5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
2RHOA 3WGKA 4XCQA 3JARB 4ZOLA 5LXTB 4X20B 4X1IB 5LYJB 5JCOA 3JALA 3UT5A 2BTQB 4WBNB 5KX5B 3HKDA 4O2AA 5LOVB 3WGNA 3VPAA 4TV9B 3N2KB 5MN4A 1FSZA 4ZHQB 3JAKB 5CA1A 3VO8A 3HKEB 1W5BA 5FNVA 4O4LA 2XKBA 4TV8B 4B45A 4DRXB 4HNAB 2VAPA 5EZYB 4M8IA 4IHJB 3HKBB 5KMGB 4ZI7B 2RHLA 5IJ0A 3C8LA 4X1KB 5J2UB 5J2TB 1JFFA 3M8KA 3N2GA 3CB2A 4O2BA 5BMVB 5CB4B 4U39A 3VOAA 3RB8A 4ZOLB 5LP6B 2RHJA 4YJ3A 2BTQA 4EB6A 4WBNA 3HKDB 4O2AB 2R6R1 2VXYA 4YJ2A 4O4HA 3ZBPA 4I50B 4I55B 5GONA 4O4IB 3RYHA 3RYFA 5M7EA 4IIJA 5EIBC 3E22A 5MN5A 5JQGB 3JATB 4LNUB 1SA0A 1TUBA 5CA0B 3R4VA 4IHJA 3JASB 5ITZB 3RYIB 5J2TA 1FFXB 4F6RB 1JFFB 4E6EA 3N2GB 5EYPB 4TUYA 4O4LB 4I4TB 4X1YB 5LA6A 4X20A 3JARA 3ZBQA 5IJ0B 3WGLA 2R751 1W581 1W5EA 3HKCB 4FFBB 2GVIA 5CB4A 2VAMA 4ZHQA 4O4JA 1W59A 3VO9A 5LP6A 5JH7B 3RYCA 1Z5VA 5FNVB 4U3JA 3JALB 3UT5B 5LOVA 5JVDA 5LXTA 3VOBA 5LYJA 4O4HB 2VAWA 3WGMA 3N2KA 5GONB 4TV9A 5KMGA 1Z5WA 4DRXA 3JAKA 5EZYA 5CA1B 5EYPA 3HKEA 3V3TA 4O2BB 5BMVA 4X1YA 2RHHA 3JAWA 5IJ9A 5IYZB 1TUBB 5CA0A 2Q1XA 4X1IA 1FFXA 5C8YA 3HKBA 4EI8A 1W5AA 3RYHB 4X1KA 5J2UA 4DXDA 4O4JB 4I55A 2Q1YA 5LA6B 1TVKB 3E22B 1RQ7A 1W5FA 5JVDB 4YJ3B 1SA0B 4EB6B 4EI9A 3JATA 4I50A 2BTOA 5KX5A 5MN6A 5LP6C 4EI7A 4TV8A 5ITZA 3RYIA 4B46A 3WGJA 4IIJB 3JASA 5JH7A 3RYCB 1RLUA 3RYFB 5EIBD 2XKAA 4ZI7A 4U3JB 4F6RA 3ZIDA 5JQGA 3JAWB 5IJ9B 5IYZA 1OFUA 4LNUA 5JCOC 5C8YB 4HNAA 1RQ2A 4KWEA 4YJ2B 4I4TA 3HKCA 4FFBA 1TVKA 4TUYB 4O4IA 3M89A
chains in the Genus database with same CATH superfamily
1ZR2A 2QORA 5DX8A 5CP8A 3EZFA 5L53A 1I2DA 5LZ2A 4H7JA 4HZGA 1XEWX 1FYXA 1RXIA 5EZSA 3F5MA 1NMYA 1XUQA 3TIIA 3SC2B 3GTZA 2EWMA 3EA0A 2I6RA 2ASVA 3WYAA 5JCZA 4OHWA 3G71F 2AG1A 3RUPA 2H4XA 3W5CA 4S1TA 2AR7A 4BV2A 2DEUA 3DA8A 3OZIA 4C1NA 1YASA 2N48A 4R3UC 3GFTA 1VIDA 1JMVA 4QDJA 5FBRB 3T5GA 1SBIA 5BY1A 3ZMSA 1YONA 1CY7A 2W2PA 4IJ6A 2JARA 1XD9A 5A9RA 4QIHA 3AF2A 5JZVA 5BMVB 3MDOA 2WM2A 1E64A 1LDMA 1PVVA 3DEYX 3LO8A 3PC3A 4M0UA 4WKNA 3Q4GA 3P2JA 2DHQA 4K03A 1R66A 1Z6PA 3EHDA 3JYOA 5FL7A 3RTAA 1HNZO 4A9AA 5HVNA 4P8RA 4W63A 1KC8W 3WRXC 5B3AA 4DLXA 1XF9A 2FP3A 3D2CA 1N2CE 1NXPA 1Z07A 4HP8A 1EZZA 1PWXA 4RZIA 3VZPA 1AU9A 4BNKA 2WDPA 4CL8A 4ITUA 3K6KA 4ZMBA 2J0EA 1W2BU 3O4IA 4HFRA 5AJTA 4KN5A 2QZZA 5DBOA 5FO0A 1WB9A 4L7QA 1TM3E 4CT0A 2NV2B 2ODNA 2CNLA 2P3SA 4H17A 1OAPA 2YASA 3UGQA 4EHKA 2YV2A 3GJ7A 4UW9A 3IIJA 3PRYA 1N8RW 3G1WA 3Q4HA 4JP3A 2OA0A 1YZ3A 2I1LA 4JQYA 4ALMA 1LI5A 4HDSA 3S1LA 5BRJA 4A8PA 4TYNA 4NJEA 1MVNA 1II8B 1QM5A 2Q67A 1M2VB 4B3XA 3TCKA 3UKJA 1YUNA 3F7YC 3DPIA 2DR2A 4GG1A 2D2XA 4FVMA 2BGKA 4JS0A 4EPRA 1UANA 3SZUA 3RYCA 3ZEIA 3AP1A 2JGEA 1T24A 1OLXB 1VG8A 2DFTA 1U2PA 5GJBA 4MVWA 2AF3C 1NBMD 1OYOA 2JEXA 4DK1A 3IVAA 3DXXA 3VH1A 2NPIA 3EVKA 2ZSFA 1NOIA 3GLVA 3OUUA 1TXGA 2A0FA 3R9XB 1HDRA 4CXMA 2P6OA 3W2IA 5EL0A 1R8JA 2VYCA 3UAYA 1A97A 3CVWA 5LP1A 3WTBA 5KHOC 3EXHC 2NTJA 4NAVA 4I46A 4URXR 1WZ2A 2COUA 4CF7A 1HLPA 2E9SA 4B74A 1YC2A 1M6VB 1YCDA 2QY9A 2QRUA 1TQ6A 1GZ4A 2XB6A 2C95A 2X3UA 4G4VA 3EGVA 4RVFA 4UHEA 3FTDA 3VMFA 4WF9V 4ESVA 1YB2A 4Z1MG 2JIZA 2DYSB 3H9VA 1XMIA 1E9FA 2HJ9A 3BHNA 4D9MA 4IGGA 1Q0UA 1DQNA 1JJVA 4TT3G 5EO3A 2XYHA 4MYSA 3H5VA 1NZ6A 2HUPA 1C2YA 2PR2A 4QTTB 3FKSG 2P79A 4ZC1A 3NC0C 4B4VA 2IG8A 2FPUA 4YV1A 3OQBA 1UC9A 1KJYA 4GKVA 4YONB 1KS2A 4W1QA 1WMAA 2OZBA 1G18A 5DM6V 1QFSA 5FB3A 1UMBB 2JIBA 3D8BA 5TARA 4DBZA 4DPKA 1DKUA 2N42A 4GQIA 4NSNA 1KNXA 3K14A 1DAIA 5HIJA 1QHEA 4YRRA 3V1NA 2ZI9A 3VVLA 2RMKA 3NI2A 5BSFA 3T9FA 2XTJA 1E96A 1P9WA 1ZNZA 3SZ3A 2P91A 1A04A 2XNKA 3KPJA 4J1TA 1RAFA 3O2JA 4JTAB 3OEEG 2XF2A 4JOSA 1BMFG 3ESBA 4FT2A 5CVDA 3PYXA 4ASUD 1QKKA 2KM1A 3DZDA 4ZAGA 1MABB 4B3JA 5IVKA 5MN4A 4RHCA 4I8DA 1GTOA 1XRMA 1OKKA 2QTGA 3BB3A 3D2BA 4I08A 1X13A 3RGWS 3UB2A 3A8TA 3Q0IA 4LXQA 2P9HA 3PUWA 4DCSA 5FNVA 2O52A 1E94E 2O4CA 3GT4A 1Q1NA 1XRQA 4IQFA 1V9LA 2ACWA 1QWOA 3RCBA 2R6ZA 3GAZA 4K86A 4QDOA 5H2FZ 1DCKA 2P65A 2QL6A 4IUDS 4E2XA 3ZVMA 3FWYA 1UPXA 2WSSD 2HCJB 4ZTBA 3AEUB 4CTKA 4XD7D 2PNJA 2DLDA 1MQ8B 3RS2A 4F8JA 1IHOA 2ONKA 4HLDA 4LW8A 4UBIA 1A69A 3ABIA 3MCAB 4ZOLB 1Y8QB 5CT8A 3IDFA 3R23A 2IXAA 5CR9A 1I3NA 1TQ4A 2D4HA 2QM8A 2J0UA 2W22A 2P5UA 2QTWB 4KOAA 4LMAA 5TNXA 4PO8A 3OE7G 4YAJA 1XKTA 1JQ5A 5I7HA 1UBGA 2DUJA 1P0QA 1Q1QA 2A9OA 2FVYA 1KORA 2V98A 3QXSA 3DMFA 4KVZA 4S1WA 3SMQA 5M7EA 5LBQA 5IBRA 4ME6A 1IJBA 2J59A 2JLZA 5FORA 2C2XA 1VG0B 1IPEA 1UWLA 4K9NA 4LXIA 1ECBA 3S03A 4MIOA 3SEAA 4QJ3A 2CUTA 1R5JA 3WYBA 4I3GA 4Q7EA 3BFXA 1VQLV 5C1IA 3ELCA 3EG5A 4G86A 1FXKC 2CGOA 1VLJA 1Y3AA 3ZE6A 1DFGA 3F0EA 1E4EB 1XELA 2K4MA 2QRNA 4BRZA 2L69A 5CBFA 5IUKC 4RHFA 5B2ZA 4MTXA 1ISHA 1HDCA 1XC7A 2CLOB 3HCFA 3ASOB 5FL3A 3EIEA 4TX1A 2G25A 4FMTA 3JVDA 3NHJA 4ZYTA 1BDBA 1FNBA 1Q19A 4NBWA 1K5PA 3FRHA 4F46A 2C31A 1LV7A 2ONJA 1L5FA 1UBRS 5ALNA 3ZEDA 4BBPA 2X3YA 4G41A 2I4OA 4HX5A 5CIYA 3KR1A 1U4OA 4C3OB 4J7UA 1EI9A 2BSKB 2PMKA 3OBBA 4WLFA 2R1TA 3CCQV 4FXPA 1EXWA 3AEIA 2OKGA 3GBVA 5G0WA 3UATA 3M9XA 3BABA 1OT5A 4JUFA 5C2JB 