5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
5EIBD 4HNAB 4O4LA 3N2KB 5FNVB 5KMGA 1TUBA 3HKCB 3VOBA 3JAWA 3R4VA 3ZBPA 5IJ9B 5IJ9A 5ITZA 3E22A 1W5FA 5J2TA 5LP6B 1RQ7A 3N2GA 3RYCB 5JCOC 4FFBB 5C8YB 5C8YA 3JALA 2VAPA 4E6EA 4TUYA 3HKEB 4ZHQB 4EI8A 3RYHB 5KX5B 3ZBQA 4TV9A 1FFXB 1W59A 4O2AB 5CB4B 3JAKA 4TV8A 5EYPB 4I55B 5LYJA 5LA6B 5JH7A 3JATB 3JATA 5IJ0A 3RYFB 3RYFA 4U39A 5LOVB 3WGNA 4U3JB 3WGKA 4HNAA 4O4HB 4O4HA 4ZI7B 5JVDB 2Q1XA 3N2KA 2VXYA 5FNVA 2BTOA 3JARB 1JFFB 3JARA 3HKCA 4LNUB 1W5BA 5LXTB 4EI9A 4EB6B 5M7EA 4F6RB 5LP6A 4X1YB 3RYCA 2RHJA 1SA0B 4FFBA 1OFUA 2VAMA 4O4IB 4YJ2B 4YJ2A 2XKAA 3HKEA 4ZHQA 4IHJB 5EZYB 2R751 2RHHA 3RYHA 5KX5A 2R6R1 4DRXB 1FFXA 2RHOA 4I4TB 4O2AA 3JASB 5J2UB 5CB4A 1W5EA 3HKDB 5EYPA 4I55A 5LA6A 1TVKB 5JQGB 1FSZA 5LOVA 3V3TA 5BMVB 1Z5WA 4O2BB 4ZOLB 3CB2A 4U3JA 3C8LA 4M8IA 3M8KA 3M89A 5JCOA 4ZI7A 5JVDA 3VO8A 1JFFA 4LNUA 4X1IB 4I50B 4I50A 4X1IA 4YJ3B 4EB6A 4O4JB 5LXTA 1W5AA 4EI7A 3VO9A 4F6RA 5EIBC 4X1YA 1SA0A 3RB8A 4O4IA 4B45A 4X20B 5CA0B 3UT5B 3UT5A 4IIJB 4IHJA 5EZYA 2GVIA 5CA1B 4DRXA 4I4TA 5J2UA 3JASA 4WBNB 3HKDA 2Q1YA 4O4LB 1TVKA 5JQGA 5GONB 5GONA 5KMGB 1TUBB 4KWEA 5MN6A 3HKBB 3HKBA 3JAWB 5BMVA 4O2BA 4ZOLA 3VPAA 3RYIB 3RYIA 3E22B 4X1KB 4X1KA 5ITZB 5J2TB 1W581 3N2GB 5IYZB 5IYZA 4YJ3A 3WGJA 4O4JA 3WGMA 3WGLA 4B46A 5MN5A 2XKBA 3JALB 2RHLA 4TUYB 4XCQA 2VAWA 4TV9B 5MN4A 5LP6C 4X20A 5CA0A 3ZIDA 4DXDA 1Z5VA 2BTQB 2BTQA 3JAKB 4IIJA 4TV8B 5JH7B 5LYJB 1RLUA 3VOAA 5IJ0B 1RQ2A 5CA1A 4WBNA
chains in the Genus database with same CATH superfamily
5DASA 4C6SA 2FQ1A 2AZTA 2R1TA 3B5JA 3GN1A 2C2MA 1WMAA 4JGIA 3FWZA 2P5YA 1L4HA 3NHAA 5GIPC 1WB4A 3FVRA 4LXTA 3GGGA 1ZDMA 4BVHA 2IEBA 4IEIA 1ANKA 2O9JA 1QX4A 3S0WA 4Y9TA 3ZQ4A 5JFTA 2VFAA 1Y7TA 1QLNA 2CNDA 3HKCA 1WHTB 1MXFA 1ZD9A 1XD2A 3AVWA 3THXA 1A2OA 4G63A 5ADUS 3TCNA 4IX1A 3IERA 3CLHA 1Y3HA 2Q49A 2XMPA 2B0CA 4Z6KA 2IEIA 1T9KA 2HSJA 1X7DA 1I2DA 2IVFA 4YUYA 4QGBA 1JKMA 4RIFA 1N2GA 1K7SN 4GSKA 2ZZMA 5JY1A 2RBGA 3AOEC 3RIXA 1WJZA 3DXRB 1H8HD 3URMA 2FZCA 3BOSA 2QN3A 1E61A 2C2ZA 4XD7A 4H33A 4WXMA 4KX5A 2J0VA 1SIOA 3NT5A 3E9YA 1BYUA 5JWHA 2HMSA 1T24A 4FMCF 1EE9A 4HQ6A 1IURA 2GXUA 5I6DA 4LYHA 1ZU5A 3ZHUA 4DG9A 2PXAA 4WZAE 2CLLB 4GT1A 3QKSB 1FMCA 4K86A 3TNLA 1KAQA 3OD4A 2YDEA 4AW9A 2E3JA 2OHGA 2C3UA 4EYGA 1Q1ZA 2EX1A 2J7PD 2BGUA 1BU8A 3N4ZA 2Q5HA 3SAJA 4XBFA 1TLTA 4YXFA 1TVCA 1XN1A 2QRNA 1G55A 1ABEA 3MSCA 5IUNC 3AB3A 5BPHA 1LX7A 1L1QA 4GS5A 2AC2A 2MHCA 3M83A 3ZQJA 1SXJB 2E4XA 2FR1A 1KZYC 1OGJA 3QKRA 4ILKA 3A58B 4CN9A 1ORVA 3UXYA 3UCFA 4NFSA 2QSZA 3ABKB 2OGSA 4EY8A 3X0DA 1P1FA 3C97A 2ERYA 5KIAA 1FBNA 2JFHA 2ZVQX 5IVIA 3H4TA 3CX3A 4C7VA 2YW9A 5AVYA 3O03A 3K0GA 2PUJA 4FWTA 3U0ZA 3ZLVA 1JHAA 1W5FA 1VPEA 1XVLA 4N82A 1PNKA 1QKJA 2XQKA 2R1UA 1VJTA 3RRFA 3BHIA 5KQMA 4UHCA 1E1MA 3HS3A 2VWQA 1F7UA 3U6BA 3PC6A 1XL4A 4AK9A 4JKOA 4P84A 3LCUA 2NXCA 2FEMA 1WIWA 1RI1A 4FN4A 4BATA 4R2HA 4PSCA 2QTVA 1WXQA 3P0ZA 2B78A 2XE7A 3IQGX 3KQQA 1SD5A 4K6OA 6AT1A 1EB9A 1KO7A 2ZSUA 4NBNA 1UJ4A 3B48A 4D45A 1CK2A 4FIZA 2HO4A 2AOWA 3IP5A 2AMYA 3EXHB 3T12A 3PDUA 4KR0A 4N5HX 2ARHA 4GSLA 4JV5B 5C18A 1K6JA 3CSSA 1Z4MA 1P1HA 4URWR 2P69A 2PUVA 3ZXXA 3B3GA 2WZBA 3WTBA 3IE0A 3E22A 3B7GA 3MT9A 1I5EA 1HR0B 4F84A 1U96A 3M3HA 3H6KA 3OEED 3A6GA 4I50F 3PC7A 4S05A 3G2NA 3ZOKA 1O95D 5BQFA 5AESA 2X2OA 1HQYE 4BQEA 2E21A 5BV8A 4BNKA 3ZDRA 2AXTZ 1AKVA 2EEZA 3HJHA 3G6EF 4B6OA 1UOEA 1U7HA 1F20A 2V6BA 3L6UA 3QP9A 2OM6A 2AZMA 3X2QC 1N6LA 3HCOA 5AW4A 2O8DB 4KFMA 3UWDA 1V2HE 1D09A 3FOAA 3GRPA 4F2WA 3AV3A 3CH7A 3EGXA 3HB5X 3G4SF 1G9TA 3OP4A 5D84A 2HMTA 4LZZA 1ODLA 2A0KA 3B8HA 4MVYA 3ZCRA 1N5DA 3H11A 4X0EA 4G5OA 4RLQA 4D57A 2AJLI 3W9SA 1V8FA 4FOTA 3REGA 3WLQA 4KPYA 3RDPA 4F5WA 3KBOA 4HDMB 1I01A 5GP1A 5NLLA 1PUJA 3GUHA 1U0NA 4MUHA 2FL4A 1VTKA 3D0KA 1PBNA 5EP2A 2C54A 4JT2A 4R54A 3MHHC 3A1FA 3AYZB 1QG6A 4UDNA 5EGSA 1A9OA 2Q28A 4IHJF 2AT1A 4PWYA 2HJFC 1KQOA 1NI4B 3HNPA 5GV8A 1YRWA 4LNAA 3PA8A 3MB5A 1HDIA 2ZT9B 3CB2A 1FPOA 2FX2A 1R0KA 4EW2A 4DHWA 1QH8A 3V4RA 1SIUA 4HH1A 2ODAA 1L5HA 3LO5A 2OMKA 1JHYA 3FG9A 2EIXA 1MC1A 4GYKA 3HCBA 2KWIA 4WKNA 2FQWA 1PXWA 2XADA 4DV7B 3VH4A 3AEXA 1KDVA 3GCXA 1G9XA 1ZOSA 3V4VB 1UQTA 3P9QA 5AW6A 4E2WA 4RNDB 3DC2A 2GR9A 3WDLA 3ZS9A 2O2SA 2FW7A 4ZVLA 4NOLA 2BEUB 3PNYA 3SS8A 2C1ZA 5KOJA 3H8VA 3EGIA 4CF7A 1RLOA 4G8JA 1C0IA 2VF7A 1UK7A 4W5HA 4B2LA 2GWHA 3ZZ0A 1BU5A 1ATZA 4BFTA 1QVRA 4UBLA 2XA2A 1N8SA 4EHDA 3ZDAA 5JJCA 3KX2A 1W2BU 4JS0A 1Y8ZA 2BC9A 4BR6A 1BJRE 5GADl 4ASUG 3T8YA 2QU7A 3SSAA 4G01B 1MX5A 4MWZA 1T0BA 1ZJWA 1BD4A 1RD4A 1EP3B 2BAGA 3T9AA 3JQEA 1V7ZA 3GNQA 4MXDA 1E5XA 3QVKA 5I48A 1N33B 5C3UA 3TOXA 2JIQA 2D7DA 4I4IA 1Z9BA 4RETA 3MWKA 1RKUA 2QTCA 4PYOA 1EJ6A 3N53A 5E7MA 4RQOA 2J9GA 3DTUB 2Y9MB 2C9MA 1HV8A 2GS9A 4C30A 1Q1EA 2PV7A 4BNLA 3GU3A 2HNKA 2MMGA 3QVXA 2VJPA 4JT8A 3K0HA 3JD2A 3NK7A 2FX5A 3D6NB 3GH3A 4KXXA 