5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
5JH7B 1TUBB 3JASB 5LYJB 3RB8A 5M7EA 4X1YB 3M8KA 5J2TA 5JQGA 3WGMA 3VOAA 4O2BA 4YJ2B 1Z5VA 5LOVA 3HKDA 3RYHB 5JCOC 4O4HB 4O2BB 3HKDB 3RYIA 4X1IA 4O4LB 2R751 3JAKA 4ZI7A 4IHJB 4X1IB 5GONB 2VAPA 3CB2A 3JAKB 4HNAA 4ZI7B 5FNVA 2XKBA 3RYFA 1JFFA 3JAWA 4HNAB 5CB4A 3WGLA 1OFUA 2Q1XA 2BTQA 3JAWB 1W581 4O4JA 5JH7A 3VO9A 2BTQB 2GVIA 1RLUA 1Z5WA 3E22A 4FFBA 4O4JB 5LYJA 4X1YA 5KX5B 3E22B 4FFBB 2RHJA 4TUYB 4YJ2A 3HKEA 3N2GB 3N2KB 4XCQA 2VAWA 3RYHA 4KWEA 2VAMA 4O4HA 3HKEB 2Q1YA 5BMVA 4TV8B 4O4LA 2R6R1 4I55A 2RHOA 4EB6A 4IHJA 5GONA 3HKCB 5BMVB 5CA1B 1RQ2A 4I55B 4EB6B 4WBNB 5EYPB 5LP6A 4M8IA 3M89A 4EI9A 4I50B 5LP6B 3ZIDA 4IIJB 5MN4A 5J2UB 1FFXB 3HKBA 3HKBB 4ZHQB 5KX5A 3RYCB 4TUYA 3WGJA 4EI7A 5JVDB 3C8LA 3N2KA 3N2GA 5MN5A 5IYZB 5IJ9B 4DRXB 1SA0B 3JALB 1FSZA 5IJ0A 4O4IB 4TV8A 5CA0A 4TV9A 5IJ0B 1W5EA 3HKCA 3VO8A 5CA1A 1W59A 5CA0B 4TV9B 4B45A 4WBNA 5EYPA 2VXYA 2BTOA 4I50A 3VOBA 3JARA 4IIJA 2RHLA 4E6EA 4I4TA 5LXTB 5J2UA 5KMGA 3JARB 5JCOA 4B46A 1FFXA 4I4TB 4X20B 5KMGB 4O2AB 5LA6B 4LNUA 4ZHQA 1TVKB 4YJ3B 4X1KA 3RYCA 3ZBQA 4LNUB 5JVDA 4X1KB 5IYZA 3ZBPA 5LP6C 3WGNA 5IJ9A 2XKAA 5J2TB 5JQGB 4U39A 5EIBC 4DRXA 1W5BA 1SA0A 3JALA 5EIBD 5ITZA 4O4IA 1W5AA 5EZYA 5LOVB 4EI8A 5ITZB 5EZYB 3RYIB 3WGKA 3VPAA 4F6RA 1W5FA 5MN6A 3JATA 4ZOLA 3UT5A 4DXDA 4F6RB 5LXTA 4U3JA 3R4VA 3JATB 4ZOLB 5FNVB 3UT5B 3V3TA 3RYFB 1JFFB 4X20A 5C8YA 4U3JB 5CB4B 4O2AA 5LA6A 1RQ7A 1TUBA 2RHHA 1TVKA 3JASA 5C8YB 4YJ3A
chains in the Genus database with same CATH superfamily
4DSTA 4JKYA 4CLXA 5EWMA 1E2FA 3MB8A 1E9DA 3ZHUA 2WR8A 3MELA 3ZR4B 2Z3ZA 1FFGA 2XUKA 3TBFA 3JAWA 3MUOA 3PP8A 1XRLA 5SY9A 5F4BA 1W581 3C6ZA 4IDAA 1DEKA 3IALA 4UULA 1DP4A 2N48A 1U3DA 2N05A 5TVGA 1Z4JA 4G23A 1FW8A 2WWFA 2ARHA 2H06A 5L4NA 3OM9A 1T1EA 1TYDE 4L5YA 4B6RA 2ZTMA 1YZYA 5CAEA 3DP9A 5EMKA 2W2KB 1DV1A 4GR5A 1JEYA 1YZNA 1E0JA 3EBLA 1CJTC 3T3MB 4WNAA 4PPQA 1WCYA 2FKNA 2Z01A 2HF2A 4QOSA 2IU6A 1TF2A 1NTKH 2H59A 4HAUA 1I4TD 5IK2D 2BE3A 4RH3A 3CCFA 1RWBA 4NOLA 7ADHA 1BZKA 4R0NA 4CW7A 5CBFA 4G1CA 2DQSA 1GGNA 1P7PA 4L8JA 5H81A 1JU3A 2AH5A 3GJ6A 3QI2A 4ASUA 4HDKA 3VYVA 3KLNA 3O8DA 4RORA 5L3EA 2JAWA 2FSVA 3OSZA 2VDNB 1E0AA 3NMUC 1GPH1 2XB6A 3O8NA 3GUYA 3CCMV 1WJZA 3NNNA 2JFBA 4DBLE 4K9SA 3DXFA 2K87A 3WJQA 1L5ZA 3F97A 2GJ4A 3K5HA 1RXUA 2DR3A 3HUDA 2BRUA 2GUZA 5B3SB 1W19A 2BTOA 2D5CA 4H37A 2WHYA 1CQIB 4XUEA 2YXLA 1X6VA 4MUKA 1TLTA 1X77A 4CQNA 3QYPA 1KSHA 1TA9A 1DOHA 2PYZA 4ZC8A 2DYKA 3U17A 4QELA 1EMDA 3ELBA 4WXRA 3MCUA 4E6PA 2CH7B 5CNKA 2OGUA 3NDIA 5KTPA 3DLBA 4AY3A 1P1BA 4NU5A 3LHIA 5L3ZA 4I4CA 3Q0TA 5IHXA 2QM0A 2OZBA 4GLOA 4BNIA 1RR6A 5HIKA 1XTIA 4YIPA 4KKXB 2EHDA 3W8NA 3UNXA 1SUAA 1GAXA 4Y9SA 1C0EA 1XCBA 5KOJA 3F6BX 4YGYA 1K9VF 2QSZA 1JXOA 4RXTA 4MQBA 2VOEA 1ZSPA 2WHRA 3BFVA 3JY6A 1U63A 1AQIA 4OGLA 1NN0A 3IVXA 4LSGA 4YJDA 2FE4A 1BFUA 3IPLA 5KNLA 2HA3A 2I2XB 3SKXA 3ZMZA 5GOTA 2G77B 5A2QM 3WTBA 1PFVA 3L7AA 4PYOA 1OA0A 1L9XA 1DBQA 5GJBA 4J0CA 1D9ZA 2WYHA 3CCLF 2HQRA 2WJGA 5JAQA 2XBUA 1TDJA 1JPUA 4W9NA 4NTWA 1XI2A 1V54C 4PC2A 1K08A 1E3WB 4OATA 4N4AA 2J6BA 4DLLA 3LSSA 4HSGA 5BSRA 4WCEV 3NKFA 1IU9A 1E4YA 2HR3A 3FPLA 4NBNA 5IAJA 5LZ7A 2Z83A 1YU6A 4BOYA 5EMMA 3DAYA 3VRHA 4IDGA 2GTHA 5DLEA 6LDHA 5CD9A 1MO2A 3W34A 3VIUA 4NOMA 3UM7A 3L5KA 1G6HA 1XTTA 2I2FA 3TQQA 2JLQA 2F9MA 2G25A 3QPBA 2I1LA 1XNHA 2AI2A 3INTA 3U26A 1N75A 3QUQA 1KHHA 5FTWA 4MVJA 4BJ3A 2BE7A 3VMFB 3AFNA 1JT2A 3RTBA 3FKJA 3FAZA 2IQQA 3E9NA 2HHAA 3VHXA 4CR7A 4X7BA 2R85A 1IOWA 3WSWA 2NU9A 4WLNA 3AXTA 3RYIA 4X1IA 1FXKB 4CEHA 1KO1A 2J3EA 3FROA 2CF5A 4CVNA 4BNMA 3D64A 4U5XA 5IM5A 4CL8A 5AM1A 2NSDA 1BYUA 4E11A 5JZMA 2PN1A 4AJPA 2OGZA 1JI3A 4OAOA 1WB8A 3F0GA 1T5OA 1R3JC 1Y8QA 2YV3A 3K0AA 1FMCA 2XEDA 2BR5A 1QOZA 2VSQA 1P6QA 2AOUB 4FDVA 3KZVA 3ZWVA 2I29A 2QL6A 1FXWA 1CW2B 2AMYA 1L8AA 1G7TA 2PZEA 4BNGA 1OBVA 1PR5A 3BXEA 5GGXA 5LGNA 2Q6TA 1RXEA 1J56A 4QRDA 1EU1A 4C05A 4D9BA 1ONBA 4IZOA 1PWXA 3H5WA 4AMBA 4MV6A 3QIVA 4KXYA 1HZJA 4YB8A 2XNDG 3SDLA 4K9OA 3MGGA 3AILA 2CCJA 3R0ZA 1LI4A 3MJHA 2VEOA 4IILA 5IJWA 3K5NA 2DBQA 2RB9A 4ITRC 5ELLA 5BR4A 5B57C 2VUSA 1HK7A 3W2GA 1G7SA 1JAIA 1S72F 1QZUA 2ENWA 1CEQA 1IWOA 3AHHA 3H1KH 5FH9A 2CHEA 5TPWA 1GZSA 4ITVA 2Y99A 2CHVA 4BQOA 3IR7A 4IG9A 3TMKA 5DIZA 3ABLB 4IDEA 3K4QA 4QG3A 3AJ9A 2XVZA 1U28C 5THKA 1KH2A 3AESA 4ZHSA 4DLVA 2IVFA 3T3HA 5KJCA 4WNIA 2AJLI 3X1ZA 3RRFA 3R4VA 2WU3A 1YRBA 1AO0A 3PZBA 2IH4A 3NHZA 3O8QA 4LI3X 3V48A 1NXOA 2WG1A 3H11A 3OJCA 1YOVB 3O94A 4LOHA 1PJRA 1TCCA 2R9IA 1G17A 2PNFA 3IPAA 4NSNA 3PC8A 5HIIA 1TZ2A 3RS5A 1SK9A 2C82A 1Z4OA 2CL5A 1A9ZA 3UMSA 2GAJA 5FL7G 3K58A 4W9RA 3UZUA 5C5IA 2ZE7A 1RDFA 1ZONA 1K88A 4PZ0A 3L71H 3I8OA 3FRIA 4K88A 3PGMA 3SJCA 1I3KA 3PXCX 3SZLA 3LT5A 1HT2E 1KU6A 4EJMA 5DT9A 1DPFA 4E2WA 1K7YA 4B45A 3WI7A 1A2BA 1IBSA 4F38A 4B82A 3OLYA 1L1FA 2PUDA 3REFA 3EOZA 1H1DA 1NVPB 1VK3A 4TSKA 1DT5A 3QE9Y 2BFCB 1G8AA 1VG1A 1RMTA 1Z6AA 1N1DA 4YXWG 1GUAA 4BZQA 5G53C 2ZJ8A 4W8GA 1UPTA 2ZIVB 2G5TA 3QO5A 3DHVA 2GBLC 