2CNKA 3F73A 4IXWA 1CQZA 3A6HA 1HKUA 3SIRA 3ZHYA 1HMPA 1CB7A 2PSFA 1BX1A 5IJXA 1G5HA 3FD5A 2EV9A 3QEKA 4W5HA 4PAGA 2A88A 1E2NA 1U4SA 5FUYA 1CR6A 3HJRA 1FUEA 1G5RA 4IXMA 1HFKA 3AI7A 3I3OA 4TWIA 3SHFA 3W05A 4B3CA 5SYMA 2IYAA 4DREA 3MQ4A 1VLQA 4RTQA 3H11A 3PR2B 1JTFA 2ZT6A 3PZBA 3OTWA 3TLGA 3IAFA 1OGJA 3WL3A 4ZJUA 2V45A 3U6BA 1VMIA 3BWDD 3TEJA 3NU1A 4YT4A 5GADl 1OROA 1HYBA 4FLYA 1CY2A 4EI9A 3EXHB 3IHKA 2XA1A 4I50A 1EZ1A 1KMNA 1SIBE 2ZYTX 1SWVA 3DOJA 3GBPA 4YT5A 2WWHA 1QU3A 2ZS9A 3M49A 3GB7C 3SG0A 1FCJA 3RQSA 1NMSA 3EPJA 1GNRA 4WJKB 2EGHA 3R0QA 1KC8H 2CLHB 3O8OA 4NG4A 4NYJQ 5B5SA 3AOEC 1VE7A 1SKMA 3RD5A 4DR5B 1J21A 1OIWA 4ZK2A 1XXHA 1WS6A 4CG1A 3UT0A 3PBKA 4C7UA 4GOOD 4N65A 4BMYA 4WLVA 4LJ4A 3BICA 3Q98A 1Q7CA 2YRWA 4Q4JB 4YALA 4D0LB 2F55A 1MAWA 2F6RA 3D7LA 5C8DA 2ZM6O 3G7NA 4MQBA 5DWVA 2GI4A 2XHZA 3K20A 3CZPA 3W2HA 4AI8A 2QS9A 7ABPA 3LGXA 4ZHQB 2BHLA 4PGAA 2RE8A 5J9FA 2R96A 1SJ9A 1YD7A 1XQVA 2FKXA 5B5EZ 1U4NA 3LYAA 3A9UA 1AN0A 3DHWC 1EG7A 5J63A 4L8YA 3IT2A 1QR8A 3F78A 4NVPA 2Q5JA 2BZSA 1H85A 4RQFA 2WLLB 2AFIA 2V7EA 4ERHA 1XCJA 2A58A 2P2DA 3SLRA 2RGRA 2UVPA 3GWGA 4RMNA 2PLAA 3IB3A 3LHKA 4ZI3A 3W6ZA 1P0FA 4BRSA 2XITA 4U7HA 1DCTA 2AJTA 4BO8A 2NQTA 3BIXA 5B7GA 1HE1C 3WWDA 1MB2A 1YT5A 1QUFA 5HFLA 1QIKA 5E9JA 4YBZA 1EIZA 2FW1A 1IZ3A 1TF5A 1UQUA 3K35A 3E03A 3NBFA 4RHTA 5E38A 2F3QA 4X3LA 3EWNA 3F5DA 3TCXB 1IHXA 4DYVA 2ZB8A 5IKXA 1CRQA 2DWQA 3AR6A 4UAVA 1FTQA 4Q7KA 4MPJA 2BHNA 3ZXXA 1BKSB 1KO5A 1R3UA 4AJ2A 4EB0A 2Q7GA 3U4MA 5IDYA 2X1VA 4ZA2A 1TT5A 3OOEA 3MQFA 4KITB 1DC6A 1PT7A 1XTKA 2HNAA 2BCJQ 4Y6LA 2JLYA 2HHHO 1VQNF 2CKDA 4EBBA 2H6LA 4N21A 2J3IA 4BT7A 3CN9A 2VF7A 1AKNA 4N82A 3QVNA 3KKEA 4PN3A 2I67A 4QOHA 4OQEA 1XQ9A 2PH3A 2R66A 3AYZB 3FZGA 3WQSB 4TYPA 2XAJA 3I1FA 1XZEA 2D06A 2JCYA 3F96A 4K40A 4X85A 2AR0A 3G79A 4YP7A 4UUJC 1D8TA 4B40A 3AK3A 3TVDA 1KGDA 5JSKA 4QWWA 2SCUA 3DW3X 3RHFA 2AW3A 3TZQA 1HUQA 3IEWA 4YHHO 1V5IA 5JSZB 1FY2A 3W6UA 2UZ4A 1DJQA 3KZOA 4NE7A 4JOBA 3V1TC 4GM0A 4B75A 4PX2A 4Q24A 5D84A 2Q7EA 1CFZA 4YWHA 3OTIA 2EIMC 1XWWA 2F67A 2FX2A 2OY0A 3AJAA 4L1KA 4ENSA 2R4UA 5KS2A 3CX8A 4JI3B 1L5ZA 2YRXA 3HJBA 1AXGA 4C4RA 4W5OA 3SIPA 1QH0A 3AUTA 1NBMG 3O85A 3H75A 2KQXA 3TKAA 1QNLA 3MJFA 3PFNA 4H0NA 4R2IA 5FPHA 4K26A 4GPTA 2JL1A 3AFMA 1KI4A 4Z1MD 4OUDB 2GYYA 1JB1A 3FX7A 1A9QA 4D42A 1NVTA 2J7PD 2V59A 3KSBC 3JQEA 3AG3C 2JASA 2E75B 2ZDIA 1GVNB 3MJVA 1U98A 3QPBA 1AQUA 1QRAA 2WFMA 4JB8A 4JL8A 3GARA 2FFBA 3REGA 5F64A 1AKRA 3TUJC 3PPXA 4NC9A 3ULKA 1P4JA 5JIBA 1OLSB 1CRPA 3VSEA 2Q9AA 3N0RA 4BN0A 2ZD9A 2QVXX 2H59A 4WSOA 4Z51A 3I30X 3AIOA 4HWPA 4NFYA 2IFTA 2Y1GA 5C8YB 4DANA 3NNNA 3DKVA 4FEEA 4P5DA 3T0IA 2VYVD 4I4TA 1XZDA 4H7HA 4BKUA 4FOLA 4K9LA 3UN1A 2MSKA 5AHRA 1ZOIA 5KWIA 3L41A 4Q93A 3GA0A 4AKGA 1EUCB 2OB2A 5ESRA 1SQVH 2IQQA 4Q0MA 5F12A 5L45A 1OGIA 2I5PO 1L5SA 3JAMM 4B47A 1QU9A 1A2BA 4JEIA 4NYIQ 1TA4A 3E8XA 4Q6WA 4QFDA 4AO6A 1T0IA 2VNIA 3CWCA 4EF6A 2W6PA 3UJNA 1T9BA 5F5LA 4I5IA 3G2JA 4NARA 3MHHC 2YHAA 3KK0A 1X9HA 3V4PB 2VWKA 3OIUA 2KBEA 2QD2A 2H08A 4NZZA 2R25B 3PFBA 3FF4A 1EM8B 4MS4B 1G3IA 1AMOA 3QEMA 3RHSA 4DY4A 4HQ6A 4KYVA 1P72A 3H8SA 1GMGA 1YR2A 4YO8A 2O3SA 3BL5A 3F1LA 4IKPA 1VBNA 5TQ2A 5TMBA 1CY6A 4KXMA 5DSXA 4INZA 1B4DA 3KJKA 1X74A 3CUSA 4YROA 4WHMA 4QELA 1PX2A 2KG7B 3BPZA 1CULC 2XDQB 3B36A 3D59A 4BV8A 1F06A 2ZJ8A 1IXKA 4UVAA 3QUTA 4WAUA 2ZIZA 3DDNA 5CXXA 4EFMA 3OPQA 4FDMA 4BNIA 3LQ1A 4A0QA 5SZHB 1YIAA 3DYIA 4JYAB 3K8ZA 1XRPA 2Q0AA 1LLDA 3QUQA 3RS7A 1V6CA 2NO6A 3BDAA 1XZGA 2Z6UA 3MTIA 3UGTA 3I7TA 4JU9A 4WNIA 4DG5A 1QTRA 1GFIA 1PK8A 1XBLA 3RE3A 1VI6A 2CZCA 3ZMUA 2JAPA 3NATA 1W30A 3R4VA 4QXQA 3RUHA 3U3RA 5LD2C 3WNVA 1AUPA 3KVOA 5ILOA 2EZUA 2YNMC 1NAHA 1RI4A 3DBHB 3O1HB 4YS6A 4YUAA 5U9CA 3MBOA 1Y74B 5I9BA 5I48A 3APOA 3QKWA 1X7HA 1CC1S 2R8PA 5ALZA 3KQUA 4BATA 1OU0A 4YRFA 2IHNA 3SGIA 1MX5A 3MTJA 2CL7X 5G0VA 3FYUB 5DIFA 3QBTA 1SKBA 2XB2A 4O2BF 2J85A 1T9AA 2XRZA 4JJ4A 5FPSA 3CR7A 1UK9A 1JDJA 1HFEL 3CWZA 3ZLVA 1GCGA 4F5DA 2O2HA 3JWPA 3VKWA 3A4MA 3HZHA 4KL1A 1ZO8A 2ZRQA 3O26A 1QP4A 5FWXB 2Y1XA 1Q6ZA 1AA6A 3K9CA 3TYXA 2WU4A 3FMVA 4WRRA 5JAPA 5EKSA 3ONNA 2C61A 3DE3X 2OV2A 4FE3A 3FCUB 4NCIA 5L3ZA 5CM8B 4RANA 3ZH9B 5K3EA 3V7EA 1QHNA 2IAFA 2JEZA 3QW4B 3B2EE 1NNUA 3A3PA 2PT6A 1T4MA 3A25A 3E23A 4OB8A 4DW0A 2YJ4A 3RF6A 3SQLA 2Z0AA 4H6VA 2W6IG 3IS3A 1U9CA 3LDTA 2OHIA 3K53A 3KKPA 2PIAA 3Q6NA 4WZZA 2FDXA 3M9LA 2VF2A 3OE1A 1KD1W 1YB5A 2FPSA 2W6OA 5GV8A 1XEQA 2LD4A 5B53A 1KRWA 4J9UE 3WVNA 4JBNA 2ICAA 2WNHA 3H2YA 1UC5B 4X1KA 1IJFA 1Y1LA 3CH5A 3QKIA 3P5BA 4F4JA 3AVUA 1ZSYA 5IT9N 4RAQA 4IGAA 3OX3A 4QXRA 4UNIA 2ODAA 3C6MA 3SJBA 2YMLA 5DISB 2VLIA 3DMDA 3N74A 3HVIA 1Z0SA 2ZWAA 1SB8A 3LVRE 3OUTA 1Z0FA 2AEMA 2H1VA 2XOKA 1QBGA 2IWHA 2FG5A 4U2EA 3I2HA 1NBWB 2GYVA 1DGSA 3BD9A 4DE5A 2FPLA 4ZU1X 5LP6F 3K70D 2OV8A 2Q8QA 2YICA 1P9NA 3I42A 3WIUA 2ZYHA 1KDTA 3E2EA 8AT1A 2CK3A 1XLVA 2DWUA 1SHLA 2JLBA 4LBEC 4GKBA 1TECE 3K57A 1UFRA 3CCLF 4OL0A 3VYRB 4QYIA 1FMCA 1KO4A 4B4DA 1HBJA 3BAFA 4BB9A 1F6DA 1PR9A 4ZYUA 1W57A 4JB0A 