2B37A 4IKPA 2HB6A 4K81B 4RM3A 1UJWB 1Q0ZA 1RLTA 1TADA 5FTKA 1RNLA 4AG6A 4BWAA 4HZIA 3LPDA 2IYFA 5HR5A 2RCVA 3C16C 2BBOA 1OB2A 3LH5A 4FR0A 4OTZA 3SNKA 4MV3A 2E4ZA 4DB4A 4CTJA 2XMDA 1Q3KA 1SA0B 3K0FB 2Q0OC 1T13A 3HADA 3KP1A 1F51E 1HNWO 3VUEA 4GVPA 4M53A 3W8DA 2I7XA 1E2KA 4XLZA 4RH0A 5DTEA 3ROKA 3HB9A 5AVKA 1IJEA 5EIHA 3W34A 1C7FA 4WBNF 2WD9A 1H2XA 2JD0A 2WIDA 1QJCA 4BE4A 5BR7A 1GFWA 3OX2A 1OXUA 1NFQA 4CEJA 4POOA 1ZOPA 4FB5A 4G5FA 2BO1A 3HCRA 3INGA 3NRBA 1G5RA 3V8NA 1KZHA 4XFDA 5F1OA 3R3ZA 5FOTA 1K4DC 1HZZA 1V1JA 1HYGA 1ID8A 4AECA 3FA2A 1KFBB 2I4LA 3FAVA 5CRIA 5M29A 4P3NA 4PX5A 5DECA 4YP1A 1AQ6A 5LC1A 4IQFA 5JROA 1S3FA 1XWIA 5K5EA 5KJFA 4MPTA 1PX2A 1SOUA 1Z68A 2NU8B 4COKA 4AO7A 5F78A 2OCXA 4R1OA 4NBKA 1N6PA 1R88A 2DZDA 5LDHA 1Z0SA 4FDVA 2AQ8A 4MKGA 2QGFA 4RTOA 2NUPA 3I09A 2BBTA 1N57A 1MF7A 1EDBA 2WSMA 2WUWE 2ZIZA 3Q5EA 1GTSA 3ZWQA 1OMOA 4ZO4A 2IY8A 5BW8A 3EXFA 1GQRA 3HXPA 3F97A 1LRKA 1E92A 2QPAA 1VSUA 4RTRA 2NTEA 1ZVVA 3NAQA 1N0JA 3HEAA 2VAXA 2UZ3A 2L19A 2W8BC 2F1RA 3ZD7A 5DTRA 1MV8A 5IT9N 3VO2A 1Q6IA 1LTQA 5DW0A 5KHKA 4YMHA 4D97A 2OZEA 4B43A 4TRNA 3JVVA 4IMIB 3D02A 2NN3C 3JVUA 2RHGB 2R6CA 2VJKA 4QUEA 5EIFA 3KUKA 1RRKA 4U9HS 2ZBFA 1S1MA 4LC9A 2ADMA 2X8WA 5JZOA 1IUKA 4KQMA 2G70A 4FWBA 1H2ZA 3A70A 2YRFA 4JOSA 1U3GA 1XBIA 1AROP 3I52A 3C4QA 4ALMA 3EMKA 3KWJA 5H9CA 4IRUB 3K12A 4JI1B 1A7KA 2I65A 1M2JA 3RF7A 4HADA 5GGXA 1EP9A 4G4XA 3OQ6A 3DZJA 2OB2A 1P74A 2DY0A 3LKVA 3QSGA 1IXZA 4MRRA 1V2GA 4RU1A 1RPZA 5HQTA 2O59A 3LYAA 1H8EA 2P90A 1X6VA 4DV7O 2IUEA 3ASNB 1E1CB 1N0WA 3E8MA 2C8JA 3MUNA 4OXSA 3OMIB 3TX6A 3PD0A 4FQ8A 4MIEA 1S9DA 5HXUA 4GICA 1TAHA 2A88A 5KAPA 2GPNA 1EX7A 4RJTA 2B3DA 3J80A 4YIHA 3GFOA 4DW8A 2Z83A 3JQBA 1QF9A 4XIGS 2B1GA 3UC9A 3C5WP 1KOJA 2W83A 1W75A 2KQUA 3DDCA 4PA3A 5ELMA 5L6LB 1QCDA 1N0NA 4C88A 5DIZA 1GN3A 4HVAA 2P6OA 1R0WA 4MKXA 2OGTA 1RMYA 2O1XA 2C4TA 1BE3H 1QP7A 3EGDB 2YMMA 3UAYA 4YV2A 5IK2D 2HZ7A 3LP6A 3FWKA 5DHUA 1YHQV 1DI0A 1XP8A 1N33O 5EZ6B 1CUGA 1CLEA 3R7WA 4A7PA 3MCUA 2N04A 3DJYA 3TLGA 3ZWOA 1C14A 3KJHA 2OAEA 2OCCC 2CJWA 3R3HA 2C3YA 3Q5GA 2IYVA 2Q0SA 4MAMA 3PGKA 1K75A 1DIBA 4ZYZA 2ACEA 3RFVA 2HJDA 3OUFA 2XNKA 3NT2A 2EATA 2VEDA 1Z6TA 4QNNA 3RYFB 3COJA 4U2DA 1ZU4A 1OLUB 3HR7A 1MA3A 1SXGA 3EH2A 2PZLA 1YB6A 5GWXA 1EVIA 1XDDA 4CKZA 4ISBA 4NG4A 4RF2A 5TSDA 2E7ZA 5EWJB 5AVMA 4PG8A 4QG3A 3BDVA 1NJ5A 3TR0A 3P26A 1Q21A 3DUFA 3PWSA 1TMOA 3HRIA 3G0IA 1REQA 3V7WA 1J2RA 3FYUA 2GUWA 5HS6A 4DV3B 2PKYX 2JRCA 2ZIGA 2YNMA 1GG5A 5DDIP 3LHSA 4Y6OA 2OV4A 4E21A 2WTBA 1EIZA 1BWPA 1RRCA 1PDOA 5E7IA 1ZIPA 3VBCA 3OZWA 2B83A 3HM2A 1JG3A 4TSRA 2PBLA 1NR7A 4RZ3A 4GZ3A 1FRVA 4MRPA 3TRJA 4TMWA 5FUWA 4IJUA 2DHQA 5AW5A 4D8XA 2CGOA 1KDTA 1TQ4A 2X5NA 1GQ2A 1GPMA 4FS3A 3DWGA 3DE7X 4MVCA 4EB6B 4D7TA 1YCHA 3DFFA 2JGRA 5IDYA 2J59A 5EERA 4WY5A 5JO0A 1L7DA 2WILA 3RRXA 3DAOA 4X85A 3K71B 2P6PA 2O23A 3DD1A 3CUSA 4I4TB 1YSCA 4JJZA 3KHUA 4BV8A 4F9GA 1RXUA 3JY6A 2ZYSA 1CUAA 4IP0A 5KBYA 3A36A 2W58A 3N6XA 4N7MA 4WOCA 1BGXT 3LHIA 5FUYA 3AONB 2C4KA 3TCKA 4UTXA 4ZOLA 4YAGA 3H1BA 1NA5A 3DDNA 3P19A 1L0NH 4Q4DA 3X1WA 5EMMA 2HHLA 4D42A 1J5XA 3NGMA 3PE4A 3TOSA 4EG3A 1KDRA 3R6WA 3HPLC 2XRYA 5EBWC 5A3VA 3N70A 4WLOA 3AG3C 5F7XA 1IY8A 1ULUA 3ICCA 2VYNA 3TNFA 2W6NA 4YV0A 3CCLV 3S1AB 4ZEMA 1WBDA 1K7XB 4GPTA 1PR2A 3RODA 5MHTA 1TIPA 3WC4A 2FEPA 5AQ1A 2JIPA 1DQZA 2L6LA 2YZKA 3NYWA 1R66A 1SJ9A 2Q9BA 1LXCA 1G4YB 1CYDA 2EIMB 4KSCA 3BM5A 4Q7LA 4FYYA 3ABUA 4JWKA 2WI8A 3KEMA 1YL7A 3CRMA 3IOBA 4B6GA 4NFYA 3NPAA 1ORWA 4M9QA 4OJKA 1TD1A 4JAVA 2OFOA 2GTHA 3L70H 3U4GA 5EQJB 2W9XA 5IJAA 4E08A 2PA0A 3RABA 4QOEA 4Q7EA 4U7OA 5KTOA 3DD5A 1KY3A 1HORA 2ZSHA 5KEIA 4FFMA 2PO5A 5IX8A 1I4EB 2FCRA 3HFRA 2XAFA 4RWEA 2RKWA 1QRAA 3A6ZA 4BVLA 2C4WA 4DV2B 1E0SA 1F3LA 1F2TA 4WDQA 4ED9A 5EKUA 1YUNA 2XRZA 4HRAA 3I01A 3EPRA 3JSNA 5EYPA 4MMZB 4E6PA 1XJCA 3GN2A 4ZVKA 3UMBA 4DCJA 3VAZA 3GJ0A 2OVBA 3ZC3A 2ZR0A 4EYOA 3DMNA 4JL6A 5HP7A 5IP5A 5INTA 2EZ9A 1GADO 1HNZB 5AVRA 3H01A 2RK6A 2NT4A 1BQ4A 1HTBA 1P2GA 3LQ1A 4DMHA 5I45A 4E2XA 3NR2A 4RGQA 1DEOA 2A5LA 2R65A 4EUNA 2YYEA 3N0VA 1KOGA 4DV0B 1ZCJA 3GFPA 2H2AA 4MH0R 1A7AA 2QAJA 1LGYA 1ODTC 4RZSA 3IILA 4FP9A 2AN4A 3G5MA 4BRSA 1GR0A 1UOPA 3PFIA 1N6IA 4M0LA 4W6ZA 4FVMA 1CZLA 1V8ZA 4BWFB 3D7MA 5CK5A 4PW0A 5CGZA 2F1HA 1K6EA 3BD9A 3DMHA 2HTFA 3GRYA 3AK2A 4MSUA 2QVXX 2Q8NA 4Q1FA 3GG9A 2CUNA 3PV0A 3U31A 1T3GA 5AJZA 2PZAA 4DDMA 4C82A 1EPUA 3IMGA 1TO1E 1RZVA 1IONA 2ZYVX 3UJDA 3LFHA 3CEAA 4C06A 2OZKA 1NJIH 5CMLA 4D4GA 3K5NA 1D2MA 1DF5A 3NHUA 4EKDA 5DK4A 3PG5A 1DV2A 4PA7A 5FAXA 1L7EA 4YAOA 4B2PA 4PLHA 1FSPA 3DDHA 1YEWA 1E9SA 4LOJA 4V3BA 4YXWD 4RJ2A 4A8PA 3NBZC 1JHMA 3BRSA 4GBJA 2B61A 2J0SA 1BWQA 3H1PA 1CE8B 1S4MA 1JDBB 3RTCA 4GNKA 4MS2A 4F9TA 3DO8A 2E18A 1YB5A 3HJTA 2GILA 1USIA 2Y0CA 3C98A 2Q21A 4PRZA 3TYXA 1X42A 4QIWF 3GJTA 3F71A 2NYUA 4K9MA 3TQTA 1U9ZA 2ORVA 1PEDA 2H1HA 3H7IA 1W0KG 