3VQTA 3K57A 5FUMA 3K73O 3WXMB 4P7GA 3V33A 3GFFA 3ENNA 1N5LA 5CM9C 4BAYA 1M1NA 1TQ4A 1GV0A 1E1LA 5HQJA 2OXIA 1YNOA 3KKLA 1P0IA 3OQIB 3CUWA 1KC8H 4PQYA 1NRIA 1GUBA 4YQEA 2DYYA 1D6JA 3IBGA 4TT3D 1V9CA 2X1LA 1I4LD 1RWPA 2FN4A 1O97C 4G0OA 2SCUA 5L9AA 1LCIA 3LC1O 2R8BA 4C8GA 1J42A 2XADA 4W5RA 3JQAD 4AP6A 1I5XA 1WY5A 1ZSVA 1KDPA 4P8RA 3CJRA 3ASVA 2AEFA 2V7VA 2VJAA 3R3JA 2BSKA 2GMWA 2IFTA 1K98A 4XJSA 1KQGA 1I80A 2HH9A 1DBRA 2XNDD 3E83A 3B7WA 4OLAA 2GCOA 4Q39A 4P3KA 3A11A 1FRNA 2P3OA 4FYKA 5LP6F 3D00A 3IEUA 4DDVA 1JALA 2AOWA 4E5MA 4G37A 1CJBA 4G67A 1EHIA 2Q5QA 1WRBA 3W7BA 3KWMA 1K4KA 3RYHB 1SXJB 4GYJA 3EVBA 4MLPA 4MS1A 5B58C 4KFSA 2DKNA 1V2GA 4FMBB 4EAQA 4E1VA 5B1EA 3RR2A 3Q2KA 1QJ4A 2A9HA 3RJ9A 4F5ZA 1LBEA 1DB3A 3C90A 3HH8A 2YKGA 3HVHA 2NLOA 5DU2A 3H8JA 4P0TA 4YCBA 2NXCA 3RT3C 2JAPA 2FN3A 3JSLA 3EVCA 4EI7A 1KUQA 3SJUA 1CUHA 2K5UA 1GYPA 3B2EA 4G0YA 1Z56C 2ZRKA 2O59A 2X0FA 4JXJA 5I01A 3KD2A 2G0TA 2ODMA 5G4KB 2ZIMA 2EOAA 4G3XA 2DG2A 2J6HA 1DT9A 4QYXA 2EZ8A 4CUKA 4KQ9A 4Y2XA 3AVWA 5C3UA 2P5YA 2RCVA 1H2MA 4OLBA 3WK4A 3B6ZA 2D3WA 5GTIZ 1EVEA 4XX0A 1X1QA 4B1FA 3JASB 4NRDA 3AR8A 5LQMA 5LBTA 3CLSD 1YASA 4AS1A 4TSFG 4F45A 3IJEB 3W7XA 1PWHA 1XXHE 2AR7A 4H4CA 3FDXA 1T4CB 4RBNA 1P8AA 2OXTA 1S2OA 1RRCA 1Z06A 2AX3A 4TTJA 5KOHB 3I32A 2GO1A 5EESA 1EXNA 3U4HA 2KI5A 3BGWA 2B8TA 3EMDA 4A5UB 5ALZA 3FMVA 3BWMA 4XAQA 1FSPA 4XVQA 1ZW6A 2ZB7A 3B3AA 3R3ZA 4TXNA 2AFIE 4NH4A 1QVFU 1OWPA 3L7MA 4DR2O 5IARA 1ZHHA 3EXG1 2XLCA 4DMKA 4JOQA 1K5QA 5AI5A 4ZYZA 4CRWB 2CVFA 3VKFA 2O07A 5JVDA 4ABYA 3W8FA 1NG9A 2QTSA 3HDTA 1FTSA 2Q3MA 1UBTS 1LA2A 4EGSA 1WPXA 1JG7A 1P4GA 3IMKA 2VQEB 3ZWWA 4BNHA 5H7XA 5HJ2A 1YUMA 4CIBA 3EZ7A 1N6RA 3C9UA 1R3UA 3LQFA 2CV1A 4J7XA 2OCAA 3NIGB 2R4QA 1E1RD 5GINC 4PR3A 1QDLB 3NGLA 1O5OA 1RYZA 3EQZA 4IWNA 3WMFA 2X0IA 1EX7A 3I34X 3RFFA 3DLPX 2Z6UA 1VCOA 2AG8A 1VJ0A 1AQYA 3LVQE 3HCBA 3M34A 5TARA 3IAUA 3TSAA 2AQHA 2P2CA 1DKPA 1P0MA 5FJ4C 2EF0A 4LV6A 1OIWA 2ODTX 1N6OA 3QVWA 5EQTA 4IIJB 1A9RA 4F97A 3WG9A 3WFVA 3OUZA 1O6FA 2PY6A 3PL5A 2X7RB 2HADA 1ZP6A 3QE3A 4GZRB 1WY7A 2ZUCA 4JI4B 1W85B 1WL8A 5B1AC 4N0MA 4UTRA 4DV0B 5LNK1 4A0RA 1TU3A 2Z1NA 4IEEA 3UENA 2D0OB 5HS4A 1E99A 5DJ5A 4KPFC 2F7SA 2V5VA 1QR9A 3FETA 3DCYA 4DM7A 4HPJB 4HX9A 2FTKE 4IRXA 4HDAA 4MGIR 4CN8A 4NEHB 4G0UA 4LZWA 3I1JA 4F4LA 4MGHA 2IXBA 3GVHA 2Q62A 2N1MA 2M6KA 2CDYA 2VAPA 2NM0A 3K30A 1XZNA 2J0SA 421PA 3D6MA 3ABLC 1T9BA 1ENVA 1LS6A 2Y2UA 3FCUB 5JROA 2VXCA 2NWQA 5EJMA 4NV1A 2HLNA 1CYEA 4MTCA 3DUWA 3DE4X 3IC5A 4GPBA 3PPVA 3ZX4A 4AQ7A 4G1MB 2EFHB 2PWAA 4YASA 4OGFA 2G7ZA 1YL5A 4BPRA 1HG1A 4QTYA 3K6JA 3DAOA 5KAPA 1AV6A 1VQ4V 5BR1A 2VC2B 4TMZA 4YAUA 1B1AA 4GHWA 3FRJA 3CEHA 4YUWA 5DTIA 3UGQA 3QYJA 5DV9A 4CC5A 2WT8A 1NASA 2X4IA 2YXYA 1ARZA 4LWSA 3B1XA 2I87A 4MCHA 1ZN8A 3PWTA 1SQPH 4DAOA 3WRVA 4HMPA 3KB6A 3F8WA 4G41A 1ZM7A 5TT0A 1NMXA 2IHBA 1MABG 1SQ6A 2WYOA 1DTOA 1O77A 3MAJA 1SFRA 1A9OA 3IL2A 3ONNA 3UOAB 4TKMA 1FMJA 1MQ8B 1ZMBA 2JGDB 2VHZA 3AF4A 3CCBA 4PLWA 4LF4B 4INZA 1NOJA 2ZB3A 3HGMA 4PG4A 1V9LA 4RZUA 2YXNA 2H85A 4I8IA 4H60A 3B4SA 3RJMA 3EH2A 4X65B 3OMLA 2PWZA 2Q0OC 3MRSA 1QV6A 2HZ7A 1FP2A 1ES9A 3TG2A 5HNKA 3BGIA 3UM9A 3ZZ1A 1IY9A 2NU6A 3Q41A 2EFDB 5C1PA 4EHNA 3Q7EA 1JR3D 2JEUA 1E1DA 1F5SA 3B6IA 4XM0A 4F5YA 2VBIA 2M32A 2WYUA 4UCUA 3EHEA 2W90A 4MS3B 4CKEA 5H3HA 2F9ZC 3C43A 2QLNA 2GV9A 3OTGA 4B8ZA 3P10A 4F71A 1C29B 1I36A 1F38A 2XLBA 4M9ZA 2D62A 1Y6JA 4WERA 5DEOA 1DRKA 4AICA 4PNEA 3HSSA 3L8CA 1W1IA 4J42A 4E22A 2OKCA 3L4JA 2WIKA 1KI3A 4LJ8A 1R00A 1MT3A 3I4CA 2Q07A 3A3PA 2QTVB 1D2AA 2P7IA 5EE5B 3ANLA 2O8CB 4JBXA 4FEEA 2IUUA 5HA5A 2QPOA 1UXJA 3W78A 3GGCA 4RWUA 3GG2A 1PSWA 1AMNA 1SXJC 1YB2A 4YRJA 1V71A 1ICEA 1L5YA 4H1HA 5HZHA 3UTCA 1CS0A 3WWOA 2HJ9A 3M1AA 4OJNA 3GUHA 5LBQA 3ZLVA 4R9RA 4J80A 3T4XA 5KLVH 1KOJA 2FSFA 2HV8A 3V4SA 1NKSA 3D1LA 4M1ZA 1HGXA 2IKSA 1YJBA 2XMSA 3ZLJA 1GL6A 2PCLA 3L7JA 2F8MA 4TN5A 3MIZA 1SCAA 3QHAA 3BHMA 2PEZA 3A1WA 5CXSA 3WYAA 5KPDA 4XXHA 2NVOA 4XJVA 1U2TA 3KXLA 1NW3A 3RVPA 4AG6A 4BU1A 3CXRA 4QBIA 1DTWA 1XNRO 1GSOA 3L6BA 2OO7A 4JCOA 5EC8A 1JTFA 4ON9A 4IRMA 3G6WA 4M2LA 1CY1A 1VI6A 4MULA 5HFJA 1D2GA 4BIUA 4JBHA 1XHOA 4BZWA 2C5SA 3IUEA 1K3TA 3CMAV 2GBPA 4M1KA 2YHSA 1SBYA 3LT0A 2QWOB 5GPBA 1U3FA 2EULA 3W5AA 2QBYA 3SXUB 2HEPA 4L74A 4EJSB 3HJHA 4D6XA 2FGYA 2WABA 2OG2A 2VJBA 4AZWA 2G9VA 3DXXA 5GONF 4A92A 2P2NA 3P5BA 3LU1A 2XT6A 2C20A 3B70A 2EGHA 1U6KA 2EQAA 3ZKWA 3SHWA 2JEOA 1YZFA 3FGZA 1P0CA 1BEUB 5HW0A 1CVLA 5B3KA 3W7SA 1PQ4A 1MJHA 2B94A 3KQOA 3GJSA 1VA4A 2RB5A 3LE8A 4TS9A 3FHCB 4G25A 3FFXA 3F71A 1EJ0A 2FEPA 1EP1B 1CY8A 4XYEA 5DPMA 3WWCA 2V4DA 2FPGB 1AUPA 1KMHB 2ZBFA 2RG1A 3JQQA 2ZRNA 4FC7A 4PAMA 4P5DA 1T2DA 3LX5A 5IX8A 2PEYA 2I22A 1E98A 2I6XA 4MQMA 3QUBA 5EVCA 3ZU4A 3Q72A 1XZJA 1PT6A 5L4LA 1Q11A 4XVRA 4LPSA 5F9FA 3KVOA 2Y92A 1WSBA 3C3EA 5SV2A 2OB2A 3SYOA 3K4PA 1HOTA 4PPFA 4NIMA 1GMGA 3A6GA 3BRCA 2Q4TA 1H2RS 3QELA 4EIWA 1I6LA 4LWOA 3WV4A 4MR9A 2EV9A 2AF4C 3FLAA 4B7CA 5DTRA 3ABMB 3AETA 4N65A 1UJCA 3K9HA 1EXVA 2RIPA 3Q3VA 1RC1A 