1SC9A 4MNTA 4D81A 1H3FA 1A7AA 2D0PB 3M33A 3QFFA 3MJCA 3EEOA 3DWFA 4E1BA 3D3WA 2A4MA 2Y0IA 2QMUA 4D9JA 5LMZA 3H11B 2YVLA 4ASUG 3GHZA 1ZH0A 4MLPA 2RB4A 1LBIA 5FOQA 5GIPE 4MVMA 2PRZA 4JAVC 3KKNA 1KI8A 2A0WA 3DM5A 4B85A 4PCLA 4LBYA 4EGJA 1KGSA 2QUHA 5ALRA 4HDSB 1WPRA 2IQ5A 5C1PA 3CMCO 1JT9A 3GI1A 3KZMA 4BXOB 4OHUA 4GPD1 3TQCA 1N33O 1HYGA 2RHCA 4A27A 5BPHA 2M6LA 5KYXB 9MHTA 4Z2WA 3I8XA 1L9KA 1Z7EA 1F3OA 2RDMA 4MVJD 1H2NA 4NXNO 3LCVB 2UXDB 1BU8A 2WICA 2WLHA 1X7GA 2YV1A 5BWNA 4PV7A 3Q10A 5C4IA 2C2HA 3DZKA 2XNDA 2WKSA 4XSGA 4ZQEA 4S05A 1R8YA 1S2IA 3OPYI 1JG7A 4OYYA 2YVKA 3RFCA 3CJQA 1MC4A 2HFJA 4GRDA 3VDQA 2CF5A 3HNRA 3H6KA 2PVPA 1PM9A 1F4MA 3Q0TA 1E58A 2ZINA 4JJIA 3RS5A 2EKQA 4UCXA 4IIYA 3UWDA 4BLWA 3X2EA 1BFUA 6REQA 5L3VA 3VR5A 2ZR2A 3QKRA 4JX9A 3OBYA 1LSUA 4EHAA 2X5OA 2YV3A 2W6CX 1QK4A 2CVFA 1NF2A 4L0MA 3K30A 4R81A 5BSVA 3RYIB 1VPVA 2CBZA 3EDYA 1H1LA 2X1LA 3A10A 5FFMA 2ZF8A 3R5TA 1TRKA 1IZ8A 5BVHB 3L06A 4XW2A 3ZOPA 1KYIA 4PHHA 2RGAA 1XMVA 1RXYA 4OLHA 3GIDA 4QUKA 1LW6E 4ZZ1A 5KSYA 1SQFA 3O1IC 1QH1B 1TA9A 5JADA 3HCDA 3VDMA 1U8FO 2PBZA 3PSHA 4KGDA 1O0SA 4NTZA 1XNQB 1P7GA 3UAZA 4JJ8A 5H9CA 4RIHA 3QGMA 1DOZA 1MC5A 3N7UA 1AXEA 4RD0A 2OSBA 4LRWA 1IVNA 1XP8A 5IVIA 2Y69C 3L46A 5ETJA 2RHMA 4HATA 4C0XA 2JI9A 3ZGOA 1Z68A 2UUAO 1R4MA 3TW4A 1PGJA 2Y0PA 1J8MF 4AO8A 4QNHB 4MVQA 1AG9A 1LSJA 2XNDG 3ZWDA 4NCHA 4GKAA 1GG9A 1BCCH 4X7RA 4AN4A 3U4HA 1HNZB 2ZVYA 2YXBA 5K3AA 1Z8FA 3G0BA 4E70A 3H5TA 3B6ZA 3Q5DA 4DLYA 3GEIA 2WZDA 1IJEA 3SKYA 2IOHA 2JIQA 3LLUA 3OJCA 5EC1C 4I55A 3ORRA 2XMGA 5DXJA 4E2FA 3EUEA 4E2LA 1NJ8A 3BAZA 2FR1A 4Q1CA 4TKMA 3D3KA 2NVUA 3W6PA 4EPVA 4Z2AA 1DXYA 4LOHA 1B00A 4PGGA 5KX5A 3DMYA 3DP7A 1CVRA 3O94A 4QDKA 4F3RA 3LPLA 3R4CA 5K5EA 3PJGA 2XVXA 1J9GA 1VBMA 2GX6A 5JZBA 2JBHA 2NADA 4IHQA 4LMPA 1YRLA 4FFKA 2ZGVA 4XWTA 4BV9A 1KJ9A 2O3JA 2RGCA 2XBUA 3HCNA 4DARA 2CV1A 1H93A 1SU7A 2HBZA 5EWLB 3S7TA 3SSOA 2JKVA 1EA5A 2VOJA 3EXG2 2OGZA 5KYKA 3LZCA 5JYDA 1SVMA 1RAIA 4IJWA 4RDCA 3BE6A 1MORA 4WY5A 1EB8A 4M9RA 3R7WB 1C50A 3LWNA 4PZLA 2F43A 1QR9A 4FFBA 3DCNA 3HC7A 3TDMA 3V4DA 2I34A 4WCDA 1CYEA 4KLAA 4ENUA 5I7WA 3KKKA 1LLFA 5D5PA 1GO1A 2WD8A 3G5AA 3TDKA 4CYMA 5IASA 3ZZUA 3U13A 5HP7A 2IF0A 2OAP1 3ASZA 3CURA 4OI1A 2BTQB 3L79A 2R8XA 5BOSB 5BSEA 2C4WA 1S2OA 2ONZA 2V1XA 3QXGA 3COWA 4UMDA 1YJCA 5IAEA 3ZXYA 4F92B 5EUMA 3ER9A 1XZQA 4DV4O 1RMTA 3BSSA 1XZCA 3EIOA 4DDMA 3DT9A 5IMBA 2V58A 4WFIA 3DO8A 2XKBA 1P7PA 2YRFA 1R0LA 2EJCA 2B34A 4HDKB 2C7RA 3LZ6A 4F1JA 4ZEVA 3H0EA 2HVJC 5AW2A 1Q7YW 2Z8ZA 4OQZA 4P7JA 3GVHA 1UBUS 4IY1A 2W2LA 4U39A 5G1PA 5KJCA 4X9XA 1WTAA 4KN9S 2O9JA 4M1OA 1FLNA 5LCXA 2GXQA 1OASA 2OORC 3LDEA 1U0NA 2DOKA 4HQFA 4M7WA 4X54A 1KE1A 2B6HA 3ZBPA 2IZ7A 5CDSA 5KA6A 3CLHA 1K2WA 3AK4A 2ERXA 5FQNA 2HXGA 3MXOA 2QX7A 4BX9A 5REQB 1AK2A 2MK3A 3TTWA 1G5QA 1G2IA 4X1OA 4WZAE 4AKTA 1D0VA 1JBQA 1R9GA 1U2EA 2QD4A 3N53A 3NK7A 5ICEA 2GDSA 2LP4Y 2FG7C 4AS3A 2QHXA 1SETA 2ZLBA 2QM7A 3O4JA 5F51A 1Y8RB 5FBLB 3ZUPA 1GITA 1LBSA 4OMDA 3OEEA 4JROA 1JFFB 3YASA 2YIDA 3EC1A 1VRCA 3KE8A 2LBPA 3KS9A 3RS0A 4C7VA 2HIGA 3CW9A 5EN4A 1IIBA 2E2WA 4TLDA 2V1UA 2FEXA 2QVCA 2YZGA 5EQFA 5EXXA 1ONIA 4PAWA 1JTVA 2AOUB 2OTJV 1U6KA 2Y4OA 4G1EB 4WCFB 3LWDA 1XQ8A 2DQSA 4IMRA 4UVBA 3UA4A 3RVPA 4BT3A 3UTCA 2SHKA 3HRKA 2IGTA 2FUG6 4GQBA 3L1KA 2Y1WA 2ZSDA 4ZVRA 3TRIA 4F9FA 4JJKA 4PYJA 4ZK6A 5BSKA 4P32A 5J2UF 2JFHA 3R66A 3MMSA 5P21A 5FD8A 2X0EA 3ABKB 5AVWA 1EAYA 4GOMD 1H9BA 1PR0A 3HA2A 4PO3X 4PX3A 4CHGA 2WWVD 2BWJA 1OIVA 1W42A 3O5AA 3RS4A 1YZKA 1CUYA 1O9GA 2V3WA 2XRYA 2OZLB 1X7PA 3MGCA 2PIDA 3R5FA 1PW5A 4GLOA 1C1DA 5CVVA 4QGSA 3DEKA 1E1LA 1A9TA 2O07A 3A4YA 4OA8A 2GBIA 4EA7A 3TX2A 1NP7A 4UTZA 3GGCA 5KIAA 3TZKA 4G0VA 4F2DA 3NR2A 2VUUA 4H7DA 4QGFA 4PF1A 4ARBA 1STOA 3BCUA 2V0NA 3RVLA 4R1PA 3R7FA 2DQ0A 3QE4A 3DWIA 3QEOA 4FNGA 3K12A 3ZGYA 4K46A 1WLEA 2C4MA 4EB6B 1NXQA 4HWTA 2PGGA 3DF9A 4MVJG 7YASA 5EQDA 5NLLA 1FJHA 3V2GA 3B7PA 1GM9A 5KOJB 3MS2A 4XSHA 3WIBA 2A86A 2UYNA 1FS0G 5JH7A 1JLMA 1KFJB 2IKSA 2ZULA 1RM1B 4KDEA 4NQZA 3K72B 2WYOA 4PSVA 1TEVA 4X90A 1XEWY 4DL9A 5BSWA 2HCBA 1B43A 4KB5A 1VHDA 1H2LA 1WUKS 4TTRA 4UUPA 4PHZA 1M2WA 2R79A 3PPVA 4CMJA 1NV8A 1QZZA 2YFQA 4G4GA 4KWEA 3IXQA 3KOMA 3ZLJA 2ZJ1A 3AETB 4E21A 2UZ3A 3O4RA 5HXAA 3E8FA 5IT4A 5DK4A 4G0XA 5I7RA 4NV0A 4Q9JA 3GJTA 3DHVA 2XYVA 4GWGA 2A7QA 4MGEA 4Y1EA 3EDCA 3CCCA 1J00A 4ZPJA 2R0QC 3UMFA 4YCJA 1S8AA 4E5DA 1LWNA 1J2EA 3F2VA 5B2FA 4X3MA 1YRBA 2CHGA 2B1JA 1FDVA 3DKPA 1NSYA 2DPXA 2EP7A 3KKQA 3AC0A 4FIDA 1CERA 4J3JA 5DM60 4DBLE 5IKEA 3SIWA 1AKEA 2E4XA 1MX3A 3JZIA 4B0PA 5C8VA 1M1ZA 1V7CA 4K88A 4KXNA 3LUAA 3B89A 2NMUA 1QQ6A 1Y1RA 1FLVA 1OA1A 2EJBA 2IY8A 2PH1A 3Q6IA 4HRXA 1XUOA 3N2NA 3B3FA 3FSRA 3FPFA 5AVYA 2A59A 3NZEA 2Q9BA 1WULS 3ZWCA 2QT0A 3L8DA 2NOAA 4HX2A 3WRXA 2BTQA 1E0KA 1FPMA 4FE7A 4PELA 1IPHA 1HL3A 1QYVA 1ZCAA 3R6GA 1DKLA 1JEAA 4R3WA 2HVKC 1TEHA 4UMEA 1L8AA 4NFHA 1AR5A 1GZDA 4QYSA 1SRRA 3HV0A 2CHQA 2ZSIA 3S44A 3FOZA 1W19A 2O0LA 2AGAA 1T36B 1K8AW 4I1SA 3BM5A 4TLEA 2LJ2A 4BMPB 2L17A 