6 A;  5FJ4 C;  3LWQ C;  4LCK A;  3O85 A;  3HJW C;  1T0K B;  2AIF A;  3VMF B;  3V7E A;  4NUT A;  1K8A H;  1VQ9 F;  1H7M A;  1VQ8 F; 
#chains in the Genus database with same CATH topology
 3N4Y A;  4G4Y A;  1PF5 A;  2ZVY A;  3JAR A;  3MQW A;  1X7P A;  3NMU C;  1NJI H;  4I55 A;  4C8I A;  3RYI B;  4EB6 B;  3D54 A;  3LWO C;  1QD9 A;  5BMV A;  2IG8 A;  1VQM F;  1E7K A;  1XV2 A;  2PMP A;  5CA0 B;  1W42 A;  3FD6 A;  3S0H A;  4B46 A;  1VQK F;  5JCO C;  1U40 A;  3WJR A;  3D01 A;  2OTM A;  3KJJ A;  3M84 A;  5JH7 B;  2JNB A;  5LYJ B;  2KGW A;  4O4H A;  3WGL A;  3JAT B;  1W59 A;  4ZI7 B;  1KC8 H;  2RHL A;  3K14 A;  2CSL A;  1DT9 A;  4M8I A;  1TVK B;  2RHO A;  4KWE A;  5MN5 A;  3CME F;  4LNU B;  3L7Q A;  4IIJ B;  1Z5W A;  1X7O A;  5CB4 A;  4O4I B;  5HP7 A;  3S02 A;  4U39 A;  4C82 A;  3OW2 F;  5AVM A;  4RQO A;  5KX5 B;  4I4T A;  3S0Y A;  2AMT A;  2QA4 F;  2HRU A;  4BT2 A;  5LP6 B;  4TUY A;  1U3L A;  5JVD B;  3CC2 F;  3CPW F;  1QAH A;  5EO3 A;  4C8E A;  3LWV C;  3GHZ A;  2CW4 A;  5LXT A;  2Z1F A;  3VI6 A;  5GAN K;  2ALE A;  4ZOL B;  3VYS C;  5IJ9 A;  5JQG B;  2VAM A;  4G4W A;  4O2B A;  1VQV A;  2UZH A;  3KHN A;  4X1Y A;  1W2B F;  4B5C A;  1H48 A;  3ESJ A;  1FFX A;  4YJ2 A;  3ZO8 A;  3QTY A;  3WGM A;  3FBA A;  3OON A;  3RYC B;  1VQ4 F;  3DDN A;  4I50 B;  2HVY D;  5GIN C;  1DBF A;  3G4S F;  3CC7 F;  5A2Q M;  2LBT A;  5J2U B;  3WJP A;  1VQ5 F;  1W40 A;  1SZQ A;  3RYI A;  3J81 M;  4BT7 A;  4EB6 A;  3E22 B;  5GON B;  5CA0 A;  1COM A;  3GTZ A;  3VYT C;  4G4Z A;  3D00 A;  1XBI A;  2I6D A;  1K9M H;  5JH7 A;  5IT9 M;  2CVL A;  5EWR A;  1Q7Y H;  1VQP F;  3JAT A;  4C8G A;  4ZI7 A;  1IV1 A;  2OHW A;  3Q8H A;  2RHJ A;  3AGK A;  1TVK A;  3CB2 A;  4YJ3 B;  3C8L A;  3JAS B;  2CZW A;  3JAW B;  4IIJ A;  4LNU A;  5EZY B;  1X52 A;  3CG6 A;  2ZAU A;  4LCK A;  1T0K B;  3HTN A;  1H47 A;  4BT6 A;  2HS0 A;  2HP0 A;  5LP6 A;  2CHS A;  3S03 A;  5EB0 A;  2LCA A;  3WXM B;  2Z1T A;  2G9I A;  3WGN A;  3CCL F;  3BYQ A;  2H8C A;  5EIB C;  3K12 A;  5GIO C;  4ZOL A;  4BVR A;  5JQG A;  1JJ2 F;  