5CVVA 4DCTA 1M54A 4E1AA 3JTEA 4BWYA 4DV2O 1SWVA 3GNTA 3GGOA 3K9LA 4D25A 2WF8A 1RYMA 1JVMA 3O1LA 5KNBD 4X3PA 5FX2A 5EJ7A 3D8UA 5DM0A 1H3NA 3G8BA 3EEIA 3BA1A 4C7VA 4EFMA 2VZ8A 1RZ3A 1T3TA 5BV8A 5C32A 1N2XA 3K16A 5JJCA 4FR0A 1O3YA 4AIRA 5B1YA 2G82A 4YRCA 4LV8B 3FYTA 2ZDHA 3D59A 5ILQA 1DAMA 4Q3LA 2Z2YA 3JATB 2ADQB 3Q1KA 2MYUA 1HR0B 3HDYA 5LYJB 4FOOA 3M1YA 1J00A 4QPPA 3L2OB 2C5EA 4MP6A 1VGRA 1IRIA 4MYDA 1QIDA 3AUSA 4L9WA 1EWTA 1JG1A 621PA 1ZLZA 5ARCA 1H2ZA 1QFYA 4FR2A 2HK6A 4ILKA 1C8KA 2UXBO 3C6XA 3FFBA 2R5WA 2WJVA 1SCUA 4BNYA 3OM1A 1JIXA 3PFCA 2UZ3A 2YCBA 1XKLA 3S5JA 1ZN7A 5F2OA 4JH0A 4WESB 2J5BA 3QVKA 4PQFA 4DPKA 3RKUA 2DAPA 4M0LA 5TQJA 3RUHA 3ZCTA 2C1XA 2IEYA 2FEXA 2MTBA 3JQGB 2CY0A 3CPWF 3W6UA 3R3UA 2IF2A 2JIZG 5KUMA 2WWIA 3BDVA 3W5CA 1PD0A 3KCYA 3GGDA 1EDZA 1F0NA 4QYTA 3DG9A 4PW0A 1LJUA 5IY5B 1RJFA 3HJRA 3EVDA 2QXYA 1BVRA 1QZ3A 5J40A 5FJJA 1JLLA 3ZIAG 1GM8A 4WXHA 2I1QA 2QL5A 4YT8A 4ZAFA 4B3HA 4O4JB 5KYXB 1Q3TA 2PWYA 1EZ1A 2XE8A 1AR5A 3NFRA 4F6LA 2Q8QA 5IXSA 1T9CA 3WFIA 4W9MC 4EJ0A 5JNVA 5K3CA 4N7RA 2GCNA 2VP4A 3SYNA 5CFQA 4W1RA 1G21A 2PZ8A 2QIPA 1ZBDA 3OQMA 3VR4D 2OHFA 2QJRA 3C24A 3JVHA 3O65A 1TX4B 3CU5A 2GLZA 4LC9A 3RFRA 4TZZA 3DBRA 2VG8A 3K0KA 2GN1A 2A92A 4O4IA 1ACMA 3W1WA 4B3CA 1D8TA 4DXDA 4UVBA 2Q1TA 4B80A 4B5CA 4A3SA 2R6ZA 2OK7A 5B53A 4UCVA 1Q84A 3NBUA 3FB8C 4RO2A 4FEAA 4CG2A 1PEKE 2GN9A 2AA3A 2NP6A 3FUCA 1LBSA 2P68A 3E58A 1FDRA 1IXKA 1TM1E 2ZJYA 3APOA 1B8OA 3KC2A 4KN8A 1TJYA 1P77A 1YR2A 4ZT2A 1J5EB 3PRJA 2JFGA 1ZUNB 2XOEA 4CNQA 1X7XA 1OH7A 1TUEA 2OV1A 1HLPA 2BBOA 2UXNA 2WKSA 4LG1A 3T99A 1FSZA 1JVSA 3S0WA 4EHDA 2FQQA 5L40A 3HDQA 1JJ2F 4QKQA 4LJYA 5E3HA 2QQFA 3K71B 3TD6A 1VRWA 2J46A 3FD6A 1RHKA 3ORRA 1OC4A 4DB2A 4GGMX 1S4MA 1TVKA 4Q3DA 3CD6V 5CFRA 3QUTA 3O83A 1AF4A 4K7JA 1US8B 4JN6B 2Z5LA 3WL4A 1TJPB 1L7EA 1D1TA 1SZPA 4C21A 3IBTA 4BNJA 3L70H 4OL9A 2R00C 5I6DA 1LC3A 2VLBA 2HXYA 1AF7A 2B61A 5HCIA 4CMBA 5CBPA 3L0CA 5BRAA 1MOSA 3EZFA 3SYAA 4BNUA 4R9SA 2V1UA 4RV4A 4H15A 3A6LA 2YV1A 3FKSA 1T2UA 2P7HA 1PPJH 3EE6A 4GYYA 4LKOA 3WO1A 1PS8A 2F4VB 1D03A 5JE8A 4S1WA 5LWQA 2PZFA 1CULC 3GUVA 4QJ4A 5JZBA 1KBQA 4M0EA 1M56B 4RSGA 2IH5A 5EKSA 4X66B 3SQMA 2PSFA 4QFDA 5IZCC 5EEGA 3DMPA 3OTQA 3PDCA 3O3MB 4MAMA 1Y76A 1EP2B 1QK4A 3FWZA 4WNYA 1JD1A 5E2AA 1DADA 1OXVA 3M6VA 1JRLA 1NVBA 1MJGA 4PYIA 3TTUA 3QLJA 4MGEA 5BN5A 3HI6A 1KEPA 4Z9BA 1E3IA 2FMTA 3DMTA 4G6ZA 3U4CA 5AESA 3FNIA 4NZMA 1GG2A 4URWR 1QONA 5EHXA 4NYJQ 3O8OB 2UUBB 2ORWA 3C39A 2IUYA 2ONYA 3DXYA 4NF2A 4II2A 3V7EA 1IJKA 6ADHA 4TMXA 2FWJA 3RFVA 3PYMA 3KSRA 5HUJA 5G02A 2IEZA 4IWXA 3IKFA 5BR8O 1F6DA 3FPAA 2EJRA 4DRXB 4MVJI 3KNZA 3O7MA 1SIBE 3QYAA 3BFJA 2ZQ5A 3L41A 2FYUH 3K5IA 2GETA 2W2NA 5HFMA 2AD5A 1VQKF 1KAHA 1HNNA 221PA 4E70A 3EC1A 4QX6A 1R4MA 4HXGA 4DRYA 2NVUB 5BMVF 2PGDA 5H9VA 3ABRB 4JI2O 2TMDA 3RYFB 4PNPA 3QMWA 1ECLA 2XD9A 4HXYA 4MV0A 3RLFA 3COWA 4DEXA 1OJ7A 3ZS8A 1GN4A 5HE9A 4HAMA 3RVDA 1UOEA 3VYSB 4CTOA 1IVYA 5IVIA 1TUGA 1P6UA 2B2CA 3KV3O 1ZPDA 3SSMA 2NO6A 2UYOA 5CYPA 4NBUA 4MW7A 2ETXA 2RI1A 1QLJA 3T5BA 3TFQA 4BNFA 4L9AA 1PTKA 3P0JA 4LVOA 2R0QC 1YOBA 4B4UA 3GNQA 4LJ5A 3INGA 4RQOA 3CC2V 3RUDA 2VVTA 1XTRA 3M3PA 1YQEA 5SY6A 3BAFA 3DF7A 3QFTA 1GPWB 1EX6A 4QYMA 4FK8A 4MUEA 1OJHA 2QQEA 3T5AA 2O4CA 2HJFC 1SMKA 5K0JA 3ZBQA 3VH4A 1XK7A 3FD5A 1Z82A 3VR5A 2BMAA 1X8LA 5K4HA 4PIMA 4JEMA 3JZFA 5HUQA 4QOJA 4YRDA 3HY6A 2NSHA 2F95B 1CEYA 4MWCA 1RJGA 4S1TA 3TR0A 3URKA 4HEQA 2G9QA 5CURA 2WUFA 2HSEA 4D46A 5DHRA 4D4LA 4DARA 3ZYZA 2Z30A 4JI7B 3VCZA 1ZMTA 1DKQA 3VTAA 2I65A 4GBMA 2QTOA 1NXTA 1MAWA 2WLLB 2NR5A 4FHFA 5L95A 2WI8A 1TZBA 4JI6O 2RKOA 4KRYA 4MWZA 5MN5A 4L3OA 5AUPB 2VDWB 3TIFA 5IY5C 3UATA 1H5UA 1I2AA 4EZEA 4KFRA 4KP4A 3Q6MA 4ZK6A 1JF8A 3D4NA 4WVLA 3OURA 3D5EA 4AKHA 5BUSA 3FSGA 4M87A 1VP3A 1I3OA 4XVHA 3A8TA 1R37A 4JBWA 1Z2DA 2CLLB 2FHPA 2GZMA 4ZZ3A 2I6RA 5EG5A 4TVSA 3ZGXA 1UL1X 4KQJA 5E6RB 4WH0A 5J1TB 1DGSA 2A79B 2UYCA 1ESDA 3TW8B 4E4RA 4ZN6A 4BGVA 3KEQA 3KX2A 3IVAA 3DTYA 1G5PA 5DI3B 4INAA 5HK9A 2V3VA 3S2FA 3TZEA 1J09A 1ZO8A 2YFKA 4J76A 1EYZA 2G72A 2J5XA 5B30A 1SZCA 1HH4A 3OCVA 4ESOA 4BUCA 2QJOA 4LY0A 3TGUH 3IEMA 3D2LA 2WTMA 3AJ8A 1YQTA 2BWJA 2RGNC 5C93A 2PKWA 2NO1A 5KWIA 2WJPA 4HNGA 1JLSA 4YALA 1YZBA 1KI4A 5A0FA 1X4TA 4G4IA 4DSZA 1UDXA 4LMPA 2PVSA 1NGSA 1B6GA 2C7VA 4GOKA 3LG2A 1W47A 3GFPA 2QM7A 1KJIA 4V3BA 1II9A 3ECCA 4GE3A 3BSFA 3PGA1 2Q9AA 4GP7A 2P9ZA 3DFKA 4U6SA 1AJNA 1RAGA 1DTSA 1P19A 2D7JA 1MW8X 1BXZA 4JLUA 1Z18A 1ZJYA 2MHCA 3KHUA 1SBTA 2PZBA 2V7QD 4Z2AA 4IDBA 1JIKA 4YCNA 2VGNA 1V25A 1K5PA 3QNUA 1LNZA 4GDFA 5IRCD 1NPDA 2E5FA 3EYAA 4EQZA 2V59A 3LWDA 3PPIA 5JEEA 1IBKB 2CEAA 1N7JA 2IYVA 3ZI4A 3OQHA 4YHHB 2HGZA 4Q93A 4TTPA 1FC0A 2DJ5A 3DBLB 4EJFA 4KAXA 2NYRA 2RGCA 5B1OA 2OQIA 3ID6C 3FWPA 3X1WA 3EDQA 1Y6QA 4B6OA 1KDTA 2B0CA 3LUPA 4UHFA 2GPNA 2WMDA 4BVQA 4NMMA 1U0LA 3ND5A 5IKOA 2XMRA 2B25A 3QH4A 1FEZA 3M5DA 4KO4S 4CM4B 4TTQA 3LKBA 4Q12A 1PVOA 3B85A 2AUMA 4PZLA 1DIOB 2N47A 1KQ3A 5DGCA 1VHAA 3LNNA 1DG9A 2Q2WA 1T26A 2X0RA 4PLCA 4QJIA 