7MHTA 1NJIH 3R9IA 1TADA 2BLLA 4IIFA 2R1ZA 4PRYA 1L8QA 2L6LA 2X22A 3NCHA 3S8MA 3SSMA 4BOYA 2O7VA 1D2DA 4MGIR 1ZUNA 1MO2A 1OI7A 3IT0A 4QGGA 3T7EA 1CS0A 1REQB 1NULA 3RT9A 1WLYA 3S7ZA 4FOPA 5T4HA 2BFDB 5KJ1A 2IUYA 2XOKD 1SBNE 2RH4A 3LT5A 4PIVA 1U81A 1A2KC 4KDRA 1PV4A 2IHTA 3HKCB 1I3KA 2Z1FA 4AMBA 4LVNA 2BE3A 4FILA 4BNMA 4AUNA 3ERCA 4HNRA 4DXHA 3EXG1 1L5MA 2VP5A 3P19A 3RARA 3FPCA 1PJ8A 3QY0A 3D43A 4KYTA 4BC0A 5JQWA 1GTSA 1AJPA 2JD2A 5KEIA 4TN5A 4ZCSA 3VR4A 1YEWA 5HBRA 2ZJ5A 4NIMA 3RIMA 4QU8A 4C21A 2C3MA 5CAEA 1FSPA 2QJ1A 4JC4A 4K9DA 5BR4A 2Q3BA 1TI7A 2O2EA 1PFVA 1EZ4A 3EQZA 2CGEA 4HCJA 1J22A 4QXMA 5T67A 1U2DA 3PFKA 4KEAA 1FXWA 3WYNA 1CQIB 1AJNA 2QRMA 2DE0X 3J7TA 4C78A 3LT1A 5EVJA 5I8WA 1PEAA 1GPMA 3STHA 1M2FA 3LLSA 4MPRA 3CPWU 2I7XA 2Z4TA 3URMA 4CM8B 4KNYA 1IX9A 2IITA 2QJWA 4QXOA 4FJCC 1EXNA 2FMUA 2I55A 1O4VA 2RG1A 3FETA 3IDZA 3UJAA 4ENVA 4FVTA 3FRIA 2ZUDA 1SUEA 3R7AA 4OLBA 1KQSF 3E58A 3LC2O 3QKUA 2REOA 3MRSA 3B82A 3KLMX 3PFHA 3T9DA 3WKAA 4UCSA 1IV4A 4BVBA 1KEPA 2B2NA 3MGBA 2GKGA 1YTUA 3QUAA 1QHHB 4Q4AA 2HRYA 2QWXA 4O1IA 4YV2A 1KYYA 5K1XA 2NQ8A 4KSYA 1R0YA 3SF8A 3JQBA 3LDFA 4MQLA 1QFZA 2WAAA 1DWPA 3OZBA 4KO3S 2QRQA 4LCEA 4MIKA 1VOTA 4REMA 5F7JA 3I56V 1K8YB 2VJKA 4GR5A 1OOEA 2R97A 1RXWA 1PNQA 2QTPA 4JC0A 4Q1DA 3TKYA 4E07A 2ILVA 2VZ9A 5I9TA 1AMNA 2GCGA 3RNOA 4OCZA 2VQ6A 3PXXA 4KN8A 4CMIB 3KSUA 4XVUA 3C3PA 3D8RA 4MCIA 5BW5A 1PZXA 3FIUA 1VL0A 4GLLA 1NLMA 1C7JA 4LA4A 2CKMA 3DTYA 2QNBA 1ICIA 1ZX3A 2OOKA 4KH1A 3E1YA 5JCJA 1QQCA 3LO5A 1P1RA 5F3DA 3WDMA 3M4SA 2R8ZA 4EFDA 1WZEA 3DXYA 1E2EA 3M8AA 1ZUIA 1U0JA 3IBGA 1RPZA 2IJKA 1GAEO 1DL5A 1TKRA 4FLVA 1AHIA 1Z25A 2CK3D 3AFIA 3MJRA 2XGOA 1K5QA 4NPHA 1T91A 1M10A 1FYFA 4PZEA 3VU9A 1QD9A 1Q86W 2HK7A 3HUTA 4RYLA 2IH2A 5B58T 3VGJA 3AK2A 1SUPA 4Z86A 5DCLA 5CHYA 1HNXB 1LR1A 1XA0A 2ZYAA 5DHSA 1PZMA 2GZ2A 2HQ1A 4JLPA 5L7TA 1NMXA 3VOTA 2B9ZA 4YJ2A 3IUBA 3VR5H 2R8OA 1HRDA 3AONB 5EJIA 4CBVA 1JQDA 4DC9A 4DZTA 1DI0A 2BELA 4FYPA 3A6GA 3QYFA 1P31A 1V95A 3VR2A 3EUAA 1E3WA 5CTJA 4E5SA 4IF4A 4OHVA 4XX0B 4XCVA 1SA0A 3FM9A 2AH5A 3ED5A 1XCBA 1LBEA 3GVIA 4RK5A 3LOPA 3NX4A 2A7WA 2G09A 1T29A 1TCAA 4QQ8A 1FXKB 4UUNA 3UA3A 2FFJA 2GPAA 4KI0A 4UVHA 3OD5A 5AR1A 5JW6A 3LKDA 1A1VA 3ZJUA 5DULA 1GM7A 3EAGA 4BNZA 2EWVA 1T4CA 5KUKA 3NHZA 2IXBA 3QVGB 4HUJA 4IVNA 4OI0A 1YA8A 1IHUA 3WWZA 4BVQA 4FINA 4PYLA 2VUSA 1I33A 1NVXQ 2HV8A 1NZFA 2BYTA 1XQ1A 1G4HA 1N9KA 5H68A 3GNTA 8MHTA 1NQ3A 2D59A 3LPMA 3PGXA 4NS4A 5JTTA 1W0CA 1T4DA 3LWQC 4MQMA 2WHPA 2ZFUA 4IM7A 4KGZA 3RKUA 4C29A 1ZXXA 2RGXA 1W88A 1BGYH 2BSQA 2GAOA 2VZLA 1T5IA 3F4BA 2G82A 5DYTA 3QY9A 4LFBO 4R8VA 4ARUA 3AK1A 3OUSA 1ZUNB 3TF5A 3BT7A 4MW6A 4UCFA 4CH3A 1E8DA 1UPFA 2AOXA 5DBFA 2Z9CA 1M56B 1KTVA 1S7CA 3KXDA 1V1RB 3K9LA 4U7WA 2M6KA 3TOVA 3UWSA 5IZCA 4FCCA 5AKHA 3H2IA 1Q81H 2ODQA 5FADA 1RYYA 2YXEA 3SNKA 2CXRA 1ZD5A 3L7LA 2FSVA 2XD4A 4HPJB 1Y6GA 1PWEA 1Y9EA 4FKMA 1F0YA 4EI8A 1HA3A 3CSSA 2OIGA 1WDLA 2WQ7A 3OT5A 2PH5A 5E95A 2QUBA 2X0NA 4FN5A 5H5JA 4RTNA 4AHCA 2PS3A 5AK4A 2R72A 4B9AA 2EQBA 4G9BA 3UJDA 1Q6IA 4G23A 3HUFA 2RBEA 1V0JA 5JISA 3KQLA 2XLBA 5JNRA 2RGBA 3IAYA 1ZL0A 1W2GA 2FMIA 4DV3O 3FCCA 1L5HA 4C87A 4EQZA 2QL9A 3E1KA 4D3YA 1NY5A 1YTFD 3OR7C 5JJNB 1IZ0A 1VE6A 2H7XA 3OE7D 4HC4A 1CQIA 2H4HA 4PLZA 2OYCA 1K9VF 1JZQA 1SEPA 3GGOA 4RKYA 2O5RA 1KOJA 5DHAA 1U2GA 2WC1A 3G0IA 2DW4A 3GZJA 3RREA 1W55A 1F51E 3EGIA 2X0FA 1KP3A 3PHJA 5J1TB 3H0KA 3WV4A 3OA0A 2K7FA 5JQGF 3U9SA 1GQ2A 1TVKA 2PTMA 1CW2B 2N04A 1DT5A 3JW8A 4RHXA 4I1VA 1ZWIC 3ENVA 3KDSE 4XCQA 1EX7A 3QBEA 1K5GA 4OQFA 1YU9A 2Z8XA 4XRRA 5CDUA 4EJMA 3SF0A 4BWFB 3I2GA 1GNVA 1C0EA 4DMKA 5TPWA 4KPFC 1PT6A 1RZRA 3ONDA 2Y67A 2W11A 3C8MA 3LSYA 2C1XA 1ZIDA 2O0JA 3G2OA 4RJIA 3WKCA 4BVFA 3N2IA 1QHGA 2H2WA 5B12A 5FUQA 2AS0A 1X1BA 3OJOA 5CX1A 1ESNA 5H8WA 5IVDA 1YZQA 3N07A 3K5MA 1H47A 2L0XA 2GN4A 4LY6A 5TVKA 1ZGBA 5FXMA 3MERA 1VTKA 3IPLA 4M8IA 3NB0A 4WMLA 2UKDA 5HY1A 5DEDA 1B06A 2LE0A 1SHTX 1JG6A 3E15A 3H5OA 4CT5A 2GJSA 2PWPA 4YLYA 3KKMA 5TF4A 3FAVB 2Z3YA 1KMCA 5HCIA 1HLDA 5K03A 4CTJA 3SP1A 2PGXA 1GXSA 4AQYO 3CZCA 4DG9A 2ZAOA 4Q3DA 4N49A 4LOLA 1IDN1 1RXCA 4AP9A 1ORQC 2V8OA 3PK0A 3X2QC 1MC1A 1SULA 3ENZA 5B1HA 3JATB 2ZBUA 3UAVA 1K06A 2EOAA 1CUIA 1JLRA 4PS0A 5HOQA 5JR3A 4C4OA 2P7TC 2JFYA 1N2CA 3OZCA 5AHKA 3UCFA 1KXZA 3HJTA 5ITZB 2EKDA 2HNBA 1P84F 1KSJA 2GOYA 3CLUC 4BZQA 4EHIA 1AQNA 3K1JA 3DLBA 4Q82A 2FPGB 1G21B 1MAHA 4UDXX 5JJCA 1RYFA 3JVHA 2V03A 5HILA 1M4UA 4ETIA 2J5KA 4OQXA 3BZUA 2FSSA 3JYNA 2XVYA 3TO5A 3HDTA 4XFDA 4TVSA 2DCMA 4Y9TA 2J9ZB 2H2GA 1EGHA 1DBFA 2FN3A 1XL6A 1RMQA 1LTQA 3DE6X 2WJGA 1U11A 2AFRA 1I94O 2OFPA 1UDRA 3U40A 2NP6A 3SYMA 1K4MA 3OTHA 5LXTA 3MUOA 3A6EA 5EXDA 5A4AA 4A15A 3IQXA 1QU7A 3H9QA 4FYJA 3AOEA 2XTAA 3ABMB 1M5IA 4JZ2A 2FJ0A 3KZ1E 1N4CA 1AB3A 3HCCA 3U7JA 4HI0E 2OAGA 4UU0A 3OZEA 3MAAC 3OC6A 1ORIA 4KVFA 4OHMA 4RIFA 4EKDA 1R12A 2A57A 4RVNA 1ABFA 4PI0A 1UBJS 2NU7B 4H0CA 2BHTA 1Z8NA 1YCIA 5F2VO 2IZ5A 2G3YA 5IPFA 2ATKC 3P9XA 5CLHA 4BEBA 5AM2A 2LBTA 2EG5A 4UEWA 2BFDA 3SU8A 4P98A 