1W36B 1MRNA 4ZAGA 4JYZA 4QOIA 3OM9A 2EWMA 3OZ7A 5JS8A 1I33A 1XDGA 3WHIA 3F98A 4Q3AA 4LYYA 4P4SB 3AVVA 1GUAA 5E1OA 4FM1A 4D92A 1GUZA 1U0TA 4IIJB 3MS7A 1Z6YA 1U2SA 2FZLA 5JIBA 1TT7A 3HL0A 2YIJA 1J8YF 4B85A 1A8UA 1M2OB 3G89A 5IYZB 3DT9A 3E86A 5JH7F 5EJ6A 1RP7A 3D59A 3OFKA 5CU7A 2EC5A 3E05A 3H19A 3KXPA 3OCWA 2QD2A 3B8NA 3O94A 1O3YA 1S6YA 5DLQC 1VIYA 1VJ5A 2PYZA 4IQ4A 2WJHA 5K3DA 3AG5A 2MR5A 4MQEA 4P3OA 4PQFA 3P9ZA 1YJCA 2Q5JA 2Y1FA 1TYZA 1JFFB 1H4TA 2H06A 3KXIA 4OA8A 2UUCB 2OXTA 4L3VA 4DR3B 2JFQA 1IV1A 4FOSA 1M6HA 1L9XA 1Q20A 4Q4JB 2CGNA 4LJ4A 3UXMA 2IU4A 4LECA 5FXMA 4C7JA 2OZVA 4M49A 1EUDB 4OX9Y 2JGIA 3ZCSA 4G27B 3GJSA 3DFKA 3I6ZA 2GN4A 3UENA 3DE2X 4DT1A 1NTKH 1XQVA 3L7JA 1W40A 1ZBDA 3DTVB 2WSBA 4FBLA 1B8VA 3DV9A 4D9JA 2FSSA 4KP4A 3MGGA 2BE7A 1WP8A 1LLCA 2EX0A 1OC4A 3A28A 3WK4A 4MCHA 1RJWA 1UC8A 2EILC 2JZOA 4M98A 1KEKA 2NNUA 2HHHB 1CD5A 4OKNA 2IW3A 1XTQA 4OQDA 2CBGA 2JAUA 3AEIA 4RVFA 3TSYA 5A3RA 1FDUA 3P9KA 1BXRA 4GEKA 3DPUA 3IEUA 2YFYA 4OH7A 2F4VO 2HA4A 3JARA 1GNQA 2YHBA 5ARCA 4TWZA 1QG2A 4K3VA 3T5BA 3OOHA 4EQZA 2DQKA 2QS9A 4MUFA 1VBNA 1OI7A 1Q1BA 3GLKA 3CHXA 3UKMA 3PJEA 2YWJA 4MUMA 4KIJA 2WTMA 1S9HA 5FH9A 3IUYA 1PR1A 2HO5A 3WX0A 1ZP6A 1W1WA 2UDPA 4C08A 1JEAA 1GYQA 1RHUA 4EKYA 1TGVA 3LHDA 1KE2A 2X0DA 5KDOA 3BCCH 2FFJA 1M7HA 1HXHA 3FTPA 2JZNA 1E3SA 1DKOA 3HMQA 5TMDA 1F8UA 3LECA 1RPRA 4YS6A 2V6FA 2RI1A 3G82C 1U3WA 2EGUA 2FMTA 5I9MA 1CQJB 4LF9O 4ZI2A 5IY5B 1SPXA 2CFRA 3TQOA 1VQOV 1OIXA 5LBTA 4GC5A 3F5SA 4F8EA 2PXCA 1VHAA 4B09A 4FFVA 1YF2A 2UVPB 1G4UR 3H2SA 4L08A 4DY4A 2HRBA 3I6QA 5KDLA 4R8MA 3F7OA 1UBJS 1LPBB 3D8RA 4O2BF 4FN5A 4U02A 3AJDA 4KE9A 1SQPH 1U7PA 3IPCA 1U2GC 4CMIA 2XOKA 1L5ZA 5L4SA 2UZIR 1G5FA 3UKOA 2NPOA 1L7OA 2F64A 3E1KA 2GJ8A 4X3MA 5JMOA 1J0BA 4GUDA 3N5CA 2QENA 1ABBA 5TQVA 5K8UA 2OECA 1HQDA 1Q43A 3I56V 4I1IA 3C48A 2J5QA 2VNSA 4IFTA 3TEJA 3BFVA 1PD1A 1XO1A 2EIKC 4CH3A 2VAWA 3L0IB 3HCPA 3FPHA 4RY9A 5AXAA 3W6UA 1OAKA 4RVNA 3G17A 3QNMA 5CB4B 2PUGA 1WF6A 2QJ1A 2I2DA 2J3QA 3FY4A 2NSDA 1N9GB 3FZGA 5FTWA 5EAZA 3RVYA 2WA1A 5B1BC 3QHAA 1SQQH 2QQGA 2QDKA 2PN1A 3IBTA 1NATA 2R8YA 4UVGA 5K3EA 1G17A 3LC7O 2IWRA 1GM9A 2A9JA 1SVUA 1HQKA 2NIPA 1YI2F 1TW2A 2VUTA 1M66A 4I99A 1V4BA 5BNZA 3FCCA 1CFJA 1WLSA 2H7VA 3F3MA 1RJGA 1VJ1A 2R4UA 5AKZA 5HILA 4UNPA 3MAQA 2GARA 3JAMN 4BLUA 4TZKA 3NNNA 1HSZA 2BR4A 1NT2B 5G53C 3FBGA 4AVYA 4MHSA 1AB5A 2QW8A 4CNBA 3K1AA 4B32A 2Q29A 5FWYA 3KB6A 4RTJA 4C3UA 3UMCA 3NVDA 2EDAA 1XVIA 3VPXA 1J21A 5LA6B 2II6A 1BGYH 1YGPA 4J0GA 2O7VA 3PITA 4XR9A 4TLAA 2LQTA 2P2CA 5EZYF 2C07A 3RJTA 3IXQA 4IIYA 4MR9A 4QDOA 1WMEA 2RGGA 5EMKA 5J2UB 2LXNA 1Y82A 2BM8A 4QE7A 3LBHA 1EWKA 1LBEA 3IMCA 4LOIA 1K9MH 4DR3O 2EP7A 1KQGA 4HATA 1DUIA 3EXAA 2ESRA 2ZRNA 1RM4A 1T5LA 2ACWA 1PZNA 1XAIA 5E0OA 3GV0A 3ACDA 1BN7A 4RXMA 3ILSA 4YQYA 1KNXA 1RSOA 5IE9A 1OI3A 1G66A 3G2QA 5CM8B 2QSJA 5IHPA 2OP0A 4GX2A 5ERXA 3ND8A 4PONA 4DA6A 4QQNA 4Y2UA 4HS9A 3G2IA 2EINC 1M5UA 3R0ZA 2YV2A 1E99A 3LUBA 3BCSA 3V48A 2JHFA 2ZSFA 4PPFA 3HVIA 5BPFA 3L9XA 1SQBH 1BNCA 2GBCA 3ZQUA 2HG5C 1PV1A 2HHHO 2I3BA 2HAEA 2G1PA 1FXWA 1PGNA 2C88A 5CIWA 3R3WA 2FI1A 1ZUNB 4P3PA 1IXMA 2NQ2C 4LXIA 1BKYA 3HP7A 4Z1MD 1OCCB 4BRUA 4W5RA 4Y2SA 3O38A 3FYSA 3ZRVA 3H2BA 2R60A 4K8RB 5CK4A 2Z6VA 3QLUA 1C80A 5IAEA 4QYWA 3P2IA 3DKRA 3L82B 3CLVA 4IZ6A 2KSQA 1PZFA 3NHMA 4MDHA 4B71A 5E3JA 2NVUA 3FRHA 4I9QA 1ODSA 5BWLA 2XE8A 3FI9A 6NULA 3C9UA 4KQWA 1Y89A 3C3WA 5AJYA 4ZRNA 4IYHA 3G0BA 2V7QA 4R8VA 5EHXA 4HYQA 2P9EA 4US1R 4EL0A 1C7JA 1BDMA 1DIHA 3IIEA 5H3CA 4Q1CA 3TKAA 1OH7A 4MCJA 3KPVA 1UBTS 2J46A 3II6X 2BFCB 1T15A 3NHLA 1C7IA 1IBKB 4NDNE 4WKOA 2EYUA 1GL9B 1G5QA 4AZSA 4JI6O 4A36A 4R9SA 1YI1A 2E4VA 3I39X 3AILA 1QR9A 1LPOA 4BNZA 4Y6QA 5E7JA 2Q45A 1NKVA 2WG1A 3TEFA 1UWKA 4NS4A 4POAA 3DLBA 4H7PA 3I04A 1VQ5V 3ETDA 3E53A 1Q6UA 4RJKA 4GOKA 3U37A 4XWGA 2BTQB 2BFDB 1T6XA 4DB2A 2O5RA 3EVFA 2GZ3A 4YAEA 6REQB 2V3CC 1H0SA 4C81A 1NJ6A 4XCXA 2WKWA 4EITA 4OHFA 2I0FA 2JK1A 2DULA 1Z7EA 2JNWA 4JIGA 1VF7A 1UZNA 4ZOCA 2AOUB 4JP3A 2JLBA 4A2QA 3D3QA 3TJTA 3KZ1E 3C7KA 2N1BA 4BJ6A 4DLRA 5LQKA 3PX7A 3N76A 4P4NA 4TMTA 1XZLA 2QSUA 1BROA 3MF4A 4DRXB 3JWHA 3R44A 3NWPA 4XLLA 2QT9A 1U0SY 1U2RA 1WMSA 5F12A 4CYMA 3OE5A 4Z2AA 4UU1A 3W2HA 3ZW7A 2KQXA 3WHLA 3U1TA 7MDHA 2AG5A 1CR2A 4QUKA 2IU3A 4F12A 2N05A 4EX7A 1YJ5A 4ZYXA 1RVDA 3SEZA 4WZBE 4UBKA 2LP7A 4L8LA 3EXIA 3UK6A 4C7UA 5FUQA 4C21A 4CXMA 2ZDGA 2W5UA 4UTVA 4FNAA 3COYA 2J4DA 1W34A 3LOUA 2J6CA 3OPNA 3IVXA 3J7AC 1ZGBA 2XEDA 2BRUC 3JALA 4GP6A 1WSDA 1GGVA 4QULA 2AWNA 4ROTA 4G25A 2WJZB 2BBWA 5IUKC 2O8EA 3PDHA 1Z2AA 4UEOA 3LYLA 3K5OA 5CCEA 1PGQA 4H3SA 1ZWZA 4F4JA 2HVKC 3AIKA 5DMHA 3LHFA 4BC0A 5K8VA 4RHXA 4D6TH 3MT8A 1P80A 5DOZA 4LBEC 5EUCA 1KSFX 3OF5A 5B36A 1SM4A 1PZGA 3BIJA 4KQ2A 3PPYA 5K3FA 1JIQA 4RGVA 2H17A 3MFYA 1DXQA 4BCCA 4QTTB 4BX8A 3SX4A 1XTVA 4KN5A 1BS3A 2JFBA 1SD1A 5AUQA 4PR0A 1KOFA 2CMKA 