1X9IA 4I5DA 4ND2A 2VSNA 1QV9A 1KYYA 1L4FA 3FAVA 4JI3B 3V4RA 3MC1A 5KKCA 1J4AA 3RYCA 1HE3A 3OLQA 1BRTA 4GZ5A 3RIMA 5M2QA 3AXSA 2OHVA 5A1TA 4J2HA 5EE1A 3F49S 5F2NA 1WW3A 1WMEA 4KH0A 1COWA 1VBFA 3PFWO 3FY4A 4HWRA 3BFRA 4BVKA 2OD7A 3ZU2A 5KOIA 4BVSA 2XDYA 3JQPA 1JZTA 5TQ2B 1VQMV 4ML3A 1PWYE 3KYJB 1YDHA 1GO0A 1VI2A 4J4TA 4FS8A 5CJPA 1J0EA 1QVRA 3WLHA 4HTFB 4QL3A 5K99A 2HG5C 3QSYA 4ZQIA 1XCPA 5LP6A 4Z2WA 4C6TB 4DC0A 5KAIZ 2VYVA 4PAQA 1HFKA 1DRUA 1A96A 2BC9A 3HABA 2O2DA 1BMFG 2Q3CA 2NP7A 2CJWB 1F9EA 2Z0MA 2YMQA 2B34A 1K7SN 1ZUWA 1OTYA 2R6CA 3VYSC 3CBGA 1DLJA 3P2OA 3U4AA 2QX6A 4OMCA 1JKMA 3T4DA 2YR0A 2IXTA 4FFDA 5FFNA 4B33A 3WB1A 1SZDA 1E7YA 3DS8A 5ESXA 1V8ZA 3MLAA 4LOIA 2BHLA 3NB0A 1Z75A 4FMCB 3RC7A 4AXBA 1YJWV 3HU2A 3CF6R 3IODA 3NVKE 3G1UA 5TE9A 5ALDA 3EXIB 2PKQP 4YDQA 1WSAA 2C1ZA 1DAEA 3IOEA 2GEDA 4Q02A 1CP2A 3K94A 1RXIA 1WUHS 3Q3GE 2NVWA 4C88A 4HZUA 1L4EA 1EFPB 4IGGA 5E4JA 1ISMA 3I6ZA 3OZGA 3I6QA 1S89A 3L04A 2BHRA 2B98A 3I4LA 1ML4A 5JR3A 4BJHB 1G5FA 4MA5A 5AJHA 4CMKA 4XGIA 2QWPB 5BMOA 3TVTA 2WWYA 3GRCA 3BXPA 5DM6V 4I4IA 4BL5A 5FUVA 2G67A 1IULA 2BOBC 1KWGA 3CVUA 2ONJA 1B4DA 2YRXA 3ZV4A 2ZJ1A 4FKMA 4UVHA 3MILA 4G4JA 1OZGA 2QPAA 1IIBA 1IZ8A 5DHPA 3IQZA 1CV2A 1P1HA 4W5QA 1JT9A 5REQA 4C20A 2Q3JA 3AHCA 3F5FA 1CFZA 1JEAA 4HLNA 3UCEA 5JSYA 3GXOA 3AK2A 4RZ3A 4B7EA 2Q9LA 1ROPA 1L7NA 3LSUA 3UF0A 4ESHA 2GA9A 3DO6A 3RAPR 1RW4A 5DOZA 3VXKA 3G2HA 1SERA 4IG4A 5LWHA 1H2BA 2ZROA 4JB3A 4LF7B 4IDOA 4BJ1A 4C04A 3OOYA 3S1AA 2FN9A 4RWEA 5LPNA 1QSGA 1GTOA 1RI2A 2ID8A 5E1OA 4BJ6A 3M3HA 1BYIA 4XR4A 1VARA 1K73H 3MHSC 4I50B 4IMRA 4ED9A 2Q3EA 4AMZA 3JRNA 2EINB 2A33A 4BP3A 5EMJA 2J7PD 4F9FA 2ERXA 2VF2A 4B3MB 3CN9A 5AJXA 5COAA 1GU0A 3FFWA 2H2GA 1V8PA 4Q1BA 3QKSA 4G0QA 2J09A 5DM70 4AWBA 4DCGA 1CUXA 4OYYA 1V96A 2NYVA 3GFQA 2BEUB 4CLOA 4JQSA 4QUEA 1UJ5A 2O3QA 3VGJA 4JVMA 4YPVA 4MJ3A 5IUJC 3AP3A 2JEXA 2CHFA 4PO1A 1W7AA 3G5MA 4Y1RB 1OZHA 3BZBA 2ZITA 1PUIA 2UYNA 2QAJA 3EFOA 2WTUA 2JD1A 3PR1A 2I62A 4CL0A 2BSAA 1GPDG 3M5CA 1Z8DA 3AERB 3GLFE 3OJXA 4X97A 1MOQA 2FDXA 2Q5LA 4JEHA 4KDEA 2Z1UA 3ZE0B 2PD4A 2FUEA 3HXTA 1NN3A 4FVTA 2QUKA 5K2OA 1YJ8A 4RPJA 4EYKA 4FQ7A 2VEDA 4RTKA 1FW6A 3K7EA 1Q92A 2XA1A 3RNOA 1BMFD 2ZRPA 1KO7A 3CVWA 1L3IA 1SUPA 1OCRB 1NVWQ 3R5FA 5I51A 3OC0A 3EF0A 1J25A 5B2ZA 3VH1A 3UB3A 2BBTA 4WFAV 5IEJA 2OHOA 5IJ0B 2CFOA 4B3DA 2Q4BA 1DMSA 1Y63A 4YMTA 2IEGA 2FP3A 4IV0A 2E48A 3ZJVA 1H2AS 2B69A 3HWWA 1RYBA 4EH1A 3I09A 2DN9A 2PLAA 1R66A 3U3KA 3TLAA 3WRYC 4Z4FA 4PTZA 1VKHA 3O95A 2YYSA 2QUHA 3FPHA 4PPYA 3KRTA 2OQVA 5B12A 3AJDA 4Z0PA 1WZUA 4IGFA 1U96A 3AHIA 1OPXA 3T4PA 5GIPC 1G291 3V4OA 1KK1A 2WYVA 3HA3A 2FSGA 3QLUC 3AEUA 5D5QA 5EUBA 5BWMA 2QVBA 1M57B 3CCVV 5ECGC 2HQOA 1W2WB 2OCXA 4BQIA 1C9NA 4GOLD 4M76B 3RQSA 4TLAA 5J58A 1X80A 1DQNA 1JOYA 4P35A 1WF6A 5FOTA 5FEUA 2HF8A 5I9MA 1XPOA 2L17A 1IY2A 1PTJC 2H7VA 1T3GA 1SA0B 3JALB 2PQ2A 1WCIA 4E6EA 2WJ4A 3RCBA 3DKKA 2HXSA 5B36A 3OGIB 1X70A 4UBIA 4UCQA 2RAUA 4CKYA 4DIKA 4FX5A 1Y1KE 1EGVB 4O3MA 4JUBA 5DTMA 3Q7QA 4AYTA 3RKRA 4V39A 4PAGA 1RQ7A 4CNBA 2BLNA 1NLZA 2BGKA 3KVRA 3AL0C 1TW3A 1Q50A 1BKYA 1AGYA 3G2LA 5DNVA 1V3QE 1ZD8A 3BM5A 2WWHA 5BV1A 4LX0A 4YY3O 1OH5A 4ZWNA 3EGIA 3LUDA 4BU0A 1N8SA 2CFCA 1IG3A 1SXQA 1GEGA 2G9RA 1QH8A 2C2XA 1HXHA 3EDRA 1RP7A 4Y2RA 1REQA 5HP8A 1S2NA 1Y7LA 3PDHA 4B2LA 2O2IA 3J80M 1AX9A 1SC4A 3RBZA 3VU9B 4EEZA 1TK2A 1XNQB 2YXPX 3CJQA 2HP3A 4TYNA 1ZVKA 2A94A 3I3OA 4KQKA 3V1LA 3NDRA 1CZNA 2NV6A 2JLRA 1F51A 3UCFA 3MSXA 2N1BA 4MQEB 1XRNA 3NWEA 3RSHA 3OLWA 3AEZA 4L8WB 1X8XA 3H2YA 3QLTA 1EDEA 1VQ5V 5LD2B 3PQ6A 2H4WA 2CLSA 4LWPA 2XUMA 4KP7A 4UOEA 4QJFB 1DAOA 2AC7A 3ZHQA 4EELA 5C7YA 3WL5A 2V58A 1N7IA 1KJ8A 3HKEB 1OYOA 2ZRQA 3ZYCA 1SVUA 2WF6A 1SQ5A 1GZ5A 3QIAA 1T8WA 3CLUC 1KDYA 4PRLA 1B6SA 3C4VA 3OD5A 4RVDA 2ATKC 4OKSA 2JAHA 4OHRA 3P94A 1RU3A 4LF6O 4H7HA 3OLCX 3E7WA 3DJYA 3K6SB 4EDFA 1JQKA 4AZSA 1HORA 3LBNA 3N05A 1QQ6A 1E2MA 3QV1A 3LP5A 3PC2A 5TVKA 1X1SA 5I47A 3RFTA 3TYXA 1TAQA 1ATIA 1Y80A 1YBVA 2QNRA 5J9FA 5B3SC 1VLMA 4UXJA 4HGYA 3A0UA 1RWWA 4UC0A 1QQ7A 3TJRA 1XQXA 2J3JA 1VC2A 1N6PA 1Y1TA 5FV4A 2QL7A 4GSYA 5AM3A 2O52A 1J1UA 2Q1YA 3OQ6A 5GONA 1MNAA 2RMKB 4X6XA 3G80A 2V9ZA 4E5VA 5SZHB 1M8KA 3VQWA 1RM5A 3BA8A 4X85A 4MWOA 1E3MA 2NSJA 4RH1A 4Q6BA 1AJPA 1XJ5A 3JWGA 1PIWA 4CH3A 1F23A 2LO1A 4IAOA 1XVAA 1Y9DA 3OZTA 1M6WA 2HKOA 3LDTA 1A27A 1CD5A 1VE6A 4XGKA 2GQ0A 3C3MA 4DQ0A 1AHHA 2ZUFA 5A2QN 4AAYA 4LYGA 2BELA 4ZI3A 1HA3A 2PGGA 4TKUB 4YRZA 3EAQA 3MTIA 3OTFA 4AC9A 2QN6A 1KJWA 3GEEA 4G9EA 1NIJA 5DRYA 3VBEA 4KO2S 3I56F 2GD1O 3ISJA 2GZAA 4XD7A 4I66A 2XF2A 3OH8A 1GL7A 4MSUA 2EINC 2WKRA 1K6IA 4GL4A 4HEJA 3H1IH 3PHJA 1MB3A 1U0OC 1WJGA 1ZXXA 3VO1A 3WLSA 1F60A 3K1TA 1Q6HA 3LKDA 4I9QA 3OA2A 3W8DA 4F3KA 1FJGB 1L8LA 4IGKA 2BPOA 1GGHA 5LN1A 4BLSA 2WBLC 2C7BA 2EJUA 4NS1A 1JDUA 4DSAA 3Q8MA 1G64A 2ROQA 2HRDA 4L4RA 1BCRB 5CCDA 4EDHA 3NHWA 1YH3A 3OZBA 1KR5A 3EG9B 1ABBA 1RZUA 2FF5A 4MPRA 4S3MA 3JYQA 1YONA 1EN6A 1Z15A 2GZRA 5G40A 5HZKA 1ISFA 3TOVA 4WKCA 5FL7D 3WZLA 1Y6GA 4QARA 3CLTD 