1SXPA 1VQNV 4PSKA 5AI0A 5A05A 4Y18A 2ZJ6A 4WVLA 1CZOA 1YL5A 3KHUA 3D5QA 2DFVA 3INRA 4I9UA 2XE7A 2VDNB 1QGYA 1Y7PA 4RK7A 4B79A 1U3GA 1JQKA 1TJYA 4NYMR 4V3BA 5EY5B 5AVZA 1EN4A 1V6SA 1U90A 4U7GA 1EP2B 2GUZB 2EBUA 2VDRB 2YHBA 2YUIA 2ZOVA 1BNCA 3EVGA 1EHIA 2J0VA 1FD9A 3OLWA 4KXWA 3RWBA 3S70A 3UW1A 2XW6A 1NTOA 2Q69A 3K0FB 1VPWA 1VIBA 1KPIA 4IQ8A 2EFYA 3SYCA 4YJGB 3CPQA 3AUYA 2UZ0A 1LVUA 1LQUA 3QJGA 4CM7A 1M2VA 2BEWB 4H2DA 5LQJA 1I0HA 1U3FA 3K1TA 5FX2A 1UJBA 1YV9A 3B9PA 3VQXA 1D2NA 3QNUA 4BHTA 1S2MA 2PS0A 3U7GA 1NAIA 1RI5A 2TMKA 3KJZA 3MINB 2DYYA 4N9QA 3VCZA 1E62A 2QGZA 3S40A 4HGOA 1QQ7A 5J9PC 5ALKA 3DHNA 2D1YA 3OCJA 2EW2A 4EPXA 1ULHA 2BF7A 3HDQA 5ENZA 1LWOA 4R6XA 4YEDA 3WXBA 3ZHRA 5DYYA 3CH7A 3UHFA 3CX4A 5CLFA 2FWJA 3EZXA 4RDXA 3PG5A 1DTEA 1U3UA 5A2QM 3FI0A 4CM1A 1T1SA 1EFCA 4OQYA 1P1CA 4FPPA 2WY2D 3KOXA 1VYUA 4J0KA 4CM9D 4AURA 4GAEA 5J40A 2H1LA 2OHWA 4OJKA 3UV7A 3I56F 3COPA 1VDZA 4QNNA 1Y76A 5FIUA 1XDUA 3IL2A 1FPQA 3LSSA 1KH2A 2VR1A 2VF8A 2KJQA 5AHXA 1ODKA 4KAXA 4MKGA 4QQNA 1NPDA 3G6KA 1YI0A 4BZWA 2O2SA 4B17A 2A30A 5DVZA 2ZYDA 1A88A 3ENNA 3PNKA 5H81A 5HJ7A 4ZVVA 2QR4A 2JCVA 4PG4A 3H1TA 1SQPH 1F9EA 1X1RA 4WESB 4FM0A 4XWGA 3AR8A 4AJHA 2Y9MB 4BJ6A 3AQIA 1ULZA 4B7XA 2Q46A 4MTCA 4IR7A 4Q3OA 2FZKA 5JAZA 1D03A 1NPYA 3FTCA 3SHVA 2Q5ZA 4ZK7A 1AB5A 1WVMA 2UXXA 1H5QA 4LAFA 3QHPA 5SICE 3S29A 2NVWA 5KNBD 5KVCA 2M7WA 2ZIGA 1HDYA 4EG8A 3MWYW 2RI1A 1TAEA 3KYCA 5I01A 2PUSA 1WX1A 1P6XA 3G2PA 4PQGA 4NR0A 3FGPA 1I1NA 3PGKA 5DV9A 5TEWA 2ETXA 1N7HA 4IP0A 4JB2A 5F3RA 4W6ZA 1QVFU 2CHEA 2PMFA 3VPBA 2CGNA 3AF3A 1VDMA 3BMXA 3CP1A 2AUMA 2GNAA 2WPDA 4M86A 1D9ZA 4JR0A 4DPMA 1N2XA 4DZZA 1GFSA 1PTJA 3GELA 4ZU6X 2PKCA 2YHUA 1XVIA 2GFIA 2JK0A 2GPNA 3MMZA 2N9UA 4BNWA 5IVPA 5GIOC 3GZNA 2JG3A 1L4HA 3IEMA 1BDJA 1X7YA 3TL2A 1IU9A 4FCVA 4GCZA 2LO1A 2DSNA 4MVJI 1Z5WA 3WHLA 4DRXA 2NU6B 5HZHA 1W35A 3DMPA 4DT1A 1E3SA 1T0AA 2VHXA 4F0JA 1DAFA 4G5XA 4G89A 5BN5B 1UWVA 1N2JA 3OX2A 2WYHA 2WA4A 3IE0A 3JRWA 3HR4A 4HN9A 1BC5A 4DR6B 1WUYA 3EYAA 4CFZA 2IU6A 4IQ4A 3IUJA 4FCWA 4S12A 4PDVA 4UCVA 3LUHA 3NTLA 4PNEA 1GRRA 5ICCA 1Z35A 1ZM7A 2Q27A 4OHBA 3V8BA 2ZBEA 2Y9PB 4B6JA 4EX7A 1BVHA 3VFDA 2YQ4A 4LFAB 4HLUC 1AA9A 4TZTA 2HRQA 2G1AA 5EIAA 5KHKA 4E4EA 3CYPB 3CXCF 1JI0A 1S2NA 3EVEA 3RFUA 3U37A 3VC7A 4DR4O 1XTZA 1EWRA 5D85A 3K5LA 3DDUA 4F71A 5AHOA 5FBVB 1VP9A 3PQFA 4GZ5A 4GUNA 1ZCBA 2AJBA 3HBLA 3U7RA 4B3TB 1GPUA 5EIBD 1G64A 1XTRA 2H3HA 3BK1A 3EVCA 3NJ4A 4FFVA 3M1AA 1YI2V 5DX1A 3QWHA 5EPUA 3C8ZA 2PT9A 2O3UA 2BKAA 3K05A 2JJ2D 1NRXA 3O74A 1DTOA 4U1RA 4X95A 1IXSB 3ROMA 3WICA 5LBTA 2POQX 1AQJA 2QW8A 3CW2A 4MV4A 2OV1A 2H5LA 1VJ1A 2X86A 3ISVA 2QDKA 4GBGA 4TVKA 5HTKA 4LZAA 2FN9A 2WVJA 1E1RG 1NQXA 1P2VA 1YZGA 4PBRA 5FPYA 2WRZA 1D2HA 1KEEB 3F7NA 4G0YA 4QPNA 5HS6A 3DQPA 3W7XA 5CU7A 2QMQA 5JO0A 1EESA 2GAFA 3WQBA 3VKGA 1OV9A 1RSOA 1N8NA 2IPOA 1BA2A 3BA9A 3NEPX 2GUZA 3SPIA 1DTWA 1LJUA 4OQDA 2HFEC 3IB6A 4KMMA 4WZBB 2Z08A 3VO8A 1S2GA 1HOXA 3VDXA 4S2UA 4LH7A 5K1PA 3ZW7A 4UC0A 5JARA 3KQWA 5H7XA 5LUAA 1H2AS 4NICA 2QEXF 2QSAA 1G9SA 1P5FA 3H8JA 3HPLC 1W41A 3EGDB 1JLLB 1OX6A 5EUBA 2O8FB 2A0XA 3RVNA 4BEJA 5KNDD 3ZE2B 1NMZA 3STLC 2XUQA 1ND6A 1CVIA 1YU6A 1AS2A 2GNPA 1U8XX 2WF5A 4IOMA 4S24A 5FI5A 1OXKB 3AWIA 2YY6A 3RABA 1JP7A 1NQVA 2WVAA 2XOEA 1MOSA 4HRAA 3G4SV 3O1JC 2RHJA 4IRXA 2GKSA 3LG2A 4AS1A 2BEUA 3ZCUA 3BMQA 4Y30A 1WUTA 2A14A 2Z1TA 3ZR4B 4A2CA 5FWDA 1C0LA 2GEVA 3ICXA 5B1DA 1IUOA 1BXGB 1SZJG 2FEAA 4D25A 3CEIA 4YA6A 3GRZA 3PGJA 4LDAA 2RCVA 3UENA 1E3LA 3I34X 4BW9A 4IG9A 1NWHA 1TW3A 2WWWA 4MSWC 2HIAA 4JGSA 1OXUA 3IQFA 3JY6A 4FZ5A 4QQKA 3FOBA 2DLCX 2PUVA 3AOGA 3R77A 3RHTA 2CXOA 1PPJH 1PJRA 5EYPB 1RKVA 2JFOA 2ZU0C 3NTOA 2HGZA 4O4LB 1U7HA 2KS6A 2QA5A 3I0ZA 3QPCA 3U4IA 4PXAA 4XM2A 5C1BA 3HSKA 3UUEA 4MQEA 1NQ5A 4BVHA 3H2HA 4NBSA 3C70A 5KHIA 2D0DA 3F6SA 2CZWA 4BMOB 1U0EA 3GRPA 5IDXA 1ENOA 1JMYA 1K89A 4RELA 5HCUA 4EKNB 1I5XA 4KRFA 1J2TA 3PL1A 3A3YA 1NJGA 4IKOA 1XXLA 4UZSA 3VHQA 1E32A 3IC9A 5FPOA 4H4CA 2OCPA 5BRAA 5LMNO 2GCPA 3I76A 3IBSA 3LX5A 4IUCS 4TUYF 4YMIA 4JXZA 3D0QA 4KCGA 3CYFA 2J0QA 1QRRA 2OHOA 3I5YA 3D00A 4ZAXA 2NX2A 5PNTA 1D5NA 3U44A 1E2PA 5A4JA 4UBJA 2F64A 5JD5A 3BHMA 5B64A 3IVMA 2IXDA 3D2LA 4IIHA 1SERA 2OFXA 3QV2A 1TZ2A 2XGSA 3PKJA 1IXRC 2MT9A 4J2OA 1Y7IA 2FFRA 4QBIA 4M0CA 4XRGA 5F1PA 1QE3A 2V7QA 2G36A 1NBHA 1M2NA 2J4CA 4H1UA 2M6YA 3EG9B 3INNA 4CLDA 3IAHA 4KQXA 4BQEA 5SV2A 4ICGA 3MWGA 3PWKA 3P0ZA 1NH2D 3GDFA 4B3BA 1Q83A 1Y9AA 5LKRA 1TZMA 3D3JA 1FUKA 1SUFA 2DTEA 3NWPA 1VHLA 3OP4A 3LP5A 1UP4A 4WNAA 2R9IA 3T1OA 4C04A 2WWRA 1HPLA 1KZGB 2JB9A 3A9WA 3TCUA 3Q7EA 4J1QA 3RI3A 3BXGA 5EXSA 5A3RA 5EQJB 2YV4A 2XE6A 1KNJA 2PHZA 3H9UA 1RFLA 1JAZA 3B3GA 1TTTA 5F98A 3LDDA 1PGQA 1XZBA 1Z75A 2OCXA 2YY5A 1ULTA 3DE7X 3I9V6 3LBFA 4IIUA 5T4BA 2V7UA 3KCYA 1S3GA 3EIXA 3FUVA 3LQYA 2ZBPA 4TTQA 4V0OA 3EVDA 2H0RA 1XJQA 4NZMA 3WMRA 1XNQO 1EHCA 1A9XB 4FJ2A 4J0JA 5HG0A 3EC2A 1MZVA 2IP1A 3HGTA 3SJZA 1P7CA 2WTBA 2F1JA 1I3OA 5EHGA 2JVJA 3T3GA 4P30A 3KQNA 2XYQA 4F11A 1KQFA 3L6DA 