2HA0A 2Q4EA 5E6RB 4XGNA 2B1IA 1E79D 4UCTA 4E09A 2B8JA 4ZODA 2C8KA 2ZYDA 4GSYA 3M84A 1VI5A 2QQ0A 3GP3A 3DGFC 1N7IA 3ZTWA 2J0UA 2P40A 4LJ9A 3AK4A 2P6RA 5CLFA 1GM8A 4X8LA 4O4IB 2VP2A 2W37A 4BDSA 3KVOA 5BT8A 1R18A 4U2GA 1JA8A 1S8FA 2AI3A 4PA6A 4ZD6A 3H5VA 4I19A 2CWWA 2V7VA 5B1HA 1FU8A 1LBTA 3DHVA 1PSZA 4ME6A 3A2MA 2CSLA 4UU0A 4J8PA 1QAOA 1TPZA 2EJCA 1CCWA 4LBWA 1WE2A 1AQYA 1LU9A 3F47A 4JR0A 3TD4A 4O63O 4YP6A 2OA0A 2C1XA 1D4ZA 3Q1KA 4PPYA 3I55V 4L5YA 4AJ9A 1GRJA 1XZAA 5AVJA 1WDMA 3CC7V 2VSFA 1JDPA 5BW4A 3A26A 1QF6A 1EX1A 2AEFA 2EF1A 1S01A 2D74A 1HE4A 2MOKA 1N6HA 5LKRA 4EFMA 2I9KA 2XHEA 1ZM4A 3G9TA 3QKTA 1GTMA 3SYPA 1NOKA 3SBEA 5IKEA 3KJEA 3AV0B 1XV5A 4PY2A 4L4UA 1DHRA 4XAQA 3P2JA 4QNRA 4BMPB 2DWUA 3DW1X 4P3KA 2JAWA 5DM70 2XH8A 1SAYA 3S6JA 4RSMA 4LSMA 2GXQA 1R0LA 4BNMA 2ARKA 2BHSA 221PA 2WF8A 1W2WB 1XI2A 3TLMA 5G41A 3TR5A 2PX6A 1YFJA 4GQIA 2HWKA 2O1EA 3T7RA 1P4RA 5C8YF 5GJVC 2VQFB 1T4GA 3LA6A 4LJ8A 2AFHB 4C4RA 3VNAA 5AIBA 2NTYC 3F46A 5TPZA 1O2DA 5JSZA 2HBZA 4HLCA 2DWEC 3L1KA 3GP8A 2H5JA 2PYIA 4HYEA 1TZKA 1UK6A 4ZRMA 5ENVA 4NTZA 3KQVA 2OEPA 3ZHYA 1IIBA 5DWVA 4ZHQF 2VHEA 1XWFA 5J2TA 2FRDC 2NXNA 3CXHF 2QYOA 2PBFA 3FVTA 4TV9A 1V4NA 1KAEA 4DIOA 1OKKA 3CLKA 1SCJA 4BTEA 4BP9A 4M36A 3UQZA 1U1IA 2J9RA 2W6OA 3RUAA 1WNTA 2C78A 1XRRA 2O8NA 4JTCB 1NVTA 3V8BA 3RT1A 4RTQA 2RONA 4JELA 1I5RA 5FUMA 3BCHA 3N07A 3ERCA 1ZIDA 4G2KA 3Q7EA 4BB9A 2R7AA 3RUCA 4QM6A 2PVSA 1LF0A 4FFRA 3HXQA 3P7MA 1U6KA 1KU9A 4CH6A 5CLLA 3NWEA 4YJGB 4RDIA 2GZ1A 1GH6A 1PCXA 2WPDG 4H6VA 1GGFA 3BMCB 2WDZA 2ST1A 1FC0A 3FNHA 1JFTA 3QHQA 5FLXM 5KAIZ 3FUVA 2WYIA 1KNKA 3K0SA 3C7CB 5LDGA 3HCNA 4DA0A 3FJYA 2LFSA 1P7YA 1RTKA 5BWBA 4JB3A 1IN7A 2A5DA 2SCUB 4MVJI 3EIUA 3GUZA 3KJKA 3N9IA 1FX1A 1JWBB 4WFQA 1T1JA 3PGMA 3IVCA 3IP8A 4H60A 4KDFA 4YI3A 1P7WA 4UW9A 2AV6A 3FE2A 2R7NA 2QAGB 2ZSJA 4L9AA 4GI5A 1NVMB 3FHTA 2FVYA 3GLFA 2I33A 2XB6A 4EA6A 1K7CA 4B40A 1LBIA 3CD6F 3MQWA 3OIYA 1W85B 4M1SA 2DX7A 1LSJA 4DLVA 1N6OA 3S68A 4TWBA 1SHZA 4CG2A 2OFPA 3NYIA 3QMVA 4GRDA 5TISZ 4L16A 2H1LA 4QNHB 1NH2B 4IDPA 3KXLA 4PYQA 2QXUA 5AM0A 2MSDB 3PHCA 3SC4A 3Q3EA 1DJQA 3K79A 4LDZA 3AR7A 5K8JB 1YZLA 5B1IA 3H1AA 4E7PA 3BSYA 5A9TA 5SY9A 4KC0A 2F43B 4O02B 3AR3A 2FZ5A 5K05A 2B7BA 4KNYA 3EA0A 2QI9C 3ANTA 2GM3A 2QVYX 1FPMA 5GIOC 1P2FA 2OBMA 2C03A 2XCRB 1MKYA 2FW6A 3CX6A 1W19A 2B99A 2QTOA 5DV9A 3OSZA 1VQ1A 5ES3A 4FZ5A 5BV2P 1NJ8A 1GPLA 4BMOB 2YXLA 2GBGA 2LFRA 5K3SA 2C5BA 3UUGA 3HJWC 3TXXA 2QTZA 2EZ4A 4NPAA 1XREA 2CNWD 1K5HA 3UPTA 3JVHA 2I91A 2WHPA 3V42A 4Z4HA 2VPPA 1VMDA 3QQPA 2PJUA 1K2VN 3TQCA 2HLPA 1M1NB 1U2EA 4MW1A 2QUBA 2VHUA 5KAMA 4BVQA 1A72A 4UB8Z 2GZAA 2JK0A 3GJXC 4NMMA 2R9AA 4DMFA 3ZJTA 1J24A 3CRQA 3D6AA 3H9GA 3QH4A 2KG7A 1X3SA 1I2MA 2QMEA 1RMQA 1P1CA 3AHIA 1UZMA 4RTLA 1XJ5A 3BHNA 3RW9A 1W48A 2ZKIA 3N2NA 4X1YB 1LA2A 4DLZA 2H52A 3PIIA 3NT4A 2HNAA 4ALJA 3A9WA 3MCQA 4EJMA 2PBRA 3A1DA 1BEUB 2CV2A 4UM5A 5C1DA 5IZCC 2KGWA 3GEBA 2PKEA 1AGPA 1IQUA 3QUBA 2PNJA 2GTAA 1HZJA 5F3DA 4N7JA 3FKSA 3MWEA 4ESOA 3RVSA 1MX9A 4AI8A 2FWPA 3NXSA 1OXKB 4NE2A 3WNVA 2GKSA 4MW3A 4FFOA 1W4ZA 2D1RA 1KI4A 2RI0A 1GKIA 1IZ3A 3RVZA 3N8KA 1UJ2A 3W2GA 4DCMA 3CEJA 4JI5B 2ODEA 3ROFA 2RB5A 4W8HA 3KQTA 2VP5A 1Z4PX 3FUUA 4DDHA 2C2YA 4N03A 2BFFA 2H51A 2R9RB 1D4AA 4K3AA 2ZS9A 3VGPA 3LUCA 2JS7A 2KHZA 4GQAA 7REQB 5B4UA 2O1WA 1VHDA 3IEIA 3GARA 4J9UE 2P4SA 5I5GA 2JVKA 4UAVA 5LQCA 2RAFA 4MQFB 4OJNA 4M9SA 2Y1LA 4FZ1A 4QE3A 3CRRA 1UMDB 3G3EA 2P2ZA 3ZRSA 3SYQA 3UGTA 3DQPA 3NNDA 4PYNA 4DIMA 3JVEA 1BCSA 3BMQB 1XI1A 1KO1A 2GUZA 4WE3A 2ZS7A 2GZDA 2BL4A 1KIMA 2XV1A 3AFGA 4V0ME 4KO8A 1H2LA 3IP7A 3IQIX 3SYKA 3MT0A 3TD9A 2AJ8A 5ITZB 3ZGZA 1KERA 3SJAA 1E2DA 3DB2A 1Q7YH 5JADA 2Y4UA 3QVLA 4JUIA 2GZ2A 3GRCA 1KMQA 5FI5A 2WF5A 1BMTA 4X8OA 4N21A 2Q4BA 3D36C 1U2DA 1COWD 3E9EA 1Z2NX 3HKEB 1VQLF 3DNPA 2FQYA 2GPTA 3R76A 2X3FA 4PDVA 5A7HA 1LW6E 5C51B 2OV6A 1Q86W 2ZT5A 3WQQA 1NOIA 1QHHB 1JR4A 2B2NA 4YAJA 4E15A 2R00C 4Z9XA 3OA0A 3NTUA 4NARA 1A04A 2IDZA 4B73A 3PSHA 2FDCA 1DBFA 3TLXA 3M8KA 3MJFA 1L8DA 1N0HA 3VVCA 1CLIA 1DCKA 1C0EA 3RTEA 4D9CA 3Q9NA 4DQUA 3HDQA 3CF6R 2FPWA 1RWWA 4EQ6B 5B6IA 4AJHA 1KXJA 2A0UA 1KEEA 3NONA 1T9GS 5JNVA 3CCSV 2WJ3A 3WKBA 1ZK4A 1X7OA 1OX4A 2IH2A 5HEKA 4LWZA 3OY7A 2QEXV 1F4VA 2FX3A 4W5OA 1Q0HA 4BO0A 3R3SA 1FJ2A 1J97A 3VU9B 1O1YA 1ZAKA 1YZQA 3AJRA 4UQOA 3U5ZB 3UATA 2IY9A 1R9MA 3ZEDA 4DCOA 4M54A 2WW8A 3MD9A 6YASA 4I3GA 5IWAB 5AVOA 5B30A 4EIWA 1L1RA 3RGWS 5LOVA 4WSOA 5IDQA 5JZVA 2BZGA 2W4QA 1V54B 5KTSA 2YWGA 3NK6A 3CKMA 5HM6A 4KI7A 1XRGA 2FFHA 3L8GA 2VDRB 3BFJA 2VAVA 5JSHA 4ZVMA 5IMBA 1YFZA 5AG2A 5GAJA 1Y6FA 1VMKA 5AHRA 1KP9A 3L7IA 2RHLA 4JV5O 4BKUA 2PTMA 4OQYA 4G1EB 1J0EA 2CZWA 4PZEA 2YRWA 3UHFA 4LH7A 1PJ3A 3QEMA 3Q3CA 2Q1UA 3VMFB 3KTAA 1HR0O 3FB6C 2XVZA 2SKDA 3HAXD 1ISJA 3GUCA 3T7AA 1YE5A 3CPEA 4WINA 3U11A 3R8CA 4WN9A 3HDHA 1CP9A 4D3XA 3TNDA 3S5JA 3N2EA 2PGIA 5KQGA 