4J0GA 3ETCA 2VP3A 1GILA 1GZHB 3N0XA 2F55A 4GL2A 4C0QC 5EOVA 3OJFA 2GKOA 4PG8A 1TGYA 4BT3A 1KI6B 3IAS1 2GEFA 2CKMA 3MHPA 3OP4A 4P2BA 4DMGA 3KKMA 4WZBE 2G8LA 4MR8B 5LGUA 2JAUA 4ZAGA 4KR6A 1H8HA 3TLGB 1W4ZA 5FBLB 4RE5A 4L78A 2OA0A 1SU4A 4HADA 2PL1A 4YXWD 3PEVA 2BMDA 3DO8A 4RGVA 2WD8A 4I0XA 1F2UB 4MYUA 1V5GA 5DEIA 2VHVA 3GH1A 4ALNA 3O85A 4UZFA 4WXMA 2GCIA 1L5HB 4TYWA 1FXKC 5DSTA 2FR0A 1MVOA 1THTA 4DBZA 1KO5A 1S1MA 1WCV1 3DHNA 4G1UC 4FFOA 3EEBA 3NBZC 3TSZA 3T7CA 3SD7A 5JJBA 3LDGA 3PF9A 2BZSA 5CD1A 4CU2A 3N6XA 5DISB 4HH3C 1M57C 2XWQA 1JPJA 4YONB 3KE9A 4P82A 4G65A 2JEZA 3IQEA 4EKIA 2R6HA 2OHWA 3AEYA 3LVBA 4X1YB 1TCVA 5ALVA 4C0HA 1EWQA 3KAKA 2OAEA 3MBMA 4JLJA 3HWRA 1G38A 1EWVA 1C1DA 1QBZA 2P75A 2RJ3A 4O25A 4DCUA 1FVHA 1E6MA 3MSCA 3H9JA 1U3LA 2WINI 4IOJA 1ECPA 3S7TA 4OLFA 2HDHA 3HKBA 4E5PA 2IBTA 1BZYA 1O95C 5CX1A 3ZWNA 4YRQA 3ZE6A 2JLZA 5KUKA 3BMNB 4DJTA 3Q7RA 1E2EA 1NVXQ 4WAUA 2G6BA 1AM4D 1VF6A 4BEBA 1SJ9A 1B8UA 1Y8RB 1I4WA 1N9KA 1P1RA 5M3BA 3TZ6A 3MMZA 1T0HB 4F04A 2AN4A 1JKJA 4R69A 4YR9A 4PWTA 1V7QA 2VZ9A 5FI3A 1QVGU 4TT8A 3LXMA 3L6OO 2QLFA 1M74A 4I3FA 2IYRA 1OFVA 1BT8A 2QT1A 2CNWD 4PANA 2ZTUA 4PZAA 3HCCA 1P2TA 4I5GA 3T1QA 2A7QA 5CITA 2Z04A 1E2DA 1WF3A 2H07A 3GRZA 1MF7A 3ACCA 1AHPA 3RUCA 4GXQA 1ZMOA 2QE7A 2VQFO 1E3SA 4EKDA 4ND5A 3OICA 4GMXA 1CUYA 2DWEC 4NAVA 4HPXB 4TSFD 3OVMA 3KQPA 2DERA 4XH9B 5SZIA 4Z7NB 1TECE 2IOFK 1H0KA 1N33B 1Q21A 4FJCC 4DL9A 5A9SA 3TQTA 1KI8A 4MWBA 4M54A 4I08A 4P4LA 2QMZA 1P2UA 4MQFA 5FRDA 3DZHA 2BMJA 5KYVA 3JAMA 3RV3A 1OE0A 5SY4A 1JFFB 3T3OA 2YQ5A 1CR2A 3GFSA 4ZYXA 3P9IA 4I9NA 3GLIE 4Z4GA 3VZSA 4QNMA 3EPKA 3R7WB 2B33A 2D2FA 4ZTUB 1VHDA 1SQ0A 1EKXA 9ABPA 1HF3A 3KLMX 4OMDA 2Q1XA 1BWRA 1DAGA 1K75A 1Q91A 3NHJA 3SYKA 1E7QA 5A02A 4D4GA 4NXNO 2IKQA 3R0PA 3VOUA 2GOYA 1YVPA 5AKIA 2G5CA 4B6JA 2WNSA 4R2IA 2CYAA 1EP9A 5CEJA 3UANA 2LW7A 4ZIRB 3FBAA 5LMNB 3WRXA 5L6MB 3DD1A 3BD7A 3L1UA 5K03A 1RAEA 5JECA 1H0RA 4EO9A 1VKOA 4C4RA 3IT3A 3FTPA 3E20B 4KKVA 4OXQA 1YHNA 4TROA 4NJEB 1VE5A 5AK0A 9LDTA 2H1SA 3O9MA 1WXEA 3L1IA 2I2WA 3MRTA 2Q7DA 4BC1A 3TKLA 4AQYO 1XDBA 1GLGA 1JQBA 1JV2B 1SO8A 2H5IA 2X9QA 4RKFA 2A86A 3KEOA 4AMVA 1FK8A 1L5LA 4O2LA 5AKKA 2EFJA 1E5VA 3GZTB 4D74A 1XTZA 1RBMA 3G2IA 1ZMRA 1P9RA 4FLFA 1PDWA 1FPOA 3DOCA 1T25A 5HQTA 3B89A 2PO7A 1SKMA 1DGQA 1N4CA 3KZNA 1U04A 3M70A 2X42A 3EPPA 3W9UA 1NJFA 3SJQC 2CLCX 3KIPA 4RY8A 1D2DA 4G4ZA 4F60A 1P1IA 1PZMA 4NCJA 4QC2A 3OWHA 2Z1FA 3LRPA 2JCBA 4H17A 1DO2A 1YR8A 3M7MX 3NK6A 2HMUA 2MDTA 4X8LA 1NJ1A 3AFIA 4G5FA 3Q7TA 1XLTA 5T67A 2PUCA 3UT0A 2COKA 4DG8A 1QPZA 4BO9A 3QBDA 4TVKA 3WJ2A 1TIBA 2XOXA 1G3MA 3MMNA 2VK4A 2IDZA 2ZLBA 2VJCA 2FXIA 3LLUA 2P30A 4K9LA 4FLTA 4QVGA 5BMVA 1EDOA 2BT4A 1YI0A 3ICQB 2QU7A 4MYHA 4LN1A 1WDTA 1VQOV 4L5AA 2OFXA 3ENQA 2IH2A 3FSJX 4I1IA 2X0KA 2CNLA 3ZP7A 3DEFA 5KI6A 1JLKA 3WKEA 5G4LA 2EIKB 3EVZA 2ZUTA 1ZICA 2BBSA 4ARZA 5A06A 5BN4A 4S35A 4QOGA 1UZNA 2A9RA 2R6AA 4ALLA 1PO7A 4XGQA 5JQGB 4A15A 4FCVA 1TFUA 1R6XA 1VFNA 3WE7A 3CCUF 4NYMQ 3I83A 3VBBA 2PAFA 2IG8A 1Q5PA 4IQGA 4DSOA 3IKTA 3UGJA 3IV7A 1VQVA 1HEUA 1KH3A 2AHZA 1G63A 3OY7A 4CR8A 5HJ5A 4FOTA 5IF9A 1QRAA 4RWZA 3HNOA 3UQZA 3V4ZA 1JEOA 4B35A 4JT9A 1ZOOA 4WWHA 3L0YA 4KUMA 1RJDA 2BGLA 2XMZA 3HXLA 4FJ0A 1B0AA 5JAPA 1WBJB 3TTWA 5KQMA 5KVQA 4JUIA 4QNHB 4R40A 3GEBA 4JP5A 2CT8A 2Q46A 1U0GA 1NAIA 1Q7YW 5F3RA 4ZGBA 5LOVB 2GO7A 3W7WA 4IUDS 4KQIA 1AKVA 4MUAA 1HNWO 2A1IA 3AFGA 3K0FA 1WVIA 2MMCA 4IDCA 1TEZA 3TZKA 2QDOA 2ZBRA 2CNOA 1OBFO 4KFCA 1VMDA 2XMBA 3PVZA 2DQ3A 2OWEA 5K8VA 2II6A 1YCFA 3N39C 1QYIA 2H9IA 5K7SA 4C0SA 4BNNA 2GAIA 1E58A 4BLPA 1F7VA 2BF7A 3JQ6A 1R0WA 2X0EA 1VJDA 3ND7A 2JIPA 2VWJA 4DCJA 4OQXA 3K92A 1PSDA 2VA9A 4EYEA 1Y9ZA 3C8UA 1K4DC 1TD1A 2OV3A 4KQGA 1YTUA 5IYDO 4EHFA 1JJBA 3FI0A 2AIZP 2E85A 1TD9A 1V11B 4OA8A 1EBOA 3X44A 4KL1A 3MJSA 1XFDA 3B12A 4B5LA 2QVYX 1UC9A 1X86B 4JUAA 2XF8A 3OM8A 4C9BA 3C5CA 4N1AA 4X8AA 4UM5A 3W5IA 3SNKA 1VJCA 5EXEA 2AGVA 4Y0VA 1C9EA 3A7EA 1N2ZA 4F6CA 3KOYA 1TB4A 4OX9B 3MXTA 3HKDB 3ZQ6A 1K33A 1Y5NA 4C7XA 4AZVA 3F5SA 3NJ8A 4FGLA 2BFDA 4I1UA 2E6UX 1U2PA 2P8SA 4FR5A 3LCUA 5ALPA 4R9UC 5BSFA 2XEXA 2Y1FA 4DW0A 5D3MB 3TRDA 1M34A 4WOPA 1M2FA 3DCIA 3FOZA 3BTVA 1VGQA 1I7SB 4BCDA 1OKKD 3UJHA 2QYOA 1JU9A 3UO3A 2AC4A 3BRSA 3QFRA 1GCIA 3VQVA 4M98A 1I33A 2NNLD 3GLUA 3HJBA 2CNKA 5TRTA 3IP7A 4C3ZA 2X7HA 4F7WA 4O3FA 5ITSA 4DFDA 4W99A 4DR1O 1NXPA 2RHTA 2H3OA 3HCPA 3SJZA 1I2DA 5DHUA 4QGHA 3QKWA 3CCJF 3PL1A 3COVA 2Q2NA 3TM4A 1SC1A 5C35A 3REQB 4A2PA 1GOTA 3A4NA 1MORA 3RPEA 1QIJA 1KJZA 3ADDA 1ISRA 4ZU3A 1UBUS 4UNIA 3A36A 5A04A 3TQHA 5IBPA 3IOMA 3IDOA 2W0SA 4RTNA 4YMLA 1V3UA 5CA1F 3QUAA 3RVYA 3T1HB 3JYHA 4L0QA 4EITA 3H1LH 4RVSA 3CZCA 1C2TA 1A1SA 3F5MA 3NXKA 4E51A 3F67A 2GVNA 4WZAB 2XW6A 2VH1A 3UA3A 1NG1A 4BO7A 3NX4A 3NZEA 4H1UA 1XE3A 3P9SA 5EJFA 1FSFA 1LPAB 2X7XA 4YRTA 1W2HA 3KHNA 1J95A 4D41A 1TL7C 2E4YA 2E18A 2QKYA 3IKEA 1L3BA 2H8GA 5K0LA 4JI5O 5EJ2A 1PGPA 4I0WB 2R66A 4ZVRA 3DV2A 2R9RB 5J47A 1P91A 4X71A 3G9ZA 4YUYA 2EX1A 2WG0A 5DYNA 5JNLA 4DYDA 