3H1HH 3ZLBA 4WL0A 3ZWYA 5EP1A 2EIKC 4ZOCA 4C3UA 2Q4PA 1Y42X 2EX1A 1LDGA 4AQYB 1PXWA 2OD9A 3E1SA 3R3HA 5J5AA 1L5GB 1F4NA 1DIRA 2YUTA 3T5CA 1YQUA 3LY9A 4NDAA 4UEJA 5AUNB 2OCAA 4CIDA 1CG6A 2P0EA 1T1IA 1DADA 1AVMA 1GPJA 3OPNA 4JUIA 1H4VB 1U02A 5AVTA 4IL5A 4OXKA 2R00C 4C7JA 4G4JA 2B20A 1XRLA 1Q3KA 4MSUA 5FOWA 4L15A 3JV7A 1E2GA 3W90A 3UGJA 2HMAA 2QD5A 1SXJE 4J0DA 4KR0A 2G6TA 4ZPXA 1JQLB 3OQNA 1F6BA 4HF7A 4YJ3A 4WBNA 1IRIA 1Q1AA 4UB6Z 3AF5A 3G3EA 4YO7A 4LR3A 2MINA 4WDRA 1UQRA 1S1CA 3I55F 1P4AA 5T5QA 1R50A 3SKVA 4BQOA 3CCVF 1KI2A 4J9YB 5GZ6A 3V9AA 1BWQA 2QKAA 2G71A 4NR1A 2W58A 1J07A 1NN0A 2NUAA 2RDCA 2WLTA 4MJLA 3OKAA 1ULSA 2O0MA 4RKFA 4KPGA 4AY5A 1LCIA 2HMUA 2WYWA 2O7NA 4K6KA 1FVHA 4JQOA 1BZYA 3AEQA 2GHIA 4HAZA 3TBFA 4BP3A 4LX0A 3H18A 1RKUA 1N5IA 4F1KA 3STYA 1OH8A 2ZUVA 4Z5XA 3T94A 4F2PA 1L5HB 1NC1A 5KUMA 3UBMA 4NEGA 3ZN1A 2HWUA 4IDNA 3KETA 2IJGX 2WVHA 3QP9A 4LJSA 1E89A 4PNZA 5G0TA 3ETQA 1H8EA 2OCCB 1JL3A 3QX7A 4OX9Y 1FQKA 2GEFA 1QH9A 3K5OA 3W77A 1JIIA 3OW2F 2GARA 5CGQB 4DK0A 1NQWA 1YS4A 4JGGA 4AG6A 2RNBA 3KBBA 2QUKA 5GM2A 4EJSA 5GINE 3W7BA 4TTPA 2BDEA 2O2YA 5B1AB 5E4YA 2W8ZA 4FWTA 1OFIA 2WJ3A 4BNVA 1SPXA 3VZCA 4JFAA 1GFZA 3ICQB 3CEPB 3ZDYB 3DXFA 1YQDA 5TPWB 4I5SA 1CZNA 3I2FA 3ZLUA 4Z4QA 4A0GA 3FBAA 1P7VA 1KXJA 4Z49A 3BCHA 2NPFA 4CPDA 1YK1A 4TT3D 5DW0A 2XASA 3ZCCA 2XA2A 2OXEA 3WGTA 1RZVA 3X2FA 2EKBA 4NCBA 3FBWA 1F2TA 2NACA 2KTVA 3INGA 4HL6A 1FIUA 3SZGA 1L5QA 1D6MA 2M9MA 2UDPA 1WPXA 3H6HA 3A1WA 2P9YA 2GK4A 1WCXA 4DLRA 3HDJA 1RS0A 2JGMA 3WWOA 2VHYA 1JG3A 2DYRB 1KERA 3DFIA 4HN4B 1GSAA 3FMIA 3W7VA 2YYAA 3RC9A 4D3DA 2O54A 4I2NA 1U9YA 2XWJI 4MUIA 3LBYA 3QNMA 1ISGA 3FY4A 4FM9A 1EAMA 1PEKE 1FF9A 5E1OA 4AJ4A 1ZVMA 3DGFC 5AXCA 2ZBFA 2DR3A 1NG1A 3G82C 1SQ0A 1VARA 2SKDA 1NKVA 2UXBO 3LQRA 4FQ7A 2WJ6A 1BZKA 1Z37A 3MCZA 2EJ7A 2HF7A 3H9CA 3JQPA 4BGUA 4ZJZA 4KW7A 2Z4SA 3WMWA 1M2KA 1REQA 3Q8LA 4FI3F 5CW2A 2VBCA 4E30A 2XRMA 3BRWA 4CM5A 1DEOA 2WK1A 4LGCA 2VGNA 4CG3A 4EUSA 2JDIA 1YDFA 3S2EA 2G9UA 3STWA 2A9QA 1NVPB 1LUWA 3X1WA 1Y0BA 2AXNA 3IPYA 1YIOA 1IBMB 1OYVA 4LVCA 3CY6A 1JXMA 4JUBA 4PIMA 4ZKEA 4EHFA 2AD1A 2AB0A 5CFRA 3BKWA 1X7XB 5AICA 2F3UA 5L9AA 3NTUA 3NDPA 3CPWF 1WCYA 3L1VA 3PDJA 4RF3A 4IIGA 3UGKA 4GI3A 5DX0A 3T4ZA 3C3WA 4LYFA 3JWGA 2R60A 2JEUA 2HW8A 1DARA 1H2HA 4FB5A 1GA4A 3HB7A 4ZIRB 1H8HD 3VRHA 4M1TA 4N5NA 4L5AA 4NPAA 1ZM3A 4DVJA 4CN9A 2NAPA 1QGAA 3ZN0A 1WQ3A 3Q7TA 1GTG1 3WDSA 1C0IA 1S0VA 2AIFA 1T3SA 3IHLA 4FD2A 3RA5A 1E2HA 1ZW6A 3LBNA 4MW3A 3CWQA 1JDNA 2J30A 2JKZA 2O6HA 4E5KA 1P3JA 3MUNA 2WIBA 1JHMA 4MR8A 3IVXA 2GTAA 2XIQA 2WLIA 3CF4A 4DR7O 1XJ5A 5C8YF 3S2YA 3QWAA 5AK6A 1ADCA 2WUFA 3DZCA 1NVAA 1SU4A 4N41A 1Q5OA 4TQDA 3U1VA 2XCIA 4A2WA 5EIOA 5JV5A 5EMLA 1RQRA 2R9VA 1N5OX 1ZX1A 5EJ7A 4LFCB 4G1FA 5L3SA 4I50F 3DTUB 4X66B 1PAUA 3G2NA 1NG9A 3E3LA 4XTRA 3MBKA 3BIOA 3D6NB 5EE3A 3LXRA 3ZWOA 1BE8A 2LGWA 1CR4A 1NI4A 3FB1A 1Z6YA 2XQIA 3A28A 3BXXA 4DUZB 1X6VA 3CLUD 4LF6O 3CJHA 1BE6A 3OZFA 3H1JH 2FUKA 3EIUA 3IJPA 4TT8A 4PI2A 5BP7A 5B3SB 3BN3A 1FFHA 1NJ6A 2H18A 2RB9A 3NT4A 4L50A 2CDRA 1WB6A 2Z58A 4Q37A 2HTEA 2JJ2A 3E8HA 2G08A 2Z56A 3HB5X 3PUJA 4ZVTA 1YRHA 2IA5A 5FTNA 5HIMA 5JSUA 5KZMB 3IUEA 4MS1A 1V55C 2QIPA 2LR0A 2HU2A 2Q5OA 1DBPA 1EUCA 2F23A 3OBIA 3CCSF 1T3LA 2V7PA 1GGMA 3OVMA 1BL8A 1OCRC 2XYGA 1ES9A 2RN9A 4Y1FA 3WP0A 3X1ZA 1FA9A 2XCRB 4IH9A 3HJAA 2E1PA 2QRZA 3B1WA 4O2AF 3SXUB 4D26A 2CE4A 5A9TA 3U17A 1KDZA 3ZK7A 2F95B 1XFDA 2CEKA 4X94A 3PFFA 3MJ4A 5JBNA 1ST2A 4DAEA 2A9VA 4NB5A 2EQ5A 4HAXA 1H38A 4JOQA 3DZGA 2GF9A 4CEHA 4RJ2A 3MBIA 2ISSD 3JYPA 2EKLA 4OY3A 2JHCA 4TS9A 2FN8A 2O20A 5JRDS 1N7JA 3UUFA 3NC1C 2BD0A 4V1CI 4DS3A 2NMVA 4EJSB 2L19A 3QXHA 1EFKA 5EPOA 1THMA 4BMXA 4BT4A 4E15A 2HJVA 3F4KA 3VU8A 1E1YA 2V4UA 1LU9A 3DQZA 3OC0A 4PLHA 2VP2A 5D86A 1S5HC 3DBVO 3FJYA 4BAZA 5AK0A 2HWKA 5ITSA 2ZBDA 4KR3A 2RH5A 4HR7A 4JWKA 1NDHA 3ADKA 2GA8A 1H7MA 5CDFA 1USVA 4GOJA 4YB8A 4CIWA 2DERA 1PSDA 3DEAA 4KQWA 3UQYS 5BMOA 2F8TA 3GGPA 5KTYA 1NX6A 2XZPA 1MSWD 3OE4A 3T0GA 2ID9A 1U5BB 3D3QA 2IYRA 4G2NA 2B4AA 1R4NB 3OU2A 4NYMQ 3CR8A 5JSHA 1E2FA 1CLIA 1H05A 5AVRA 1EGVB 1GV1A 1PQWA 2PJDA 3CX7A 4KTVE 4GOND 4BWAA 3IKMB 4YCBA 2PU7A 5BW6B 5EUQB 4QHYA 3FHLA 4BO1A 4KWHA 5CCEA 1P29A 3TSAA 1FNSA 1TYBE 3FFXA 3D6HA 5KYWB 4GWKA 4B76A 5KNCD 3BEHA 2CMGA 3N5CA 4Q9AA 1P2BA 2VJOA 4QEKA 1G1AA 2CHSA 3HRIA 1KO8A 1EN5A 5GIOE 4CEJA 2IY9A 1I4LD 2EF0A 2BAGA 1Q0QA 2GWRA 1QDEA 4HNGA 4YMSA 3MA0A 1KAEA 1NZDA 3TQFA 2WTUA 2PUJA 4UZEA 1K5DA 4FMPA 4RPHA 2XMPA 1P5HA 1ESCA 4LKOA 1G20B 2V9PA 2Q2NA 4P82A 2IE8A 4GP9A 5BSUA 3RRYA 2HK9A 1D5WA 1K4KA 2JLRA 2O2XA 1XNGA 4CETA 3EMVA 3GPLA 5LP6B 1FK8A 3B6JA 3DBRA 3RV3A 5LQNA 2HJDA 1JIQA 1ZY2A 3H3XA 3QWFA 5F5XA 2NVUB 3E61A 2JGFA 4O4HA 1T9HA 1SB9A 1VQPV 1XSEA 4DWOA 4EBFA 2V6MA 3PQDA 4C4TA 1JHVA 1UDWA 5A9SA 5EFZA 1VFPA 2G88A 1COWG 3T1HB 3AVTA 3O2NA 2JNBA 1A9OA 2OO5A 4QE3A 2JJ1G 4TYQA 5CHEA 3CLKA 2WLJA 5LVAA 1T5HX 4QOFA 1G6UA 4JELA 4W5QA 4HBZA 3AY7A 1YI8A 4Z1OA 1SF9A 1SIWA 2C5AA 2IHBA 5HRUA 3W9BA 4D9EA 3ZU6A 3ILVA 4DLPA 