2QV7A 3PRKE 1E3EA 4LZNA 4BT2A 1ETHA 4EW1A 4RK1A 3LX5A 3MUEA 3EGCA 1Q84A 2UAGA 3EWIA 2ZIMA 5J9FA 3QPVA 3VR4H 2P91A 3ELCA 2YIMA 3KKKA 3O8QA 3EVTA 3D54A 1X9HA 3K9BA 4CF6A 3CJHB 3A2NA 2WMNB 1DAGA 3VTAA 13PKA 3IP1A 3UK1A 4B74A 3KR1A 5IBPA 1HOXA 3ZQKA 2X8JA 1USWA 2WWTA 2PUEA 4TXHA 5BR8B 4KP7A 4HH0A 5KTMA 2ATCA 3HUFA 4RJLA 3SSMA 2VRCD 3L0YA 1BDBA 3WRVA 3EZGA 3HZRA 1EJ0A 4JI5O 1E1QD 4LFCB 2ZRGA 2CLKB 5K2OA 4AMBA 3SEAA 3PI7A 4P35A 4PF1A 4QJ3A 3ID6C 3EG9A 2O3UA 5A4AA 3LT0A 4CL0A 5P21A 4J49A 4MQ4A 2QRPA 1PSWA 1T34A 2NO5A 2AA3A 2OSVA 5EQFA 5B3SB 4DNXA 1WRBA 4K9DA 1YZTA 3RJMA 3OOSA 2G1JA 4D44A 3LY5A 1AUVA 2WU4A 1QMGA 4OHPA 4BCDA 1Y8AA 5COAA 3RHTA 4P31A 2MU1A 3E3OA 1JGTA 3DZGA 3WG9A 5TMPA 2YCLA 2HKIA 2DBQA 1G6HA 2YUAA 4W82A 1JLRA 1K8AH 1M6WA 5TGZA 5GJBA 1Q82W 1QPGA 2PRYA 4RACA 3KDSE 3JRWA 3NVKI 3R7DA 2JW5A 2QF7A 1R6VA 4TSFA 2N9UA 4CEHA 3OHSX 1A7JA 2FPPA 4B3RB 2DOKA 4J43A 5ELLA 1W44A 1T4CB 3DQZA 3TKYA 2Z3WA 4H3HB 1PNTA 1XL6A 5EMJA 4GMXA 3A7EA 2JJMA 2ZYHA 5JARA 1N3LA 1U0RA 3PUJA 3RADC 2H8PC 3V3KA 4M0EA 1A97A 3RVMA 4G1VA 3NFYA 1Z5ZA 4DUGA 2OZPA 4X1IB 1WOMA 3MTAA 2H0QA 3PFNA 4Q9JA 1PO7A 3QUSA 1T5IA 1DPFA 3PNOA 2JHAA 3JZMA 4JI0B 4LTNA 4B35A 1Y6RA 4TRJA 4OLHA 1ZJ5A 4CQNA 5HP8A 2YOHA 4B6QA 2WPNA 5AUPB 4HH4A 1P19A 3EEQA 2O0MA 3SC2B 1T8PA 4NCAA 5F51A 4YIKA 4BLVA 4IJ6A 4CODB 4DQLA 2AG1A 3STWA 4XVUA 2GCNA 1RI4A 4WOPA 2H4XA 2C4UA 4B7EA 1SKMA 2XTMA 4GYWA 1NI5A 1YK1A 4P4TA 5J58A 5DTJA 4D0SA 3DL4A 1O8BA 1JDNA 2SHKA 3PNPA 3ADBA 4EG5A 3T7SA 3AERA 5EY5B 3FMFA 2BP7A 3INYA 2WLKA 1KYYA 2YTZA 2H4ZA 2QRGA 3CYQA 1ECPA 3KYBA 3MS4A 2HV9A 1K27A 3GFQA 4HDAA 2AI2A 2X0LA 4DSAA 1EUYA 3WLHA 2B4RO 4QYXA 3T6KA 1W4BA 1ADCA 2I29A 4TXNA 2BSXA 4LAFA 1ROPA 2VDJA 4Q4HB 3HKBA 3TM4A 4ZQIA 2BR5A 2G7MC 3VKWA 4ODIA 5CX1A 3UJ9A 4U7WA 2OGUA 5L3QA 2GXSA 5ED0A 2PSFA 2LW1A 3OQPA 1EFPB 4UBJA 1Y6ZA 3CCBA 1Y7HA 4G4ZA 3KVRA 1HEUA 3ULKA 4C8GA 4XI9A 1K33A 5KNCD 2W00A 4U9IS 1KVSA 3N2YA 3W3AA 4BLOA 4N7RA 5D85A 3IP3A 2IE8A 4FYHA 4I36A 3ZX4A 4N39A 1PG5A 1MORA 3EW7A 1LLUA 2J6BA 3SKYA 1I0HA 1EFDN 2ZSEA 5C0OE 1BMQA 3WYEA 5HJ5A 1PEKE 5AVUA 2FPGA 3DT8A 1GGEA 3CCRF 4ARSA 3KYCA 2V1UA 2VDWA 3VQXA 5E79Z 3CF2A 1PV2A 3QA3E 1JBEA 3FD6A 1BN6A 3IMFA 2QZZA 3O9ZA 1SZTA 4OMDA 2XNJA 3GQVA 1CQWA 1TECE 1BE0A 3D8UA 5BN3B 5BR8O 3UO2A 5ALVA 2WKPA 4J94A 1O58A 4X94A 3OJLA 3JCMM 2ABWA 3LXRA 3Q3JB 2JLUA 3FCXA 2O4CA 1VQ4V 4IILA 4B48A 4XIJA 2QZ4A 1I1HA 4I4TF 1KY5A 4HNQA 5EXXA 2XKAA 4DA7A 5U9CA 4BO8A 3RFUA 3NEAA 3S0JA 5M04A 4PQYA 2PEZA 1DLIA 1ZD8A 4Z3OA 1CFZA 3UF0A 4CI0B 1I5YA 4EI7A 4HRXA 2Y3IA 1MVNA 4EFKA 5CYFA 3OPYA 1QP0A 3LW8A 4WL0A 4JI1O 3MXTA 2JIMA 3R7LA 5JQGA 2G1KA 3PNLA 1U8TA 1YDEA 3OPVA 1AB3A 3HHEA 5FPTA 1VPVA 3TD3A 1Q11A 1CR0A 1IHOA 3O4HA 2BD0A 1TPYA 2AR7A 2IPAB 3BILA 4NJEB 5DBGA 1UBFA 2P9CA 3FFXA 2WB4A 3COSA 2DHEA 3CUTA 3LLUA 3WY9A 1OIVA 3FYIB 2ZAIA 3LUGA 1A96A 3KJNA 5AHKA 3ONWA 2LGWA 1X8XA 5HZHA 1WHSB 2QG4A 4JL8A 1Z0AA 4KREA 2RI6A 2PGOA 4DE5A 5JS7A 2GCOA 2CHGA 2WFLA 3WLTA 5A2QA 3OT5A 5C3MA 4MYUA 4BP8A 1XN4A 2GD2A 1A9QA 4YDRA 2YS8A 2PT9A 4OHYA 4TWKA 5AHXA 2CFOA 1X38A 3NJRA 1W88A 2ON6A 3H1GA 5EIBC 2BISA 2NWQA 5FTMA 2I6XA 2CVHA 5I9SA 2QMYA 2BLNA 1XQWA 3TB4A 3UCEA 1EU1A 3ESRA 1FVHA 4UVDA 5FP0A 3PQFA 1IN8A 1CP3A 4DEVA 4IFIA 3RVOA 1K4YA 1AXGA 3UJNA 3U60B 2JBAA 5HA5A 4TT3G 2RC6A 5FLEX 2BFNA 1CF2O 2JCYA 5CNMA 3FFMA 4D9IA 3VZRA 4CFYA 4GMFA 1YRYE 1EFAA 3GPBA 4FM0A 2G9UA 4MW5A 1I9CA 1POXA 5B3JC 3ZS8A 5BNTA 3VR6A 1QPZA 3WHKA 4DPLA 1VHJA 3U7IA 3BXEA 1E1LA 3I9V6 1WXDA 2GLZA 1ESNA 3OQIA 4W8GA 3MTGA 4I55B 3LZCA 3TKLA 1Z83A 4N0QA 3E5RA 4R9NA 1CIJA 1F7VA 2RGWA 2YHIA 4E31A 4Z5XA 5K0EA 1GQYA 2CV0A 2RHHA 2Y9PB 5F2KA 5AKKA 1HOTA 4JC5A 1E2PA 3OZEA 1LR1A 1SC5B 1JTFA 4AQ7A 4TLBA 5KSWB 4FI3F 2GN6A 4RANA 4Q4AA 2XKKA 4CUJA 4MI3A 2XZDA 1MAHA 4DV3O 3CLRC 4ZZ3A 2P5OA 3QXSA 2OIEA 4AN4A 2WLSA 3QHDA 3X2QB 4C3OB 1V8BA 4MVJM 3RUFA 5KREA 4BOYA 2XQFA 3VSBA 3V8RA 1R7RA 3L0PA 2XMRA 1OXVA 3SP1A 1CWUA 2F23A 1Z35A 2NV2B 5KJCA 3NHKA 1EWYA 2BZ1A 4DLXA 2IH4A 3OE7G 5U1PA 3H9UA 3O1LA 3DV0B 1Z82A 3CP1A 1Z5NA 5CFLA 4FDMA 4AMGA 5EWRA 1LEHA 1E20A 3BN3A 1MO3A 3K70D 4MWSA 1SVNA 5CG1A 3TE7A 5HW0A 4N8EA 2P9GA 1H93A 4PXYA 1ZVKA 3AL2A 2BE3A 4BJ5A 5I7UA 5I7RA 3EZ7A 2QX6A 1JMVA 1YI0A 4OQZA 2OHIA 4OHXA 1H2FA 3ROQA 2FNAA 2AE1A 5G1PA 3M82A 4UEJA 3EQZA 1GCOA 2A5FA 4HDKB 3HU1A 1RJ9B 2OBXA 1WU8A 2CLOB 4PD4F 2IBZH 4A8HA 1AXEA 4XYGA 4FNOA 1IOWA 4PFSA 2JCBA 4D4IA 2OHVA 1JY8A 4PV7A 1UBRS 4EW6A 3WLJA 2N48A 5HKKA 1RJEA 3IKMB 4MQUA 5FPRA 4J7AA 4OGFA 4ZAYA 3GEIA 2N3ZA 3N3BC 5EWLA 1PS8A 1OAOA 2PL5A 1Q8RA 3SWWA 1MO6A 1B00A 2VHCA 3ZBUA 1X0VA 2HQSC 3IAUA 4DIEA 2XRMA 5ALSA 1Q22A 1QX3A 4EHLA 4K6KA 2QLBA 5F4ZA 2Z6UA 2IGBA 2DF8A 2C5SA 4IIJF 2P6NA 4N3GA 1NE2A 4CQLB 5FPHA 2BELA 5B7QA 3FNFA 1JV2B 4IEEA 4BNWA 4IH1A 3PYMA 1JKXA 3FRJA 3KCQA 2FUG6 2AKEA 4GMKA 1SG6A 2VJAA 1NX6A 1E3QA 1K4KA 3F3YA 1Q0UA 3LL4A 