4HC4A 5HS6A 3FMOB 3BVPA 5JJNB 4BVEA 4K87A 4H59A 1XHEA 4YAGA 1ZI9A 2QEXV 2HMTA 3BERA 1E6UA 2FEKA 1SUBA 4OQNA 4IFBA 4ZCTA 2FOLA 1V8OA 4Z4QA 1N0UA 4CL2A 2WQ6A 1CF4A 3K5WA 4NC9A 5AI4A 3U7QB 3ESZA 1C0KA 1WU8A 3CISA 1GL9B 1Y48E 3AF1A 5FA6A 3O82A 1RQXA 1PYDA 2IBMA 4BWGA 4CH6A 4Z6KA 1QCEA 3HP7A 4MA0A 1W96A 1O2DA 4GIBA 3SBXA 5MFPA 3TD9A 2PWBA 1O9HA 2MJLA 1RYEA 5CB6A 3GFVA 1OWMA 4KYIB 3ZCSA 3TN7A 4PHZA 4C8IA 3PAFA 2JFVA 3DC5A 2MQEA 1E5LA 5CIQA 5EMLA 3B3QA 4UTNA 1M1KW 4N0DA 1OX4B 4M0DA 5BVGB 4JZ2A 1QNMA 4CN9A 3F5WC 2P2LA 3K53A 5AQEA 1YFLA 4MAFA 2ASVA 3SIPA 5A3VA 1IWBB 1IJEA 4LCEA 1P7BA 4JJGA 3AQ4A 4P08A 4GF5A 1UKBA 3ROQA 4X44A 1PP9H 5CVDA 3D6UA 1EHYA 1YBAA 1XILA 4NJMA 1T8TA 4D3XA 4S24A 2NXNA 1U2DA 2JF0A 1GITA 4M9UA 3EIHA 2X8JB 1Y4DE 4EJSC 1CJSA 3FVQA 5ADVA 2JIZD 2EIKC 1U0EA 2H0AA 2XYGA 1D4OA 4ZV7A 4GYKA 4J1TC 3WQSB 2HPZA 4EL0A 2GJSA 4QA9A 2CSUA 3IAM1 4LXYA 3I9LA 1A2QA 4N82A 4PSUA 5FR2A 1EVZA 3ZIAD 1IWPB 3TLMA 2R86A 3I61A 4ZI7F 2JIOA 2VDPB 4RJLA 4OM8A 2ZKLA 1OY1A 2MSKA 2ZRIA 1KMCA 1M2GA 3A28A 3GVXA 4DV5O 4H7FA 5TQ0A 3GW8A 2NQTA 1DT3A 5CNJA 5LMZA 3MEQA 1KBHA 3ZX6A 1XEFA 3WYNA 1SPXA 3EVFA 1DMRA 4N76A 1E59A 5I7SA 3ITEA 2XPCA 5EY5B 2I7CA 1E2JA 1KF0A 2CJYA 1NXXA 3N8DA 4YLEA 3Q98A 4IJ5A 5KWEA 4L0DA 1T6YA 3SYLA 2FFBA 1G66A 3A06A 1YTLA 4YJFB 3UW1A 1TO6A 4N5LA 4HYEA 3A6EA 1O96A 5AW8A 2YCLA 2IV2X 2IL1A 3NOOA 3QU7A 2BH2A 3EASA 4KR2A 4PLPA 3EUAA 2ECQA 3BA6A 5AJWA 4BT7A 2R84A 3FHOA 1YJQA 4YP6A 1NVDA 4NCNA 5EPUA 3PD0A 1VSTA 1SUSA 5B5EZ 5JNWA 2EIJB 3ABMC 3PEYA 5IT5A 2P06A 5ALKA 1RKXA 2EDAA 1L5VA 4QBKA 4DLZA 3HYNA 5A4KA 5ITZA 2HYDA 2QRVA 4OFBA 1GPJA 2Q8NA 2I76A 4JV5O 2GN2A 3TQIA 1PW5A 5GINE 3IKVA 1JS1X 4LXHA 3IEVA 1TIPA 3VQXA 1LF5A 4PBSA 4MEBA 1WSWA 4PWZA 2FEAA 2QSYA 5K1ZA 2RHMA 3GRPA 1ESZA 3B48A 3VR2A 1FAFA 2Y66A 3UJ3X 2IYPA 4NZOA 5AM0A 5LUAA 2POCA 3AYZB 1KBZA 4JSRA 1P2SA 3T1CA 2N75A 1W36B 2ZEJA 1HO3A 2GWRA 1A8IA 4ATNA 4Z3OA 5FLEX 2CLDX 4UASA 1FX0A 4BP1A 3VOSA 2FUG1 4DV3O 1I32A 1O7JA 1WEKA 2FZEA 4JASB 3FDIA 3IHWA 2HU5A 3N27A 3H42B 3OE7A 2PT6A 4B4KA 1QH9A 3QF4B 1GRRA 1X9GA 4NATA 4RVFA 4ZYWA 3CCCA 5A5DA 1F9AA 2XMDA 2GKGA 1ZGHA 1DZ3A 1Q20A 4FYPA 1JXQA 1UI9A 2X4GA 4KIWA 3LH5A 1PJ4A 3ZWOA 4U3JA 4ZOLB 1TUBA 1Z4LA 5I3CA 4YUAA 1BU5A 1P84F 3P0EA 5K0EA 4DWVA 4Z7JA 4BMDA 3AGKA 4PU0A 4GXRA 3A1DA 5IT9M 1VMIA 3NRJA 2WF7A 3E9MA 3QTCA 1N0VC 1VF5B 2HC9A 5KJ6A 4RMJA 4B62A 3COSA 5E9AA 5FWYB 4ZVOA 4B43A 3BREA 2HPHA 1S01A 2NXJA 4D9GA 4N49A 1Z6GA 4LZJA 1XUOA 2ZS7A 3G3EA 4P3PA 1NSFA 4C0AC 4NP6A 1SUDA 2WHEA 3I01M 4BCBA 1DJLA 1BX3A 1MEJA 5BT8A 2ODAA 4JAVA 2AT1A 2ZIUB 2UXDB 5BN3B 3ADPA 3SLRA 2W6JA 2VO1A 4EWLA 2FPOA 2X77A 4OXYA 1DI0A 2WLJA 1EM1A 1UJWB 3MWJA 3WGTA 4C0XA 3NYRA 2GLXA 2E3CA 2P79A 5JWRA 1E7WA 1Y7PA 1T1RA 1C1YA 1W3EX 5A4IS 5THQA 4MYRA 2VUUA 3DD5A 3SJBC 1II8A 3EFBA 4LISA 4UMDA 3A6KA 2F8LA 4J7KA 4EP1A 3OZVA 2Y1KA 2D74A 1UOOA 2M7WA 1KEEA 1XLWA 1QYCA 4IGEA 1GG9A 2OORA 5FYDA 5EXDA 4E5SA 3X2FA 1ZA2A 3IAHA 4KH1A 2ZWAA 4BASA 2ZBQA 4A1OA 3LFHA 4FDUA 3ROFA 3W6PA 1Z34A 2VP6A 4NTXA 2IYLD 3PFGA 3BA9A 2WSLA 2X5XA 2ECPA 4HRVA 3ERNA 1SCNE 5ALUA 4P98A 5DWQA 3HEAA 1QMPA 1KMQA 4CETA 1I08A 4X1KA 1MVLA 3V7FA 2ZIGA 4W5JA 4DR7B 2ZR2A 3K0EA 3EQ2A 3KL4A 5ALGA 2PH7A 1UMKA 2G06A 2HDWA 1PM9A 3D4PA 4HATA 4OP3A 1PL7A 2Y48A 4YCMA 3GQBA 1V1MA 3A2MA 4RX1A 2ZSEA 1CZKA 2DOKA 1NHGA 3IAXA 2B5WA 2OVFA 3LQQA 5EI5A 1PJTA 3NRCA 2NADA 4RLHA 3RADC 3G85A 2QRHA 1QE3A 4F4JA 2IP1A 2X4LA 4D9JA 4MCJA 4INJA 5EZYF 5BN1A 3A2KA 5H82A 3CXCF 1X19A 4BEWA 4HGNA 2VK8A 4S05A 4XBFA 1D09A 1OZ0A 3FKSG 2ZZNA 4LTDA 1SXJE 5D5HA 3FNHA 1VIAA 1AB5A 2ZJBA 5JAHA 3G9QA 3C1UA 3BXZA 4A6XA 3BBPA 1T29A 1JXMA 2CDCA 4G0NA 2V97A 5I8ZA 4QUKA 5BOSB 1U80A 2RHDA 3AQIA 1UC5B 4MW2A 1T9GS 3O6VA 5T3YA 5FNVB 2YY5A 4FE3A 3NVIB 2JCSA 4Q6WA 4CM7A 1CF2O 2W8BB 2HUNA 2QTMA 2YHAA 4R1NA 5KHLB 1M56C 1ELOA 4JBYA 3ZW8A 2H51A 2YVAA 4PPGA 4QYIB 4J94A 4JFAA 3SM9A 1KP3A 4J16A 3HWX1 5F1YA 5HEKA 5FV7A 3FX2A 2J3DA 5THXA 1SZXA 1WLSA 4R2JA 5FOQA 2CUNA 4GRIA 4L4YA 4HUTA 5IAEA 3V1KA 2QY6A 3WLNA 2C7QA 1QG4A 3U3ZA 2CLMB 3DFFA 1IUOA 1LLDA 4CS2A 3PTAA 3FMFA 2VKTA 4UEWA 2CTQA 3R7FA 5J63A 5EWLA 3AUJB 1M2KA 3K0DA 1SUEA 2VYNA 3MWDA 4RTSA 2RCYA 1SKBA 5IBCA 4X0EA 1GQSA 4UEKA 1X1DA 2W22A 1N5OX 2P27A 3HDHA 5I4KA 1FFTB 5LMUB 3UAVA 4M7WA 4AW9A 1LLQA 2V6GA 2B83A 1S96A 4Q00A 4LFAB 4PN3A 4MO2A 2WFLB 2J4FA 2EU8A 2QS9A 3DPSA 1JNYA 3F9RA 2D1TA 3UK6A 3P9CA 3WFZA 3FOAA 3C3WA 1MLDA 3PUJA 1SGWA 3DEAA 1GUZA 5AKGA 1JSXA 1O6GA 4ZQFA 3LVRE 5CBHA 2JHFA 4O1IA 4UHCA 3CLKA 3V55A 5A2GA 2P2GA 2IV7A 3EIOA 3FX7A 1Y81A 4UZSA 1U0RA 1VJ5A 5I9IA 3ZCPA 2WTEA 4MV8A 4R54A 3SX4A 1Y42X 4C0JA 2QLTA 2OQ2A 3TGPA 4J7UA 5HOEA 5BW4A 5JHHB 2V0NA 1OR8A 1WV1A 1YKSA 4PY2A 2ZCVA 3EIFA 3OE5A 2YS7A 4ENPA 2IBSA 3JU3A 3P2YA 4X64O 1KI7A 3PHLA 4BRUA 5GP1A 1P18A 4OOEA 5JJKA 1THGA 3KJKA 1P62B 3U1VA 5KHAA 1KGSA 1OGIA 2MSDB 3IH5A 1A7AA 5F3DA 3M6WA 4LVUA 4FYVA 1W75A 1P0PA 1PEDA 3LZCA 3IBCA 4MKRA 5TB5A 3PKZA 4K6GA 3DNPA 1L6RA 4A5SA 1URFA 3C74A 5KNDH 1CXZB 3EEFA 3EZ2A 3OIDA 1A7UA 