3TM4A 3EJ6A 1HTTA 1U1DA 3FCYA 1JHYA 3UJ9A 1XCPA 2C4NA 1M2HA 3C4JA 2P9TA 4YDRA 3RSZA 3E05A 3OMIB 1VCMA 2Q3LA 2NZWA 3NBAA 2CFOA 1ELOA 2OTJF 1XAHA 3BCCH 4G0QA 3RSGA 3SE0A 3Q7IA 5B6JA 4QUBA 5CXQA 4B3TO 2PXXA 3VPGA 1ZC3A 3W34A 1KEEA 3AV3A 3G5TA 3EH2A 2EC5A 3L0BA 1BCRA 1GAQA 3I9NA 1VQMV 3LNNA 3ORFA 1KY4A 4EH1A 2PD6A 4KP7A 3L7AA 2IYNA 4BXOA 3BH7A 4S1VA 5JJIA 1U6JA 2Y4UA 5IBQA 5EZYA 1CRLA 1JNXX 2ZVQX 4PICA 4RY2A 3AL0C 1P0PA 3BGVA 1VFNA 5HIKA 1TE2A 4KK3A 5GINC 4XQCA 2B1QA 4QPJC 1TK9A 3F47A 2ZTUA 3OJWA 5JXGA 3RC8A 3P3PA 1F3LA 1I13A 5HQTA 5G3ZA 2Z1EA 1QAMA 4X1IA 4KAJA 1DUSA 2JVIA 3TMYA 2CD9A 4XDHA 3OY7A 4R4JA 3UKDA 2ACVA 3ACBA 4IJMA 2UU9B 3ZV4A 2PYLA 2VDWA 1P33A 2OLJA 3SJAC 3LNCA 4M0PA 4WQMA 3SC4A 3SSAA 3UWOA 1PHRA 4PGMA 5HRAA 4QASA 3PXEA 1EQ2A 3CTPA 3H2JA 4UNQA 1COZA 2WJVA 2FQWA 2GN6A 1BTOA 2H5EA 3WK8A 3IOEA 2CLDX 4P3YA 3OFVA 3HGMA 5KKCA 1MABA 1KU6A 3WGJA 3WLOA 4I1RA 2YMQA 3CYOA 1QZTA 4N54A 3WTCA 2A92A 2IS4A 2K87A 2JGRA 4W6QA 1CP9A 5HJ2A 3HS3A 2ONYA 4QYMA 4MUBA 4TKVB 1EFPA 4Y2PA 3BKXA 3R6WA 3LAWA 4C0HA 4M76B 4QUEA 3ZNOA 4C4SA 3G0HA 4TV9F 4N48A 1J5EB 5JS6A 1QFXA 4UCUA 2VRBA 1U80A 3FMGA 3IOBA 2QKCA 1KSFX 4H44B 2AYXA 2I2BA 4Y6GB 4KPEC 3TXAA 2DQ3A 2BR5A 4L9RA 5KSZA 4OX9B 2E18A 3R65A 1C8VB 3HUUA 3IXMA 5KB3A 1ZMTA 3B8EA 5THXA 1GG2A 2FPPB 3O8NA 1UK6A 4FFRA 4MUXA 4OA5A 1IBCA 5AKIA 5HFAA 4A36A 3UCXA 1KK1A 4LHYA 3AM5A 3BGOS 4EJ0A 3KYJB 1FE8A 3PUVA 1YS1X 2QM0A 4XVRA 4Z0PA 4OFXA 5K4GA 3CCJV 5E0OA 5AKXA 2MSLA 5IY5C 5KTPA 2CVHA 5JNTA 1N2OA 2JFZA 2OM6A 3ESXA 4V0ME 2I2DA 3FLBA 4LDJA 1QAHA 1P19A 2R70A 1PV2A 2RAFA 2C7VA 3FOCA 5KOJA 1G3RA 3SQWA 3O8BA 4YRBA 5IJZA 3CN7A 5TVGA 1NJ5A 3WLMA 2XDYA 3KZCA 3GRAA 3OIVA 3FRJA 2HK6A 4UBOA 1ZR4A 1KYXA 2P77A 3EDMA 1F7YA 3H1IH 1X1SA 4I81A 3WL5A 2R6GA 3BFVA 2C2OA 3ZXUB 3PICA 1ZGGA 3SX0A 4IEIA 1Z2GA 3W7WA 1BMFD 2PN1A 4M9XA 5G4UC 3ZRSA 2JRLA 2XCOA 4PYQA 1R6AA 4YAWA 3OTOO 3QWIA 2BFEB 1U65A 2O8NA 1V9PA 3BVPA 4FZ1A 4AICA 4KBGA 4JIMA 1RHJA 2BEVB 3EULA 3DONA 3QTTA 2QMZA 4PFQA 3GEBA 1AD2A 1XB2A 3RRNA 2IP4A 2O19A 4WFHA 1C0PA 1ORDA 1AGRA 2Q7HA 2FPMA 1OBOA 1SHZA 2D1TA 1U1IA 5HXZA 2OC9A 2FCAA 2OG1A 5CNKA 4BP8A 4V03A 3D8CA 1ENVA 3TGPA 2VDKB 3CZRA 4JT4A 4XOUA 2PS1A 5HDBB 5MGBA 3K70B 3BJEA 2A0UA 2IYVA 1N1DA 2H7CA 3AVQA 4U7NA 4PONA 4Y2GA 3H2KA 1K75A 1T2VA 1OBVA 3M99B 3ZQKA 1UFYA 2FI1A 4UCRA 1MD9A 3IEKA 1UL1X 4GWLA 4IDEA 4IS3A 4MB6A 3JVIA 1JD1A 3RQIA 4A7PA 1I8TA 5A1TA 3DTTA 3JYHA 3CLVA 3RAEC 1XMQB 3AFOA 1ZNXA 2R5NA 1NN5A 3DV9A 5KKAA 5JNWA 1E99A 3PEWA 1U2ZA 3BTUA 3K8QA 4YUWA 3WBFA 3IKTA 5TQJA 4JV5O 2ATVA 2B4YA 3C1AA 3EF3A 1BT8A 1WB4A 5KTMA 1T0BA 4QTZA 4IXTA 2O3RA 3KJQA 4PZUA 2OV4A 4MGKR 3OEYA 4NP6A 3H9GA 3TRDA 4EJ2A 3ABOB 5K8TA 3U0BA 4MI6A 1IL0A 3KV3O 3KUXA 4P54A 4LDZA 1P1BA 3RANA 4WLEA 4P9OA 5B58C 4NJEB 1QHFA 5DM2A 4B4UA 1TQ8A 3IAM6 1L4LA 3O75A 3PL5A 3CCFA 4GQAA 4NBTA 3RVZA 1Z15A 3DE2X 2ZT9B 2VJAA 3GK3A 3PLNA 3H0CA 4PQEA 3TRKA 1QHIA 3F5WC 3USCS 4HWKA 1G41A 3RYIA 3HB0A 3OT1B 4GZ6A 1KMMA 1T9GR 1Y4AE 3OM8A 1Q0TA 2YNMD 4EQ6B 1DC4A 2CCGA 3IO5A 3L43A 4KKVA 2B1IA 1N3YA 1RXSA 3NORA 5EIXA 2HRDA 3EJWA 1DF4A 1BQ0A 2F1IA 1AI4A 1OVMA 3LKBA 4L9WA 4Q9DA 4WOKA 3MWDB 3DH0A 3ZPXA 4C4WC 1SKUA 1X3LA 3EEYA 3GJXC 5JSQA 3ZY3A 3ELYA 4L9SA 4Q7LA 1WLSA 3IT1A 3TTUA 2P2LA 3T7KA 1CTQA 1E3IA 1KOGA 2IYWA 3DOOA 3BIJA 2DF8A 3F6CA 1KD1H 3JQ7B 1Q86H 5L4LA 1Y6QA 1BO6A 1JLSA 1P1KA 2OGSA 3CUUA 3E8SA 3B3QA 4TV8F 4UEQA 1JH8A 4WK4B 1EFRD 3ZX5A 2DT4A 1SQBH 1ISPA 3EOAI 1U2QA 3G0OA 1XDWA 4KUEA 3V32A 2A1UB 3DSQA 1OXVA 3CINA 2W71A 1AO0A 2VF4X 4DUGA 3T3MB 3IJRA 1CUWA 1E7WA 5TGTA 3H65A 4RLFA 1J20A 2XDAA 4QG3A 3K1ZA 1NKDA 3DCJA 3RRBA 4RK4A 1EVEA 5KMGB 1F4PA 1CFJA 1OF1A 1HOTA 2WAYA 3L5OA 1NT2B 3N59A 4HZUA 3IEXA 3UHPA 4O2BA 1Y82A 3PNPA 2FRDA 4REOA 1ANKA 2ZIAA 4X8HA 3IV7A 4Q4JA 3ZJZA 2QU7A 5AESA 3NVIB 3NPAA 4KAFA 4LOIA 3F7MA 2GJKA 3VQWA 2PGIA 4OH7A 1DLBA 4QX6A 4XLLA 2Y1FA 3REQB 1Q6YA 4HGZA 4WK2B 5F35A 3X1MA 2OP1A 3RIEA 5HZMA 1IV1A 2DKNA 2VFAA 3INTA 3NDJA 3I6ZA 3F67A 1GPYA 3P9SA 4LPSA 4UBMA 5ALIA 3KQQA 4PZZA 4R2XA 1D1TA 2QW1A 2WJHA 5T6BA 2FEWB 3DT6A 1IC6A 1PUXA 2ZSKA 3NW9A 4MVYA 4JI1O 2R7LA 4FX5A 1TLLA 1UJ4A 3AINA 2YSUB 3HA5A 3WWYA 2HLNA 1EYZA 4ZT6A 1IY1A 2NPOA 3ROPA 4GW3A 3SI7A 3JQ9A 4C0WA 5LWHA 1Z13A 3BWXA 4WEQA 1W25A 2PZ8A 3A1VA 2J3HA 4PLVA 1X1AA 5HCNA 5CDYA 1UBFA 1JHRA 5DNUA 1FRQA 4I0WB 5FV4A 3J81N 4CLOB 2HVYD 1E1QA 1GGKA 1WSBA 1ZAKA 3VYVA 4DR4B 2XWPA 3G88A 1Y3FE 2H4ZA 1UDCA 3HO1A 3DEFA 5ADHA 2NYRA 1PGNA 1GDHA 4PJ0Z 1ISSA 1H9AA 1TYAE 2JAXA 2N75A 3MPUA 3W3AD 4F5YA 4UV8A 3UK0A 4BUZA 2P1ZA 4EY5A 4ZEMA 3RRZA 4O4HB 2NSDA 5BNZA 1ZU4A 3WG7B 5GONB 1IWPB 2BP7A 4U63A 1EH5A 3MOGA 3FROA 4H35A 1VF6C 4IWYA 4Y0NA 2P2GA 2QDOA 3LOUA 3QI2A 4BFXA 2PUTA 4PLGA 1E4VA 2B6NA 3LWZA 5LU8A 4WD3A 3A1DA 3PTZA 2TMDA 2JEOA 3CG4A 4HH1A 4XM1A 4EO9A 5CRIA 2H11A 4E5PA 3QA9A 2UYJA 1ISMA 3DAHA 5B1AC 3QZUA 1J0DA 4C7OB 3GVXA 1GKIA 3Q6MA 4POOA 3UMSA 1NLZA 3OQHA 5AUQA 1V54B 2XNSA 3IAS1 4JYMA 3BILA 4M9ZA 4G0PA 1N6KA 3U9TA 4Q12A 1LPMA 3D36A 2PYIA 3SZLA 3WIVA 