1W5A A;  3HKB B;  1KD1 H;  3CMA F;  3F0D A;  1KNJ A;  2P6Y A;  2R6R 1;  3OBW A;  3VOB A;  1Q86 H;  4BVS A;  2W8B C;  3RYC A;  4FFB B;  3N2G B;  2VGM A;  4I50 A;  1FSZ A;  2PHN A;  4HNA B;  1J7H A;  5HXZ A;  1GX1 A;  4TV8 A;  3HKC B;  5J2U A;  1W58 1;  2GVI A;  3TD5 A;  3FFM A;  3NVK E;  3VYU C;  3E22 A;  3PAF A;  3DC2 A;  5GON A;  5IJ0 B;  1YJW F;  3MBM A;  3IKE A;  1R1M A;  2HS3 A;  5EIB D;  4X1K B;  2I6R A;  2KG4 A;  2UYP A;  3UT5 B;  1M1K H;  5GAP K;  5MN4 A;  3G6E F;  2DT4 A;  4ZHQ B;  3SIU A;  4WBN B;  3B6N A;  4YJ3 A;  5EZY A;  3JAW A;  3N4Z A;  1M90 H;  4ERH A;  5C8Y B;  3PLA C;  3TD3 A;  2UYJ A;  3C9R A;  2B33 A;  3MDO A;  3VO8 A;  5ITZ B;  1FNK A;  1GO1 A;  3S06 A;  1W57 A;  3HKE B;  3U0O A;  3V3T A;  3JAM M;  5EAZ A;  1IV4 A;  3HKB A;  3M4S A;  3CCE F;  3N2K B;  5HP8 A;  1UI9 A;  3S0W A;  3G71 F;  5JCO A;  3CCR F;  5LOV B;  3HKD B;  3N2G A;  4FFB A;  5CA1 B;  3T80 A;  4C4W C;  3RYH B;  4HNA A;  1SA0 B;  2Z1U A;  3M1X A;  1NMU B;  1IV3 A;  3J80 M;  3HKC A;  3KJK A;  2HQS C;  3LWQ C;  3O85 A;  2FGY A;  3HJW C;  1CLI A;  1VK3 A;  4F6R B;  4NUT A;  1VQ9 F;  3F0E A;  5IJ0 A;  1RLU A;  4G4V A;  3WPW A;  4TV9 B;  4EI7 A;  3VTI C;  4X20 B;  4X1K A;  4ZHV A;  4U3J B;  4B45 A;  1UFY A;  3C9U A;  5LYJ A;  3UT5 A;  2Z1E A;  3JAK B;  3NK6 A;  4O4L B;  3RA6 A;  4ZHQ A;  1JFF B;  3ZOP A;  1GO0 A;  3RE3 A;  4WBN A;  3ELC A;  3VIU A;  5KMG B;  1K73 H;  4DXD A;  2FC3 A;  3CCQ F;  4BW0 B;  3CCU F;  4O4I A;  4R40 B;  2YYE A;  1Q81 H;  5C8Y A;  1TUB B;  3IMP A;  5KX5 A;  2CHT A;  3LWR C;  3KE1 A;  3WGK A;  1QVG F;  1ODE A;  2KTV A;  2LBX A;  5JVD A;  3P4E A;  1OFU A;  4TZZ A;  4PWT A;  4ZK7 A;  1VHA A;  3CC4 F;  3HKE A;  1PXW A;  3F0F A;  2EWC A;  2OTL F;  3CPQ A;  1RQ7 A;  2Q1X A;  5EB1 B;  3C9S A;  4BY9 D;  2F9Z C;  3JAL B;  3N2K A;  5G4V C;  3QUW A;  1Q8R A;  2BO1 A;  3E1Y A;  2N48 A;  3R0P A;  3HWU A;  2NMU A;  3CCM F;  2R75 1;  1N8R H;  5LOV A;  5CA1 A;  2ZOD A;  1W5E A;  2GLZ A;  3RYH A;  2UYN B;  3CYQ A;  1SA0 A;  2OZB A;  2H6L A;  1KQS F;  4O2B