1EVQA 3V9AA 4IDHA 4OXQA 3UOAB 1SY7A 3TD2A 2QB5A 5EE5B 3ABOB 4CMKA 1T36A 1AKMA 4RQEA 2F8TA 5KHAA 4WH0A 2ACKA 2OBFA 4IG9A 5K0BA 4DV2O 1C30B 4E32A 3WSWA 1SXJE 2GA8A 4FYVA 1XLWA 5TARA 4A26A 4QICA 3TMKA 1G7TA 4OG2A 1CULC 2ZBVA 4XDZA 3LDDA 5JV5A 4RW0A 3Q12A 3V4SA 2AW3A 4EFLA 1JEYB 1TJ4A 2PX0A 4NJMA 3ZVLA 1JKJA 1XVTA 4F6RA 3E81A 4CT0A 1E62A 1HNZO 3H84A 4EG4A 3MTJA 3CLSD 2JI7A 2Q46A 1L4KA 4FUQA 2IP4A 3WYFA 4XB6B 5CNKA 4DV0O 1Z6PA 2ZI4A 1XZPA 2PUHA 3CZQA 3T1CA 1OROA 3KSUA 2KBEA 1X0XA 1EWQA 1R6KA 4K28A 3MWDB 3PHIA 2VP6A 1NR1A 2V9YA 3GYBA 3K3WA 1P4SA 3RVQA 1G8MA 2Y66A 4B4WA 4E33A 3CX7A 2XXAB 4BLWA 3EZ9A 4ZCMA 2F3SA 1MAUA 2RDCA 3IEPA 2VPIA 3JWIA 5ALDA 1KYTA 3J81A 1I7NA 3WIEA 1RBQA 3HP4A 4LV8B 1Q81H 2VTVA 3B2NA 5LBIA 3B1FA 5F98A 4B7KA 4CLDA 3RI3A 4PBRA 1ZPDA 3IFSA 4WPGA 2O19A 2NU9A 3EVAA 2EAUA 3RRJA 3DYVA 3HDGA 3E03A 3MN1A 3WXMA 3W7UA 4DBLE 3HGMA 5ALFA 3ORSA 4IF4A 1JU3A 3P9RA 1QTIA 4FLTA 2QD3A 5BWOA 3ED5A 1P6QA 4H08A 5G4VC 1W76A 2XA1A 3QWHA 5A4IS 5AUOB 1ZL2A 2GK7A 2X5JO 4JJAA 3CW8X 1K9VF 1AK2A 4X89A 1EYZA 1XLTC 2IYPA 1PHPA 1FKAO 5B55A 3NAZA 3D64A 3D3WB 2ZVDA 3KKLA 2G0NA 3UMFA 2C84A 5CCDA 2IPOA 5I4KA 1HM5A 4LNHA 2Q50A 4BFSA 3KOUA 1L5OA 4K9OA 2E4AA 5K0JA 4QVGA 1OLXB 3B12A 4MWDA 4FLZA 3N2LA 2QRKA 1PBTA 2W8BB 3TTTA 4QE9A 5FTNA 1KMCA 1YH3A 3ODGA 3ZMZA 3WYGA 3L74H 3FX7A 2IUTA 3PIDA 3RWBA 3RYCA 3LWNA 2FSGA 2YI9A 4PTLA 2MDTA 1GZUA 4IXDA 1JIKA 4G0ZA 4Q3EA 5CXSA 5B58T 5I9LA 3DFIA 1KI7A 4WOBA 4GO1A 1L1EA 2QPLA 4REMA 3GGDA 4G0YA 3DCIA 4R6WA 5DJ5A 1TM5E 4E5SA 1FJHA 3COVA 3TQRA 3TAHA 2PZKA 1K8YB 1CRLA 5AW9A 5E4JA 3SJBC 1MNQA 3QENA 1IN1A 5HY0A 2IYXA 4H7DA 4TMFA 3OZBA 5CB4F 2QTMA 2WMOB 5T4EA 3AI1A 3CMCO 3Q8KA 2Q2WA 3MWFA 3HCDA 3QPUA 3A9RA 4W4LA 1IEWA 3MRSA 3DPIA 2UUCO 1C8KA 1K3FA 3B38A 2GI4A 2BUAA 4BVEA 2UXXA 2QX9A 1HKHA 1ONIA 3T9EA 4Z54A 2PQMA 3LO8A 1GSHA 3AX6A 1QRTA 2JGEA 3HUUA 1FZTA 3HA5A 2YXEA 4EY3A 5TT1A 3TJZA 4RZ2A 1EM8B 2HT6A 3VR5D 2W6QA 4MIYA 2B5WA 2NZXA 4DREA 3CJRA 4MCAA 2QTSA 1CRQA 2OHOA 3O31A 3UB2A 5REQA 1UJCA 4IJMA 4TQGA 4WUVA 1A4XA 4EVIA 3CXCF 2HC9A 2ZATA 1Z2OX 3CMAV 3OCCA 1NU1H 3GDHA 4F2PA 9LDBA 4YRZA 3GVCA 2G77B 1AM4D 1FS6A 2YKGA 4RTNA 4XH9B 3N8IA 4DANA 4NICA 2PLNA 2DWQA 2PLFA 2JEUA 4MQMA 4X7MA 4JQSA 1A95A 5FHQA 1E7WA 3PIRA 3SQNA 4BEJA 1IM5A 3QEOA 3MJRA 2Y4TA 5LA6F 1IEXA 3ECSA 4ZN6A 4U63A 1XNHA 3WK6A 5HZMA 1VPLA 1PYOA 3G80A 2OCCB 1UL1X 1ZUD1 4WKGA 5BN4A 2HA5A 4O4HB 3M9WA 2GK4A 1YR7A 4H44B 2YQZA 4Y2RA 2RNBA 1A5SB 4UQLA 1ACJA 4Z4CA 5J2UF 3WDMA 2BFMA 4ARVA 4XJTA 1ND6A 3H9QA 4HBGA 1GTJ1 4JKYA 3BY6A 3GMTA 4IDOA 1R8JA 3AY6A 1NKSA 1J8FA 3C6ZA 1T2FA 1EK1A 1Q57A 2JEZA 4HAOA 1WDWB 1XAGA 1D5WA 2FF5A 1JU9A 4KQIA 3C7AA 1XDZA 1XKTA 3RS2A 1QHGA 2A1UB 1O9BA 4P2BA 2ZITA 1W2HA 3K53A 3KKPA 3GVXA 2PUDA 1I6MA 3AWDA 4Z4GA 3GAAA 4AN0A 4RHYA 5CAEA 1XEWY 4JBHA 1JXMA 5CJJA 1V5GA 3NM6B 2P0YA 5EJ7A 2IPLA 1FNBA 4GH5A 2AXEA 1E8MA 2ODPA 2HFJA 4GP7A 3PTAA 2DU8A 1V39A 2ZNIA 1E6WA 2BFEB 4IX9A 2NU7B 4EKWA 1NXOA 2XNDD 3OTHA 2QWQB 5LXTB 4JJ8A 2MSNA 1CXZA 3L02A 5LR6A 5LQDA 2E6UX 4A3SA 2FMXA 2IIQA 3RWRD 3QUQA 1KF0A 2QTRA 4F2DA 2CXOA 1BG6A 4CM7A 1W96A 2MSKA 4HQNA 2OCDA 1HFKA 4JASA 3E7PA 1SXHA 4O3MA 4LWPA 1DUSA 3R5TA 2BKAA 1XT6A 4OU4A 4XKJA 1VJGA 3CYFA 1KDPA 4NE7A 4PLFA 2E2WA 1AS2A 1Y74A 2R8OA 1YITV 3RBZA 3OHPA 2Q9LA 4A6PA 4TTQA 1WABA 2C00A 2JLQA 4BGUA 4WTOA 3OF3A 3HVJA 3CSUA 1KAGA 4A23A 4AKIA 3NMUF 5KTPA 4NECA 4NEQA 3WWPA 2YZMA 4QUJA 3AG3B 3E4CA 3ABIA 3FLEA 1PS9A 4Y67A 1K7YA 3LKDA 1EXDA 3O47A 2BI4A 3BJMA 2WNIA 4RH3A 1QO0D 4L9SA 1JX9A 2R79A 3V3TA 4UTNA 1QP4A 1TL7C 1A2KC 5BSMA 3ACCA 1GGJA 4N0PA 5FPYA 1G6UA 2X0NA 4U6NA 2J8ZA 4ZAVA 4FC7A 2PG3A 5BXQC 1CIPA 3UT5B 1LSOA 4R5MA 1LH0A 1KPIA 5K0TA 4R1MA 3D4BA 4ZI5A 4IW3B 4JY7A 3SYOA 2P27A 1QC5A 4CL8A 4E11A 4HC4A 1Q90D 2UYJA 3WWYA 2M6SA 1LTKA 4NYKA 1HDRA 4BZZA 1RWXA 1B6RA 1FNDA 1S2GA 4BTVA 2LBTA 3AF0A 3SDSA 5AHWA 3BWCA 4R0NA 1L0BA 3D7SA 3UANA 3C1UA 3HB3B 5HE9A 4CIAA 4N3AA 2A9HA 2OOKA 4C07A 4BU1A 4OK5A 2QL7A 2AR9A 2P9ZA 3C6XA 2WHXA 3T3DA 3H97A 5LCXA 3M7IA 4W5WA 4M7WA 2RIRA 5FTJA 1QYCA 4R69A 1HUQA 4BQQA 3KWFA 2YV3A 5ALIA 4HDNA 4MLZA 1DTWB 2CLSA 1NULA 1JT2A 1Y6JA 3UMYA 1DFIA 1JHDA 2PL9A 4GWKA 1SVMA 1XZEA 2HN9A 1VLZA 1RZ3A 2D5IA 3FKSG 5ALHA 3TXQA 2QE7A 2J6HA 8MHTA 4YUVA 3ZG6A 3HABA 2ECKA 2OG2A 3RTAA 2XCTB 1IZ9A 3LA8A 1I4OA 1NZ6A 2OO7A 2M6KA 4PQRA 2IIBA 2EZUA 2A30A 2B36A 3NALA 1Y8QB 1JH9A 2AG6A 2APJA 5E4TA 3TSCA 1SKYB 3OIDA 4QEKA 4TTSA 5E6UB 2MCFA 3LC0A 3AETB 4OHVA 4LMBA 4C01A 2P77A 1W9HA 3WISA 1RW4A 4MVJD 2P9JA 5M34A 1C1XB 1XVUA 4EABA 5AP9A 3IHLA 4BAGA 4NCHA 5B2ZA 1N1EA 1B7GO 1L7AA 4AMUA 3VTKA 3VIUA 4FGJA 3SBDA 3AEKB 2D3WA 5G1OA 3I8OA 1D03A 1YASA 3B6EA 4BNDA 4HFJA 5IT5A 4QAJA 2AHYA 2H07A 2D1TA 4N18A 1P1JA 4X92A 1Q3EA 2AX3A 1VQPF 3T4EA 2VLBA 1MN6A 3QZUA 3AK3A 5BOVA 3L40A 1S8AA 2PWYA 2CZGA 1OYOA 4MSWC 3ZDZB 2I6TA 3Q88A 2JS5A 4ZEXA 3BDAA 1FFSA 3NHZA 