2X6RA 2XSZD 1C3OB 2E7ZA 5FCDA 4CDRA 1TPYA 1KIMA 1Y3BE 2B7LA 3WLQA 1E79A 5IDJA 1XNRO 1D4ZA 1M2OA 4GGMX 4REQB 4BO2A 3GZ4A 1AI6A 1CUXA 4K6GA 4E5UA 1GRNA 4HB4A 1IHDA 4RHEA 4CJXA 1N0UA 5KTOA 2Z3VA 3KXIA 2Y0DA 2W6ID 4WKPA 3BGWA 2UXCB 3RVJA 1LD3A 1GZVA 4R9VA 1E9AA 1MG0A 2AKYA 1Y80A 4HS4A 3CRAA 3T61A 1NQTA 1FFCA 2P75A 1ARZA 5HZKA 1IBKO 1R74A 1OLOA 3F97A 1JA8A 1NHGA 1TZJA 1SCKA 1UK7A 2WZQA 4RFVA 3K0TA 2QGFA 4PA4A 4Q4DA 5JFGA 1I10A 3K4QA 3AG4B 4X1IB 1DG9A 3FGOA 1MEJA 4L78A 3I8OA 4ZQHA 2HP0B 1A5AB 1Y67A 2JJYA 2X4IA 6YASA 2JFQA 4UXJA 3LX6A 4TMFA 3U4QA 4XH9B 2WM9B 3DXRB 3MZ0A 2FUEA 2H9AA 2DN9A 4J1SA 4OHCA 1N6RA 2PSHA 1T35A 2X4DA 2PGNA 4Y2SA 4ZOEA 3B85A 1GDDA 5JHGB 3P94A 3UC9A 3RWMB 3FAKA 3OPXA 2EDCA 4K9PA 2POCA 1LS1A 3Q3IA 1U2GC 1WCIA 1WB7A 3DVRX 3PXAA 5JCXA 2F7SA 4YJDA 3W5DA 1T25A 1N36B 2GXAA 1N0NA 1QGED 5IT9M 3T7RA 1WY7A 1ZOSA 3KCNA 5L7YA 5T3YA 4NTWA 2C84A 1W75A 3BCRA 5AXAA 2GZAA 2P3QA 2BDUA 2RQ6A 3L4EA 4KU4A 5FOXA 4FCTA 3RK4A 4E6PA 1F0PA 5ABPA 4QFCA 3AEXA 4P83A 2XZOA 1HSZA 4ZVPA 1I2CA 3P7MA 1SZTA 3FYEB 1CR2A 2QG9A 2LTAA 2Z5UA 3FUUA 3SPHA 1ZJYA 1M1KW 3LOQA 4LY3A 3RRXA 1RLJA 2M98A 4CF5A 1C8LA 5FLKA 3I9LA 2MSNA 2D3TA 2QSYA 3E89A 2KPOA 3B1JA 5DBEX 2QQ5A 2YNMA 5H82A 5A02A 4PG7A 2B4KA 2H92A 3ZN2A 3IKJA 4E5MA 4JLUA 3L7KA 4ZEOA 3HE3A 3SR3A 1VIYA 1FTWA 2QMOA 4QTXA 1EQAA 1RWBA 5CVEA 2O8CB 3SBDA 3MB5A 1CF4A 4B4OA 2DTXA 3F2IA 3T1CA 1ZM9A 2C4UA 3OT7A 1XVTA 5DBGA 1Z4OA 2FMXA 3D1JA 4JC8A 4TXJA 3V7WA 1KI1A 4BLQA 5I7UA 1NVKA 1Q7YH 1OAOC 1CF9A 4TRJA 1N36O 3KXKA 2AIRA 2QP9X 2YCBA 2HRCA 4ZAVA 3W5IA 3D3EA 3NUGA 1NRJB 3QOWA 1RLIA 3SFVA 4BBAA 1YB7A 1XIVA 5K3SA 2BZ1A 4AYTA 2VPTA 2ISQA 3G9ZA 3OOJA 4OQMA 1V16A 3AM1A 1VL8A 3ESRA 1JDZA 2RG7A 1ZQ1A 3FB4A 4D41A 4IJQA 1YDEA 4AULA 1RM4A 1G59A 1ECLA 4ZXPA 3RG2A 3CF0A 3IC5A 1U2SA 5TSDA 3ANMA 1U6IA 1NS1A 1HDGO 2NXJA 4GI5A 5H3HA 4MP3A 4C82A 3TFWA 5IKMA 4KXYA 4CEJB 3AG7A 1ZI9A 2VO1A 3GUZA 3GJSA 1XL0A 3PC6A 3E4CA 3WL7A 1JHOA 5E1MA 4EYKA 2JHPA 1GY8A 4U6SA 2ZVJA 2D1SA 2RGEA 4JI7O 2HWXA 1T9DA 2JLQA 2RK4A 3LT4A 3TJRA 4CLEA 3O21A 1HNXO 2WT9A 4AL4A 1W0JG 2G9IA 1Z16A 1Z4KA 3UVEA 2B8JA 2YFYA 1MN6A 1SZDA 3E9QA 5JDIC 1Q3HA 3ZBHA 4ZHWA 4N5MA 2VK4A 4HQKA 5A6VA 5G0UA 2QVBA 2G4VA 1K86A 4FYHA 4N8SA 4PG6A 3SPGA 3K6SA 5B1IA 1WOMA 3AG6A 2XVMA 2YS7A 1XMOB 4KUHA 4PYNA 1Y5LA 1NC3A 3L5KA 3QXJA 4ZOAA 4KACA 3C7TA 5EGSA 3VV2A 2DWDC 3V7NA 3WV5A 4C20A 4ZYZA 3ZUGA 2X8WA 3HI4A 4Y7CA 3OQPA 2F4NA 2OK7A 1W6RA 3UCSC 1WUIS 1Z2AA 2PQ2A 3CNQS 3GUYA 4ND4A 4W5WA 2FQXA 5ALUA 4LYAA 1J0BA 1HC7A 1DEAA 4GKJO 1UOEA 2VF5X 4YRNA 4O59O 1I7QB 2IRWA 3LSUA 3DLTA 4RVDA 1JBEA 2HLHA 1AO3A 1LF0A 3TBKA 4DO2A 2C7GA 1K66A 1ABEA 4HLUA 2IZ1A 4G1MB 4MZDA 3U48A 1XPRA 3G7UA 5ITWA 3T1TA 3AVXA 2Y1DA 1HLGA 3ZO8A 2J46A 3M70A 3R0VA 3EVTA 1WPQA 3N75A 4JI5O 5DCVA 2X41A 1VB3A 2VDJA 4HAUA 2Z09A 1T8YA 1NBOA 5LDHA 4F72A 1X9IA 2YQ5A 1E9EA 2F1HA 4YDHB 2FLWA 1W3EX 2OUKA 1VQ5F 2IC5A 1APBA 1KNQA 3I52A 4RTLA 4Q39A 2PUEA 3RVKA 2N05A 3VOAA 1YDGA 3OGIB 1M76A 1E1KA 1KARA 3A2MA 3G2HA 3ND8A 1E9SA 1H6BA 5AJZA 3TR0A 2QPLA 1L7EA 3MWDA 1DKOA 1QC5B 5E2IA 1XTBA 3T80A 2OORA 3A7DA 3ABZA 1WAMA 1P0CA 3FUWA 3WK9A 1E2LA 3EVNA 1D4AA 3QFCA 2GJ4A 4BY9E 4K2HA 4LCUC 2AN1A 2WIGA 2WKPA 1ZPDA 3KWJA 4UJ5A 3T5TA 4KZKA 3ETHA 5JMWA 2E3JA 1F51A 1KO1A 4HWOA 1BEZA 3BTSA 1U3TA 2EX4A 4MYDA 1I2ZA 4X71A 5GGXA 4ZZ3A 4IICA 5DE3A 2BM9A 2NYAA 3VGPA 4J29A 3C7AA 3UMYA 3EA5A 4GMHA 4MVJF 4QGHA 3T3NA 3UO3A 3HFGA 2H85A 4LRYA 3RN4A 1JR3D 3AL2A 5A4IS 1JJOA 3GQBA 1L6IA 3TZEA 4LJ7A 2C9DA 2IXEA 2ZRLA 1KDOA 4YP1A 1RZ3A 5KUTA 1CJSA 3UMBA 1FQWA 1XFAA 2IBZH 5CB4A 2NZ2A 4N03A 3UO8B 5DTIA 3IOCA 4DEYA 3AERA 4CIAA 3MTEA 2V6JA 3WZMA 2X5XA 1ZGAA 3M4ZA 1GNLA 3WPXA 4FR0A 4I8IA 1DCMA 5E0KB 1SKAA 3ETDA 2Y05A 1SD5A 2UUOA 3BX1A 4FD3A 3WIDA 5DHTA 3K4PA 3Q3JB 3AJ9A 4JAAA 4CMBA 3OR6C 4FUTA 2EQAA 4MWCA 1BJRE 1YBMA 1U3LA 2JANA 4JC5A 4D98A 2OXFA 4KVAA 4Q4CA 2GRAA 2QTFA 2PUFA 3TZLA 1G5IA 3DEJA 1SKVA 2H2DA 3BXOA 3L8EA 1MVLA 4IH1A 5CX1B 2AVNA 4B6EA 1XI2A 1ISJA 1KYVA 1Q2UA 3R7BA 4NNOA 5KSOA 1N6PA 2JRCA 4FR5A 5DT9A 4DDVA 4KRYA 4C7KA 2PX0A 1PJ4A 4URHA 5ELMA 4WZAA 4JQCA 3I55V 3N28A 4RA9A 5C4GB 4EM6A 3KHTA 3DMTA 3DP9A 1SVSA 1KIAA 4FYXA 1NW8A 2QL7A 4UVEA 2BOVA 3GCWA 1LVHA 3TD6A 1AHPA 3AVWA 4TXMA 3G0CA 2JNWA 2UYQA 2IEIA 2XAQA 3P0IA 3OM9A 1ODCA 1SCQA 4CKCA 4EDHA 4EENA 3NEJA 3AF1A 1TVEA 3NYWA 4R68A 1VIAA 3TLAA 4F8YA 1SK9A 4JY7A 2ZRKA 4CZZA 1FDTA 3SXJA 2I2AA 2NU6A 1PZHA 1YR6A 2B98A 4LJKA 4P35A 3JVEA 3CA8A 4O3MA 1KDPA 2ZZKA 3OJ0A 4RKQA 1EG2A 1Z33A 4R7TA 4JU8A 2ZETA 3WGKA 1F5SA 3CRW1 3OZVA 3WB2A 2JVKA 1GPWB 3TQQA 3TQSA 3U0OA 5G2OA 4EK9A 2VP4A 1E7YA 2AN9A 2I7VA 3SYRA 3IBFA 1HE2A 1UXJA 2ARHA 1PJQA 3VPAA 3KQVA 5C9ZA 4TMKA 2G5TA 1P9RA 4P3KA 4Q9IA 4LQ4A 2AEFA 1ODFA 3FB6C 4M36A 3GMDA 3CUVA 3H1KH 5T57A 1SQ6A 1DRJA 2CN1A 5ADWA 2P4EA 1ZHFA 3BEDA 3DW1X 5KNCH 3H1FA 4LHSA 5F4ZA 5B55A 5ENVA 2BF4A 3GAFA 2BBWA 4QSMA 4L85A 1XV2A 1YK0A 1JFFA 4JI6B 3EVFA 3OMNB 3IJ5A 3DFZA 3ORHA 3HPQA 3KWLA 2VJMB 1FB5A 2EZOA 3HR8A 2ESRA 2PMWB 5JD3A 3AHEA 1YVPA