B;  1W55 A;  3VOA A;  1VQO F;  4F6R A;  1CN7 A;  4BT4 A;  1YJ9 F;  4YJ2 B;  5HY0 A;  5LA6 B;  3HAX D;  5HY4 A;  3GYQ A;  1GZ0 A;  4TV9 A;  1RLG A;  2RB9 A;  3J7A R;  2RHH A;  2VAW A;  5IYZ B;  1S72 F;  4U3J A;  3CD6 F;  3P10 A;  1Z5V A;  2BTU A;  3JAK A;  4O4L A;  3MCA B;  4O2A B;  4ZHY B;  1SDS A;  1JFF A;  3I56 F;  3IEQ A;  5EYP B;  1IPA A;  5KMG A;  2IQQ A;  1YHQ F;  3ZP7 A;  3KIZ A;  3JAS A;  5HWE A;  3FD5 A;  3LWP C;  3ZP4 A;  4DRX B;  3NVI B;  2LBW A;  1JD1 A;  4G88 A;  3MCQ A;  3CCS F;  1TUB A;  4XCQ A;  4C81 A;  2QEX F;  1XRG A;  5J2T B;  4X3M A;  1JY8 A;  4BT5 A;  3I3F A;  2ZOV A;  2QTP A;  5FJ4 C;  3RYF B;  3LDT A;  3V7E A;  1IV2 A;  3C9T A;  3I7T A;  2K1S A;  1K8A H;  3ERN A;  1VQ8 F;  2V9Y A;  2DYY A;  2BTQ B;  4E6E A;  2MQE A;  3E20 B;  3LME A;  1QU9 A;  2QI2 A;  3JAL A;  5B8F A;  1JN1 A;  2OTJ F;  3CYP B;  1Q82 H;  2WAL A;  1VQN F;  1RA4 A;  3I55 F;  2HP0 B;  3JVH A;  4EI8 A;  1XHO A;  4RHA A;  4BVT A;  2UYN A;  3P0Z A;  3ON1 A;  3K2X A;  3EOR A;  2KTU A;  4O4J B;  1YIJ F;  3VCZ A;  1YQN A;  2Q1Y A;  1ONI A;  3JCM M;  5FNV B;  2UYK A;  5G4U C;  5GIP C;  1W5B A;  1W3E X;  5LA6 A;  2YXZ A;  4X1I B;  4IHJ B;  5HY1 A;  5IYZ A;  4NWO B;  5LP6 C;  5DCV A;  4B62 A;  3QHD A;  1VQ6 F;  1U43 A;  4O2A A;  3IEW A;  3JAR B;  1T0A A;  2AIZ P;  2ZVZ A;  4TV8 B;  5EYP A;  4I55 B;  4NQ3 A;  5MN6 A;  1FNJ A;  2L26 A;  1VQ7 F;  2HP3 A;  1YI2 F;  3CCJ F;  4G4X A;  3K0T A;  3IKF A;  5BMV B;  4DRX A;  1VQL F;  2VXY A;  3CCV F;  4BT3 A;  4X3L A;  1YJN F;  5J2T A;  5ITZ A;  3RYF A;  1W5F A;  1W41 A;  2GZL A;  4O4H B;  4BVQ A;  2HX0 A;  1KNK A;  3WGJ A;  3CXC F;  2H8E A;  1VH8 A;  4EI9 A;  5CB4 B;  2VAP A;  3SIV A;  2IAF A;  2CWJ A;  3LFO A;  4I4T B;  3WJQ A;  1YIT F;  1CK2 A;  1QVF F;  1OAP A;  3F0G A;  2BTO A;  4TUY B;  3HKD A;  3NK7 A;  3TD4 A;  3RA5 A;  1RQ2 A;  5LXT B;  1NQ3 A;  3IR9 A;  2HRY A;  2HS4 A;  2VGN A;  5IJ9 B;  1YGY A;  4O4J A;  1ZWZ A;  3WPX A;  2Z01 A;  4X1Y B;  5HXU A;  5FNV A;  3FPI A;  1FFX B;  1X25 A;  3V4D A;  3OBY A;  3V7Q A;  5FLX M;  3F6M A;  4X1I A;  4IHJ A;  2ZF8 A;  2AIF A;  4X20 A;  3VMF B;  4ZHW A;  5HY2 A;  3LYB A;  1H7M A;  1U3P A; 