2NMUA 1KKLA 2FP4B 1PN3A 3WV5A 4FHCA 1FP6A 1QIHA 4O4IF 1IBKO 1OAPA 1KFKB 2AZ4A 3PFCA 1XQYA 3Q7IA 5K8CA 3DQQA 4N5MA 5ALWA 1VIDA 5EJ5A 3A3NA 3OZDA 1F6DA 4LPKA 3R7AA 3R75A 2ENUA 3GLHB 5KNDH 4J0IA 2X19A 4U1RA 5IJWA 3CW2A 4RO2A 1YUBA 4EA9A 2Q62A 4A5SA 4GOLD 5WRFA 4IGKA 4ZOBA 3PNMA 3OX1A 2X3YA 4D9MA 3UAOA 1TA9A 2IJGX 4NBRA 4RJJA 1CUVA 1NF2A 3ZHSA 4G2TA 4FS8A 3B09A 1FQKA 1H8HA 3TBHA 3Q7RA 3IMKA 3ZIDA 2DFDA 3I2KA 4OQ4A 4DCGA 2CZQA 1Z37A 3J7TA 1NXPA 3WV4A 4D9NA 5EBLC 2B33A 5JFGA 2QLLA 2UYNB 1QYIA 3MJEA 2FE1A 2V9CA 4HXYA 3SEQA 3UWSA 3WPWA 3S1LA 1LPSA 3MNFA 1YACA 3SJCA 1KEZA 1QE5A 7MHTA 1ZOLA 2J7PA 2P7IA 7ABPA 1RYEA 1ZN9A 2AUNA 3ER6A 3JQDA 4DCSA 2AYZA 3T5PA 2HRQA 4I1VA 2O2EA 5LQAA 2IH3C 4B2IA 4QU9A 2PCJA 3L8DA 4EOGA 2IBSA 3H9EO 4K9KA 3CVYA 4OPHA 1NN3A 1OU0A 8ATCA 1XKXA 1HE1C 4J7JA 2DYKA 2JJ8A 1RFGE 1F38A 2FWIA 3N2GB 3S3TA 3MRXA 5AQEA 3TLYA 1V7PC 1ZA2A 4YN3A 4HG2A 4RZUA 3AVYA 2BGTA 3E18A 1FFAA 5EWMB 1MBZA 1G3MA 3C90A 4IICA 1XXHA 3K0CA 1U4OA 4CKEB 3A4NA 4Y2TA 3WO0A 1R0XA 4B82A 4A0SA 5AJWA 3K5LA 3U9TA 3PYXA 2EILB 2QW1A 3DAYA 3IE2A 1YCFA 1QVWA 1G98A 4I08A 2HQOA 3E23A 3P30A 3T7KA 3KU4A 2XAUA 4XPIB 3VJLA 2GDJA 2ZRHA 1VQMF 4P0TA 2ITDC 3I3OA 4XPZA 4YX9A 3PWZA 1P0QA 1BH2A 3AUKA 3QF4A 2FP3A 3GNLA 3J7AR 3UN1A 5BQ5A 3L7LA 1GUBA 3D7KA 1C0LA 1FDTA 1GZ5A 1D4OA 2CFSA 5KQLA 4OXXA 3KEOA 2LUOA 1OD6A 4YJHA 4QTYA 1MG0A 1XUQA 4BXOA 2EFYA 3ZGVA 1WV1A 3BREA 1B0PA 5DN6D 1HKUA 3C1OA 2O8VA 3COZA 1M10A 3I61A 2PZ8A 2Y1EA 5IJ9A 3VA7A 1U2QA 4CZZA 3TL2A 1M6YA 2FUEA 4ZOEA 1D4FA 4H1UA 3ANLA 2GX6A 3OEEA 3ZZUA 1YDXA 1TYDE 2D1SA 3SXPA 3GFFA 5T6MA 1O95A 3HYRA 3ENZA 4HEA6 1IVSA 2D7JA 3TL6A 4YYEA 5JQWA 4YAFA 3DULA 4G81A 3FNQA 2UVDA 4TYPA 4L0DA 1QSGA 2GXAA 2UXDB 2IV2X 1AU9A 4Z0NA 5ECWA 1XTSA 2DC1A 1G21B 1Q5OA 1ZW6A 2B21A 1SIWA 1DLJA 4B8ZA 4C6TA 4JBGA 2ZK7A 1IG0A 3BH0A 3RHFA 1H8EG 1U0GA 5GTIZ 1ADFA 1CUXA 2JAOA 3V2UA 2JEOA 5ILOA 3EIFA 4WZZA 1II8B 1UEXC 4U7TB 1MRZA 1KMIZ 2IUUA 2GJSA 2J9FA 3JWPA 3ZVMA 3A1VA 4NVPA 1P7GA 3IV7A 3KYIB 4IDDA 1UR5A 3GEMA 1P9RA 1WOYA 4BBJA 1TCBA 4G23A 3SE0A 2EIKB 1GXSB 3A7DA 3RS4A 4E5MA 2BGLA 1NBIA 3NBXX 1VQ7V 2PI4A 3IQHX 5AM5A 1QVAA 3X2EA 2P30A 5LJIA 3ENWA 3WGZA 4DC1A 2NPFA 1P2UA 3K0KA 3ZTYA 1XCOA 3T5DA 1SOWA 2HKOA 5B1BB 2Z5VA 3QXJA 2I8CA 3HNOA 1M1YB 3W8EA 4D3SA 3STXA 2XJ4A 2MTBA 4KHPB 4GPIB 3RT7A 3H75A 2H1WA 2WFZA 3B82A 2AMVA 1G6KA 2I99A 4B5LA 4DM7A 2VQFO 1B76A 4H16A 5GONB 1Y8RA 5KMGB 1MC4A 3DC7A 3H4MA 5JALA 4DCNA 2JHGA 4XARA 1IY2A 4Q20A 2X9VA 3I58A 1ECBA 4ENTA 3G1UA 4EPXA 2XQGA 3P9YA 4EHAA 2AD5A 2RHWA 4YCNA 3WP1B 1F1BA 4C4TA 3NHYA 3B40A 2WOJA 2YSUB 5JJKA 3I2FA 2O0HA 1DRVA 3JYLA 5JNTA 1WV0A 4JX9A 4N23A 3RAEC 3HXTA 4X24A 3BTOA 3R9IA 1T1EA 2H00A 2ZKOA 4IHKA 3AB8A 1MQAA 5U4XA 3UXEA 1DL5A 3OJXA 3AW8A 5IBRA 4FE4A 4V0OA 3AU9A 1DEKA 4FILA 3M4NA 3T9BA 1L5GB 3I53A 2QKCA 3G2LA 4X7BA 1VDZA 2OM2A 3A6HA 3DJFA 2GPJA 4NBTA 3IQDB 1JAXA 1Q2XA 3R3XA 4JJ6A 3Q4HA 1ZMOA 3RROA 5J5VA 3BTSA 3LTEA 1NKDA 1R0ZA 1DC6A 3VAAA 4O3FA 2NXEA 4RVHA 5BQ3A 2NTJA 2EBWA 2D5BA 3AIIA 4B7XA 2P78A 5FOXA 4PELA 3O9MA 3QFTA 1PNVA 4N48A 4UNNA 1PUIA 1GSOA 1BA3A 4AZ3B 3ACBA 3E8XA 2UYKA 2JLAA 4FT2A 3T9FA 1BAPA 1EBBA 1U2DC 2EDCA 2N74A 5TE9A 1C1DA 3L7KA 3GWGA 1E6CA 4TXLA 1NZJA 2Q8PA 3L6EA 2VPXA 1TTHA 1PWZA 4FM9A 1I0IA 3FZYA 1F8GA 4HFRA 3ANMA 4AKHA 1A4IA 1QU3A 4IDEA 1J33A 2XB2A 1O94D 2ZB7A 2EINB 1XZCA 1AZWA 2XEXA 5LVAA 1GSAA 1S3JA 4WFKA 2VWPA 4C4PA 4WQMA 4DK1A 5FCDA 3VQTA 8ABPA 1VIAA 3W4IA 1P91A 5D1NA 4BKRA 4GKBA 3GXBA 1EX6A 3HM9A 4EMTA 3DKKA 2FZWA 1DKLA 1T6BY 2V1DA 1M5TA 5HDBB 1WMFA 4P7BA 1MHPA 5ED4A 4BIOA 3AL3A 4P8RA 4F60A 2PUSA 3P9CA 2Y0DA 1GPBA 3GNTA 4B62A 2ZDHA 4UVIA 3PHHA 4RKEA 1VFNA 3A4LA 4M60A 1YHNA 3L0CA 3KSMA 3RO7A 3ZKWB 2P6JA 4ER7A 3MDOA 4L22A 3N2KB 4KMRA 1TUBA 1MPXA 3U19A 4KO1S 1Y42X 2OKCA 1LJLA 3EEIA 2C5FA 4R2MA 3MTIA 3SD7A 1NBOA 1QVGU 4MZXA 3EVDA 2PFKA 2ZUWA 1FFHA 2VA8A 3DBHB 2FLVA 3BXPA 5JD3A 4HB4A 4IAOA 4G07A 1NRJB 2OWDA 5KX5A 3WQSB 2PR2A 3CLUC 3GLIB 2VKTA 1RMTA 2HBRA 3MOGA 1J1IA 3F90A 3ZEIA 3LSSA 2YWDA 3VM6A 2JBWA 3E35A 1HZZC 3TD6A 2DAPA 1EHIA 2C7QA 3HUTA 2IH5A 3O3NB 5H3HA 4IJQA 5B3LA 5CXQA 4MZDA 5AKHA 4G1UC 1O0CA 1Z6ZA 1F0YA 4PO1A 3OKAA 3RVKA 4TXJA 1NU8A 1CJTC 1JHOA 2QORA 4RGBA 5TIIA 3M6MD 4LMAA 1WG8A 4XYEA 5AW3A 3QGMA 2X9NA 3F4LA 2H7YA 2IY7A 3W5UA 4UDYX 3G0GA 4Q4LA 5AICA 1TCCA 1JIJA 1ZN8A 2QL9A 2C7OA 3SEFA 3VPSA 4DXAA 1G0NA 2NT3A 1KQSU 1S7CA 2FPRA 1NZFA 1FP7A 3BKWA 4DDWA 5J40A 4G5RA 4MGHA 3CT4A 2ISCA 1QKIA 2RHMA 3PQ3A 3DR5A 1F6WA 3AMVA 2C31A 2PL3A 1PVDA 3TVYA 2DT8A 2YN0A 4YRGA 1GL3A 3I9KA 5BMOA 1TDJA 4M0DA 4IVQA 3RN4A 2Q5CA 3B6NA 4IS2A 2BYTA 2WRZA 2H5IA 1S0UA 2EGHA 4MS4A 3RYIB 4KQEA 5IVPA 2XDYA 4ENSA 4KHPO 1HLPA 1ZH4A 3AU8A 2E9SA 4NKGB 3HCAA 4IRXA 1V7CA 2KB1A 3LFTA 5AT1A 3WA6A 1CDOA 2MINA 1TO6A 4E1AA 3VOBA 4H4EA 1JJ2U 1KP2A 1GL6A 2D13A 4PAGA 1FFCA 3UGJA 4Z9FA 2GEFA 3OBWA 4KPUB 3STTA 3CUKA 