2TSYB 5GZ1A 1CB7A 2V6MA 5KSYA 3C45A 4BLTA 3GPCA 4JXKA 2X8LA 3ZEIA 4GX2A 3RVBA 3OETA 4W5OA 4PI0A 3ENZA 3UA4A 5G0SA 4DV4B 4L76A 4FBLA 5JTTA 2EZPA 4CM9D 1NXSA 2JANA 4XSHA 4CU5A 1OXSC 2FP4A 4MX8A 1TVCA 2VH5R 3ON5A 5CLIA 1AE1A 2CDAA 3T9AA 2Z2IA 2D0DA 4O63O 5CT5A 2EIXA 3G13A 3CKKA 4OSPA 2R8EA 3IB6A 4DKJA 5KX5F 1YTFD 3AZOA 1BO6A 2VCHA 1ZRHA 4D4HA 1T2NA 1ESCA 1E9RA 3GJYA 4HNAA 3T7DA 1QYXA 4A26A 1SC5B 2DWOA 4YS6A 1KMMA 1VPDA 2GARA 5CB0A 1F12A 3UWSA 2C5GA 2FMXA 1AHIA 4HT3B 3D3KA 1GR0A 2NX2A 3RHFA 2LUOA 2Z4SA 5DHSA 2G17A 3ZVLA 3AGPA 3ETHA 3DWGA 2GR9A 1G3UA 1BCSA 1QWOA 4UMEA 2A84A 3KR9A 2Q0XA 2GTAA 1N32O 2ZIOA 5KNBH 3E1YA 3OKCA 2LQTA 1EVQA 1C4OA 4XEHA 1YV9A 1TAHA 5DMHA 3PR3A 1QHGA 2IF0A 1LC0A 3WYGA 1XXHA 1KJQA 3WNQA 1LFAA 5EZSA 3IB3A 2ZT9B 3QKRB 3G4SF 5CBKA 5IJAA 2ISCA 1L2TA 1DEOA 1MH1A 3E1SA 1ONSA 1QMGA 1X7YB 2ZKIA 2IS1A 2JGIA 2IZ1A 2XQIA 1MC4A 1V8BA 3T61A 1JZQA 2PUVA 3I2FA 2AFIA 1H42A 2OYQA 1NN5A 3EMBA 2H4XA 3H84A 3UMFA 3FTQA 1PEAA 4GXNA 3I3SR 5DH9A 1F2DA 4CTMA 2JIBA 2LCIA 4K6OA 1HOXA 5IN5A 2R7LA 5BWCA 1ECBA 1R0ZA 2OTJF 3M9WA 4B81A 4NEQA 3CB4A 2K2WA 1E3LA 3A1EA 3V2HA 3GUCA 1E2GA 3AO0B 5AW0A 3PXAA 2EWWA 2WVGA 2Y93A 2I8AA 1QIMA 3GOQA 4H33A 1E2PA 1E9FA 1XTVA 2BFWA 2MSLA 1KP2A 2BHNA 2RE8A 4GGPA 5DX0A 2NU7A 1H48A 3UMYA 3IUQA 2G71A 1NBOA 4HZ3A 4IUYA 3BSWA 1RYYA 2R7NA 3GDWA 2JBAB 4KQEA 1KMIZ 2PMPA 2KBEA 3Q3CA 5CG2A 1WXFA 4WCFB 5H9CA 3WZ2A 3UO2A 3RRZA 1HT1E 4N39A 1XEQA 2D5BA 5A4FS 3CRAA 4EB6A 4EA9A 2ES4A 4R1UA 1K34A 2FPXA 1NURA 4LSZA 5ESWA 2FNAA 1SK8A 2JDIA 4WLOA 1J97A 3NDJA 4CGYA 1EUQA 1ODCA 3KHSA 3ASYA 2FTKA 2A14A 2FL4A 1Q0RA 4MEAA 3VR4H 1DOAA 3K72B 3O03A 3UMMA 2IS6A 1Y1LA 4JBIA 4JU9A 3HI4A 1Q1AA 1WW2A 3PI7A 2P35A 2IWRA 3VPHA 1UAAA 3SE0A 3CNOA 2WKQA 1GZDA 1LPOA 3IQHX 5ALYA 3TNLA 1EHCA 3TI9A 2FPIA 3MMPA 1ANKA 1J20A 1SB8A 3L1KA 3OKAA 2ACWA 2X6BA 1CLEA 4RUFA 2JLCA 1K5GA 2ATIA 4JL8A 2CXNA 2Q68A 2ODQA 4I5FA 3P4EA 4EW2A 1H2WA 3D3JA 1G0NA 1XCMA 1ISHA 4LSMA 2FWRA 4RMIA 5JYEA 3M6LA 2ZAUA 3BBLA 3II6X 1GTG1 3NP7A 1QV7A 2H1CA 4DV1B 5DNYB 5F23A 4KWHA 3S3WA 1X1EA 3UKJA 1SUWA 1AQJA 4DR3B 2JNWA 4QM6A 3D4OA 2AXEA 2BI8A 3THYB 1M1UA 1MRNA 1GU7A 3JARA 1Z8NA 2P1RA 1F6BA 4F5DA 5FPKA 4Q4CA 4ASUG 3QQ5A 2O3RA 3W2FA 3ZRWB 4M6WA 4LF9B 5E1BA 3UK2A 4CMHA 1NBWB 4OHUA 2W71A 3UT5A 1UMBB 3S2SA 3V9AA 1ITZA 3EGDA 4JP1A 1UDRA 4EA7A 2R1TB 1QTQA 3CS3A 3GJXC 2A9JA 1NPYA 2JFWA 1L0LH 2FJUA 3ZXSA 2YNMC 2ZAGA 4UUPA 3N76A 2FG6C 3HUUA 4GKAA 4GQIA 4IXNA 1KZ6A 2XTMA 2PBLA 3D3IA 2EVWX 5HGXA 5EERA 1RRPA 1JR6A 3U9TA 3CSDA 2OHXA 4RPCA 4M53A 4C4YA 1GSAA 3WZMA 3HJWC 4LXGA 5JLAA 1B00A 2QYTA 1C0IA 3ROGA 2FDRA 4EVQA 3V3KA 3QQPA 4EG6A 5HKKA 4WV3A 2E49A 2ZI5A 4QPJA 2XKAA 3MUNA 1I01A 1W5SA 1AJQA 3A1VA 5IANA 3S02A 3SYTA 4ALKA 1UBHS 3NJRA 4BVHA 4ENRA 2I78A 5H5JA 1SVOA 4DG9A 2C9YA 3IV6A 1QFXA 2W2MA 2PGLA 2XSZA 1ADGA 3U61B 1E3JA 2LFRA 4A8TA 1R6UA 3OOHA 4MP8A 2CJXA 1KYTA 2QORA 4UU0A 5HXUA 2ZDIC 3VO9A 3FPFA 1V6CA 2F67A 5JWPA 4MWEA 4JI0O 3IR5A 3TOSA 1KY2A 3IDFA 3ULKA 1DC5A 1A8PA 2F4NA 1DG3A 4HYQA 4TQ9A 4D4KA 1MSDA 1XA4A 1W42A 3PQ2A 2IZ5A 1KY5A 1UAYA 1I3LA 2IEBA 1X9HA 1I94O 2H92A 4FBGA 3RS0A 3H2HA 4ZT5A 4BUZA 3KB8A 1XHZA 1ZH4A 3TUIC 3O9ZA 4HSEA 3HO6A 1GL3A 1SUCA 5KJEA 4OAQA 4NWOB 4I55F 1QU9A 4Y2PA 4QE9A 2HDNB 1R6AA 3KJXA 5EQDA 4WFHA 3GLRA 3EORA 1JTVA 1DX4A 3B36A 4HWSA 5AVKA 5J4LA 1PE0A 1N9GA 1AGNA 4C78A 4UXHA 1J6UA 3OPVA 4AKEA 4RW0A 4RFSB 2ODEA 2H1VA 3KAJA 3SVTA 2H8EA 3NASA 4DJDC 1BJKA 2XOKA 4WA8A 4AZ0B 2GYYA 5ALTA 2RJZA 2XH8A 4MVJG 3EARA 2YFHA 2QI9F 2Y2VA 3SPHA 1GK9A 3RDPA 1JDSA 3ZV5A 4OIFA 1H7MA 1CRZA 1T0BA 1DKUA 3JVEA 4QU9A 3TPCA 3DV0A 1RLOA 4RJIA 1OCRC 1WZCA 4QT4A 2WTAA 5C8VA 2J7KA 3W5JA 2ONZA 3BF7A 2DMXA 4DQKA 3PU6A 3QOXA 3V3TA 3HP4A 3WSVA 1TYAE 2DYRB 2JJMA 3TR6A 1HKHA 3C4JA 1CQJA 5DMXA 3I0MA 4TV9F 4M7PA 2PX6A 4CODB 4YRPA 7YASA 4B9AA 1FS5A 2ILMA 2TYSB 1E62A 3OQOA 3HFSA 2HCJB 3NS7A 3UJAA 2ZR0A 4TGLA 3VVLA 2WD7B 1ULAA 1W9HA 5AH0A 5KHOC 4UNPA 4PX2A 4QQFA 3USZA 1N0WA 2OBXA 2E76B 1HYGA 4QXPA 4NMWA 4XM2A 2VQ6A 2VDKB 4YAFA 4MKXA 1SVWA 5JCJA 2J0QA 4CKCB 1AZSC 1SKUA 5CDUA 4DJJA 5KMGA 4OUDA 5ALJA 4DN6A 1OLUA 3SPCA 4YA6A 2GF9A 1VCIA 5AIBA 1GNPA 3AI7A 3F4BA 4PZUA 1R4ZA 2RH4A 2XUPA 2UUAO 4NZ9A 2EHJA 4EARA 1AR1B 3IEWA 2Y0CA 3DE3X 3G0DA 4WCFC 1QG0A 4BY9E 1VCMA 1OH6A 4RK4A 3S6JA 3KELA 1MG5A 1QKJA 3LBHA 2Q67A 4PC6A 3QI7A 2G5GX 4XQ9A 4M1WA 2XB2A 1WNFA 1VGVA 2EWMA 5KU7A 5D8DA 3PC4A 1DEXA 3TQSA 4KQFA 4X62O 2VRZA 4PAOA 4BX8A 5CXXA 5E9WA 4LVCA 4MARA 3J81k 3TDNA 1KQPA 2IVZA 4CJXA 3MFYA 2X76A 3ESJA 1KSGA 4FLEA 1JFSA 4BLWA 4Q9AA 2PM8A 4BN5A 5DXFA 1JHPA 1V5EA 4ZV9A 4UMFA 2A4MA 4LGMA 3BWBA 5AM5A 4NK5A 3RAJA 3P3PA 3SQXA 2DZDA 2GNAA 4JP2A 3RA6A 1J07A 5CA1A 3M4SA 1M2OA 4HAXA 1B23P 3QEMB 4QXAA 5KDOA 5E4TA 2A0FA 4IJQA 3IHLA 3W5UA 2QVZX 2V9PA 3WDLA 1IN6A 2NSLA 3EZNA 4KDFA 4ZHYB 4G8DA 4AYXA 4CPDA 1R3LC 4M60A 3C9SA 2XGMA 4ZRNA 2OE2A 3QKIA 4UZEA 2Y9MB 1YZ3A 1CUUA 1Q17A 1TA0A 4KZPA 4JUDX 5KCMA 1T1SA 1H5QA 4MVJD 2P5TB 3WGLA 4MS4B 2DOSA 3BEDA 4FFSA 1EPUA 2FXVA 2H1WA 4J4HA 