#chains in the Genus database with same CATH homology
 3N4Y A;  3E20 B;  1X7P A;  2QI2 A;  3WXM B;  1NJI H;  3NMU C;  4EI7 A;  2OTJ F;  3CCL F;  1Q82 H;  2WAL A;  1VQN F;  3LWO C;  5GIO C;  4BVR A;  1VQM F;  1RA4 A;  1JJ2 F;  1E7K A;  3I55 F;  3NK6 A;  3RA6 A;  4EI8 A;  1W42 A;  1GO0 A;  4BVT A;  1VQK F;  1KD1 H;  1K73 H;  3CMA F;  3ON1 A;  2FC3 A;  3CCQ F;  4BW0 B;  3CCU F;  3OBW A;  2KTU A;  2JNB A;  1YIJ F;  1Q86 H;  4BVS A;  1KC8 H;  2VGM A;  3JCM M;  1Q81 H;  3LWR C;  1DT9 A;  3CME F;  1QVG F;  5G4U C;  2KTV A;  5GIP C;  2LBX A;  5HXZ A;  1W3E X;  1X7O A;  3FFM A;  5HY1 A;  4TZZ A;  3OW2 F;  3NVK E;  3CC4 F;  3PAF A;  1PXW A;  2QA4 F;  2OTL F;  3CPQ A;  5DCV A;  1VQ6 F;  1YJW F;  3CC2 F;  3CPW F;  4BY9 D;  5EO3 A;  2F9Z C;  4NQ3 A;  3LWV C;  5G4V C;  2BO1 A;  3E1Y A;  1VQ7 F;  1YI2 F;  3VI6 A;  3CCJ F;  5GAN K;  2ALE A;  3CCM F;  2KG4 A;  1N8R H;  1M1K H;  5GAP K;  1VQL F;  3CCV F;  3G6E F;  3SIU A;  1W2B F;  4X3L A;  1YJN F;  2GLZ A;  2OZB A;  1KQS F;  1W41 A;  3N4Z A;  1M90 H;  1VQ4 F;  1VQO F;  4BVQ A;  1CN7 A;  2HVY D;  3PLA C;  5GIN C;  3CXC F;  1YJ9 F;  3G4S F;  5HY0 A;  3CC7 F;  5A2Q M;  3HAX D;  5HY4 A;  4EI9 A;  3GYQ A;  1GZ0 A;  3SIV A;  1RLG A;  1VQ5 F;  1W40 A;  3J7A R;  1GO1 A;  3J81 M;  3CD6 F;  3LFO A;  1S72 F;  1YIT F;  1CK2 A;  1QVF F;  3V3T A;  3JAM M;  3MCA B;  1SDS A;  3CCE F;  3NK7 A;  3I56 F;  3RA5 A;  3D00 A;  1IPA A;  1XBI A;  2I6D A;  3IR9 A;  1YHQ F;  3G71 F;  2VGN A;  5HWE A;  1K9M H;  3CCR F;  5IT9 M;  3LWP C;  5EWR A;  1ZWZ A;  1VQP F;  1Q7Y H;  2LBW A;  3NVI B;  3CCS F;  4C4W C;  4XCQ A;  2QEX F;  2OHW A;  5HXU A;  4X3M A;  3AGK A;  1NMU B;  3OBY A;  3V7Q A;  3J80 M;  2CZW A;  5FLX M;  1X52 A;  3CG6 A;  5FJ4 C;  3LWQ C;  4LCK A;  3O85 A;  2FGY A;  1T0K B;  2AIF A;  3VMF B;  3HJW C;  3V7E A;  5HY2 A;  4NUT A;  1K8A H;  1VQ9 F;  1H7M A;  1VQ8 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...