1RCFA 2Z43A 1V55B 2FH5B 2C29D 3WYDA 4RPHA 1XZGA 4N54A 2R6DA 1J2EA 1U1DA 4EMBA 2IPXA 4ZMBA 1GUDA 2D13A 3N6RA 5LD2C 1EK2A 3OCWA 2X3YA 3PWSA 1JJOA 3PQCA 2VUTA 4YT4A 1Q15A 3OOEA 2IYNA 2QGFA 2OCIA 4I36A 1PV1A 1CZOA 2VYCA 2ZT8A 1OSNA 4AG3A 4DMFA 1U0BB 4IDQA 3U3DA 1G98A 4IX1A 4LOJA 1G1XB 4CF3A 2Q5JA 4O4LF 3GMSA 1DHRA 4XWGA 5JYBA 2XTZA 4O5OA 2RBKA 3ELDA 1VYVA 1Z5OA 4P9PA 5L6LB 5LGTA 2ETVA 3AM5A 3Q9NA 4UPVA 3L4KA 3N2ZB 2VJQA 2IJJA 1LDYA 3N2IA 1TT5B 1AO3A 4JT4A 1NBEA 4P22A 1L5SA 2V8OA 5I7HA 1BVYF 2XD4A 2O5EA 2HWXA 4AU1A 1TAEA 4JWKA 1FFHA 3AONB 1E2QA 3AUFA 3F5QA 5DCLA 2X6CA 3ZJTA 3BUSA 2A3QA 3MCAB 3PF8A 3WLJA 4K6HA 1G8SA 3U49A 4CMEC 5HR5A 4ARCA 3OIUA 3ESQA 1R1DA 5AXDA 3ADBA 4UOZA 4ZCIA 1P7GA 2FSIA 4KIUA 2J5KA 4MMZB 1XMJA 3KSUA 4RKRA 3T7SA 5FBHA 3H1AA 3GBSA 2A5FA 4R71A 1IUPA 5EHZA 2DWUA 1UQUA 1CPYA 4UVEA 3NVKI 5K45A 2JCYA 3GWKC 3DKRA 1LZLA 2OFPA 4IGIA 4HLDA 2WT9A 1EDDA 1Y3AA 4D99A 4MXDA 2GYVA 4TUYF 4TYPA 1HZZC 4GICA 3GEPA 3FPSA 3GJ3A 4BB9A 1QU7A 2B8EA 5FORA 4BFYA 4ZI7A 1ZDMA 4WFFA 2ZUEA 2ZRAA 2BV3A 2GZHA 4TXMA 3WKCA 1J2RA 3PXEA 2ZAIA 3WLKX 3T9EA 1RJ9A 3EISA 1XQVA 2JARA 3OT5A 2UU9O 1E18A 3TFOA 2AV6A 3LT2A 5JBNA 2XT9A 4QDOA 2Z9DA 4FM1A 2O2SA 1DCTA 3MCTA 1G5QA 3R5HA 3HZOA 3EA0A 4NONA 4DLWA 1Y6RA 1L4NA 2ZUBA 1GARA 3Q8XB 2C03A 2YQ4A 4U7WA 4UUNA 4B6PA 1OI7A 5KC8A 3OCCA 3JTMA 1ZI6A 1NH2B 2PUHA 1CY7A 2FW8A 2CSLA 1GRJA 1CX9B 4X8HA 3KYDB 1XTSA 4M4SA 3B51X 2H9YA 3AIOA 3CW2A 3VYRB 4YIOA 3L07A 3MCVA 2HS0A 5HY0A 4R68A 5B3JA 2X86A 1O94C 1YZLA 1UT6A 2O05A 3VOAA 2BEVA 2AYXA 4IHAA 1PQPA 4K9NA 2JFUA 5LB2A 2A5DA 5HFLA 5BW6B 2XXAA 4NAHA 4IZ6A 3ICEA 4B3SO 1SOAA 5IULC 2Q8VA 4FFMA 2P6RA 4Z54A 3DLCA 2XHZA 5INTA 3KXDA 2GT1A 3T3PB 2PSDA 3SIWA 4QUGA 1JA9A 3B6MA 1JA0A 4AO7A 4PZ9A 3NMUF 4KLZA 1NDHA 2FSSA 4LFCO 3VSDA 4LCKA 4GVPA 4MWTA 2RGRA 3F7MA 2RGDA 1I9CA 1JN1A 1V43A 4RTQA 4CTJA 3SDBA 2EIMB 4LHEA 1C30B 1MIOA 2C3OA 4LNUB 4U39A 3C3CA 4I9FA 2W6ZA 4EKWA 3TNFA 4HK4A 5EPOA 3HBMA 1E4EB 1NUAA 3FUVA 1DCFA 1IHDA 2AZ4A 3DSRA 3OHPA 3O2JA 2R751 2CMHA 4WOKA 2G83A 3ZI0A 4UD2A 1JIJA 1ONNA 5DNCA 4MRAA 1NAHA 2IYSA 3ZS9A 4TMFA 4E32A 3R5JA 4NZZA 3ABKB 2F1IA 1WABA 1I14A 2PUJA 4P0PB 4D3SA 3PCRB 2IZOA 3SHTA 2ZTVA 3HDJA 2WU8A 4PVCA 2EIHA 1U5BB 5DWDA 3IDSA 3GPLA 5K0GA 3BWXA 1VH8A 5B1SA 3UWKA 5AOAA 2WLSA 1A8SA 1F6WA 3EUFA 1Z3CA 4N5DA 3QNMA 2JGMA 2FQYA 4OHBA 3AR2A 2JCGA 1ZKMA 3AFMA 1ZM4A 4ZYLA 1W52X 1YQXA 2G4CA 3TMAA 2KTUA 4B2PA 3AL2A 1Z5UA 3SZUA 2B7LA 3AHGA 1NYTA 3CYPB 5HWEA 1NVGA 4ZKEA 4TZKA 2BGRA 1L4YA 4DMLA 5EXTA 2Q5CA 3SJ7A 1ORDA 1OXMA 1RWKA 5GIPE 5AWFC 5JATA 1TA8A 2WDZA 3HS3A 2W93A 4H0NA 3F6CA 1SU8A 2G7MC 1X14A 2ZPAA 1N2OA 4OQDA 2BP7B 3OOSA 5FI1B 5HRUA 2QE7G 1CEXA 3ZCVA 1VEWA 5LLSA 2C1EA 4QHSA 4XM1A 4HUQA 3WBKA 1N4DA 3A0RA 1KYZA 4R7TA 3V2UA 1T5SA 1X7GA 4XLZA 2F59A 5CYOA 3KPYA 5LP1A 3CF2A 3BJIC 4CM8A 5KTNA 1APBA 4O59O 4BVTA 4D0SA 1ZG3A 4R7GA 4AILC 2FRDA 3CJHA 4OXRA 4UBMA 4AN1A 1S4QA 4JWTA 4G2KA 2ACEA 1E5TA 5JO0A 2YX1A 3T52A 2FG5A 3E5NA 5H70A 3NDPA 1ZD9A 5C51B 3AY3A 2BCEA 4U6NA 1V55C 4JYAO 4KLCA 3TXAA 5JWOA 1USGA 3B1KA 2E4AA 3RSLA 1AJEA 4RY2A 1POWA 4TQGA 3SDZA 1CWUA 3ZMUA 1NOIA 3HCWA 2Q49A 1PN3A 2C3UA 3JAKA 5AI6A 2IXDA 3IEIA 3QNWA 4YQYA 2IYYA 4DR6B 3WKDA 1OCZB 1RYHA 4I5SA 2CMDA 1X59A 1QC5A 4BKUA 3WLLA 2J9YB 3BGDA 4XSGA 1Z5PA 1VL0A 4DWJA 1WXDA 4PC1A 4L8LA 3CC7V 4QTXA 1RXWA 5D6NA 4ADSG 2QVXX 2PUFA 1Q7CA 2P11A 1E66A 5LM3A 2VZ0A 4CT5A 3GTZA 4JAUA 1DX6A 2P4QA 4JLWA 4K1LA 4LJKA 4UHJA 4YJ3B 1IK6A 3SU8A 5EZYA 2G9NA 1G5RA 3K0SA 1S76D 3KPJA 5TF4A 4HDSA 3WLMA 4AJEA 1EUYA 1XDDA 2JVKA 1FPQA 5LL6Y 2WPDA 4DV7O 4B73A 2PGAA 5D1NA 2AL7A 3AH8A 1NJ6A 1QHFA 3WHKA 3PNPA 4KODA 4UXNA 4BFSA 3SMQA 3ONFA 1ADJA 1CUJA 1E89A 1I3MA 3DVRX 2GK7A 4FYIA 2VJOA 3PI6A 3ZVNA 3E22B 4D92A 7MHTA 3OT4A 3G6KA 4NVRA 1TJ4A 2PJRA 3LY5A 1R9NA 1PK8A 3K32A 3W8EA 3M82A 2HSGA 4NU6A 2ZTHA 1DF5A 3TLCA 5CIWA 1AOXA 5KVVA 3AKEA 3LGAA 1UDBA 3RIGA 2B7CA 4YMVA 4GKKB 4REQB 4YH1A 1F3OA 1VA5A 3AK3A 4N23A 4C4ZA 1LBQA 1XD8A 4LSWA 4LY6A 3OMXA 3EXHA 4NH0A 4YV7A 3BVOA 4C4SA 3AVXA 4JEIA 1JLRA 4MUYA 3A3OA 1X92A 4K86A 3TCXB 1PGQA 4JC4A 1RQPA 3DTVA 2OV4A 2GH1A 1MJNA 2QP4A 1G4YB 1I4DD 3AKDA 1XR3A 1WUTA 2PYJA 2F00A 1E96A 2Q4OA 4DGSA 2GDJA 2I3AA 3SZRA 5DGXA 2XGOA 1Q81H 1R74A 4W7HA 2WRZA 1LVGA 2AHRA 3E8FA 1Q6UA 4G0VA 3BKWA 2YRFA 3CZQA 3CLRC 1UZMA 5FWXB 3SF8B 2AK2A 4C7KA 1WPRA 3FG9A 4FBMA 2IXEA 5DCVA 4JROA 5K0ZA 4KLAA 3GRRA 2OZLA 1H2SB 2X4DA 1M6HA 3GFTA 3RS9A 3AG2B 4DR4B 1CE8B 4EG3A 1AKMA 3Q6NA 3CY6A 2QEQA 4FPXA 3DGFC 1RRGA 1G59A 3UGTA 1IZ7A 2JHCA 3ZCXA 3TETA 3P9RA 3OQ1A 4F2WA 3TSCA 2X22A 4C3VA 3TLZA 2D7DA 5AI9A 5JXGA 3DULA 5EEHA 3CM0A 1Z0DA 4R83A 4TM8A 1NULA 3CXHF 3NALA 3NG1A 3ZDXB 3JQEA 4H7KA 5JXHA 1FSGA 2PD6A 1M1YA 2CFSA 4RUEA 5I7RA 1K6XA 5PNTA 5AVSA 1P3Y1 3ZWPA 3D8CA 2ZI9A 4JP3A 3RRYA 3B53X 3RK0A 3ZCRA 1BEZA 2XZDA 3EQ9A 1ZA1A 4U7JA 4WT7A 3OWOA 4FLUA 3E8BA 3NTRA 3KQNA 4L16A 4KNYA 4XE5A 4O33A 1W59A 1AI7A 4UPEA 4IMIB 2DPYA 3B2QA 2R79A 5LJLA 4LF8O 4ENSA 3KU1A 4Q16A 3KTAA 1XL1A 3A14A 1OWLA 4YCJA 3EUW