3NM4A 2P75A 3E7DA 3DEFA 4CLRA 2P4KA 4NXMB 1SG0A 1TRKA 2IXGA 2AQIA 2P9TA 3L2OB 4TLEA 5IS2A 5H5NA 2QTWB 1AMUA 2H16A 3K8YA 3MW8A 4F2GA 4F3TA 2GA9A 3BL6A 3ONNA 4OHCA 4AJEA 3SKVA 4X8MA 2OC9A 3BL8A 4M4SA 4RY0A 1P49A 1DMRA 4GZLA 1PF5A 3ILVA 1XBLA 5I51A 4ZV7A 2E5WA 4BLTA 4CKCB 5IK2A 2ZTHA 3H65A 1H05A 1TK3A 3BJEA 2CVOA 4Y0AA 4PQGA 1B3RA 1P73A 3KTDA 3JQBC 4XVHA 3T3NA 2XX3A 1A9XA 4QFDA 2WM8A 2O54A 1QTRA 5CVCA 1W47A 1Y76A 2R4QA 4RKWA 5BRNA 3CB4A 3L4KA 1EGHA 3E58A 1NBHA 4NOMA 4HD8A 4BNNA 2A3RA 2COKA 5IAOA 2ZI5A 1X1SA 5PNTA 3D5TA 1D1SA 4PC3A 2VQSA 3FCYA 2B7LA 4WXEA 4KOEC 1EHCA 1IN6A 3DTYA 5EAIA 1ENPA 4CKWB 3L9DA 1FXUA 2PIDA 4EHBA 1WCYA 4U3JA 4LW8A 3K0TA 5H02A 4N8SA 1ZGJA 2IKSA 3BQNB 3ZDEA 1JSZA 1AILA 5DOVA 1SUFA 1WCV1 1MFPA 3GFTA 1IEVA 2CHSA 4QQKA 3D5QA 3A27A 3THYA 3B51X 3WJ7A 2H29A 2QRVA 1RWNA 2ZVJA 3E48A 2PRKA 4Y9UA 2HWUA 1JQLB 3DZCA 2HCBA 2A5YB 5CYOA 5HOEA 5KYXB 3ZD8A 2EFEB 4CQMB 4G86A 1IVNA 1QNMA 3O4GA 2DWCA 3IE1A 4P3XA 4I2VA 1PR3A 5BVHA 2EIJC 3BXFA 1UM9A 1BT8A 4HNAA 2Q7GA 3FYUC 1FFEA 5P8WA 3ZV7A 3KETA 5CB6A 5IWAO 4G1BA 5JNSA 4BYGA 2HGZA 3IEXA 1OV4A 2YNMC 1IHDA 4DYDA 1XMSA 4B6PA 2Z2ZA 1ZWKA 3ZWMA 1APBA 2PMKA 2XTNA 3SHQA 4YASA 3OFJA 4WFBV 4PNZA 4JNCA 4RELA 1IBLB 2ZIOA 1ZK3A 2ZIXB 4RYLA 4LHEA 4FKMA 1C4WA 4RS4A 3G2KA 4YJFA 1DEHA 2ADOA 1KJQA 4P32A 1YUMA 2XIJA 4HGQA 2XQJA 3ZGOA 2R4TA 4RFLA 2ECPA 1H38A 3R3JA 2NO4A 4JVNA 2EHDA 2GPYA 3GCGA 3PE6A 2AD1A 3P5BA 4QZVA 5A0VA 4E1BA 2FN7A 2YYAA 3ME5A 4OSPA 1VQKF 4C6HA 2JKZA 3ZBPA 2RAPA 4YGXB 1ZWLA 2EWVA 5CH8A 4LXUA 2WSIA 4IDCA 4G5SA 2LGQA 1UM8A 2WTXA 1JG7A 4TT8A 2H1CA 3FMPB 3WGKA 2ZB4A 4Q93A 3VVBA 3ZLTA 3BXXA 3N8DA 1XD2B 2C57A 4DO2A 4OLAA 3MLEA 4R7ZA 1PT5A 1BDIA 5HF9A 1W4LA 4PBTA 3D4NA 3AF6A 1W25A 2PGJA 3UUFA 3X44A 2VH5R 1KZ9A 5FUBA 1EN4A 4UCOA 4DF3A 1YQGA 2PGLA 2ZUFA 2ZRIA 4DQKA 3BIXA 2QM4A 1Z75A 4PYJA 4RZIA 1V4VA 2I4NA 4NCXA 4YUAA 4Q19A 3PUYA 3IA7A 4MWCA 3L0ZA 1KK2A 4PRLA 1K1EA 4EY4A 4G24A 1PQYA 2VUIB 3K0BA 4AJPA 1KDYA 4WLVA 5GM1A 3HB4X 3EODA 3KZNA 1KI9A 5TGDA 2K6GA 5EQDA 5HXAA 4FFBB 3G2HA 4LFCO 1JECA 3IBGA 1GN4A 3RV4A 1Z7WA 2UV8A 2JI4A 1L4UA 3ORYA 4V24A 1IOVA 3O2JA 3MUFA 1NW9B 2QN7A 4NAVA 2XZTA 4MA4A 4JAVC 2XOKG 4ZKIA 5EINA 2GVZC 1LS6A 4P80A 1JLLA 1FMFA 2FKXA 3L8HA 4NXMO 4CNQA 3MVEA 4JQYA 3H0CA 3PLAE 3MMNA 2O2ZA 3LX6A 3V32A 1KU0A 1TEXA 5ELXA 5B4VA 2Y1CA 1SBCA 4DIUA 3ZGNA 3BORA 1L2TA 4JLWA 4JGBA 2ORWA 3UIEA 1WPQA 3LDFA 1K08A 1TVKA 4Q24A 3LUAA 5EIOA 1JPUA 3FVVA 3HI4A 3WIUA 3GWKC 2XAHA 3E15A 2AN1A 4M38A 2Z4SA 4N5LA 1H22A 4EZBA 4FW9A 3K1JA 1GAJA 4DWWA 4NU6A 5TJ9A 1UBKS 1YULA 2HH9A 3WYAA 1IAVA 3QLVA 3ZIAD 5BV1A 4B3RO 2PY5A 5AO9A 4G8DA 1AKEA 3PDWA 1S02A 1KO5A 1KQ3A 2RJNA 3GT4A 1OI2A 1ESEA 3GPIA 3OSUA 3IS3A 4AS1A 3BA6A 3TB6A 3VTIC 1OOEA 1UPFA 4Z7JA 5LL6P 5ETJA 1DBVO 4UNRA 4MINA 4FJ1A 1GEEA 5EC8A 4DWJA 5AI5A 2BMEA 4BVBA 3OTGA 3W9UA 1Z15A 1EWVA 4IH4A 5L3DA 4JI0O 3LRXA 2GVIA 1XEQA 5AKYA 4G4VA 2Q2OA 2MYUA 1VA5A 2GCEA 4GR5A 1IRXA 3QHPA 3HBMA 3RAGA 4URUR 1VQNV 2FMUA 4ETWA 4Z3DA 3FSGD 2G83A 4YXWA 4PPNA 1PE0A 4DABA 1EM1A 5EPOA 4KNWA 2VK4A 4S2EA 3IESA 1W73A 4GPAA 2JLWA 1SHKA 5L3ZA 1CR6A 3BMNB 1NBMD 3U61B 5FIUA 4PHHA 3ECCA 3NVAA 2AZXA 2ODQA 1K4MA 4JI2B 5BY2A 1CS4C 1NNUA 2XLBA 3GF4A 1DGSA 1MJ5A 3ZP4A 2AJCA 4UATA 4O2RA 1M2VA 2HEPA 4DJFC 4LHWA 5K2MA 1UXIA 1FTGA 2WP8J 3WMXA 3HEBA 1SC6A 4YRBA 1WLEA 1SZXA 3NWOA 1QHSA 2P7TC 5BW5A 1OHHD 2ZG6A 3DFZA 1JDZA 2C83A 5KYGA 2JA2A 3O8DA 1RXYA 2CAZC 3PQ5A 5FEUA 4UZSA 3V1TC 2HA3A 2C2OA 1IZ8A 4BS9A 3C3EA 3FZEA 1IBLO 1Z7GA 3F0FA 1OJ7A 5I9IA 1L4LA 2AB0A 1T2AA 4DSZA 3K5IA 2X6CA 2YXNA 5AW2A 3GDGA 4ZP1A 2WIGA 2H59A 2O57A 1JRLA 2WHQA 2Q2QA 3Q85A 3P4EA 1EQ2A 4I55F 3M4XA 1WF3A 1LPPA 1EUZA 5KVVA 3IVAA 4UXIA 4L5CA 1DIGA 3ZI7A 2VBGA 2HSEA 2UZ1A 3AH8A 5BYKA 1KJWA 1VRWA 1EFCA 2YOGA 2RGDA 3A0RA 1EUCA 4IIEA 5AOVA 2AFHE 2AOVA 2QYHA 4N5NA 1JF8A 5BUCA 1OT3A 1E2BA 3VBBA 3JSXA 2JI9A 4E0BA 2EBFX 1UC4B 2GVNA 4BC1A 1Z2DA 3F6RA 1E3MA 3CNNA 1GAEO 4CM4B 1QH8B 3A05A 3B1WA 2WAAA 5BOSB 4DMUB 1L5HB 3KUUA 4M8SA 4RV4A 3TIVA 2RAUA 1KA9H 3CVWA 4RFSA 4D41A 2V7QG 1GQSA 1X86B 1FYWA 4KCGA 1JYEA 1O6FA 3AESA 2N42A 2YN2A 5EE3A 1SKAA 1UMBB 4LRTB 1TM4E 1S3GA 4FYIA 5JCJD 1U28A 4B7ZA 3MWGA 3TNJA 1M34A 1PJTA 3NBQA 4TL6A 1L4GA 2KS6A 1W4AA 4QPKA 1ADBA 2P2LA 1IULA 1Z6XA 4ZT2A 1QNLA 3WVNA 1WNSA 5LP1A 2VJBA 4MVQA 1Y3AA 1X59A 2GD1O 1BVYF 4V1CA 1VCIA 4M1MA 1Q0PA 3OJOA 2PS3A 3IJ4A 1VCMA 2F8SA 5IYZF 4J80A 4QYIA 1WULS 4QTZA 3T5CA 4EEQA 1VBMA 1KD1H 3NI2A 3PE3A 3HVUA 3ZDQA 5FA5A 1GZHB 1B3QA 1J06A 4KE8A 1YVDA 3AM5A 3D0OA 4DUPA 2FDRA 1BCRB 2HI0A 3GJZA 3GZNB 5HJEA 2ZR9A 1UI9A 3ZWBA 2BWJA 3UJ8A 5D7NA 5CDUA 1DG9A 2PGGA 1SBTA 5MN4A 2BE9A 3PC3A 3A6DA 4JB2A 4F11A 5IAGA 4D8UA 2RMKA 3PC4A 2QBYB 4JC0A 4MKZA 1KO8A 2ZBRA 2ZYAA 4ZCSA 4CIYA 2TMYA 3AHDA 2X13A 1MEOA 2F48A 2GZHA 1VSVA 2PE5A 4QXAA 3V7FA 4BP3A 5CD1A 4Q1EA 4JC8A 4UZEA 1UWLA 1F9EA 5A2GA 2YL2A 1J7JA 3JQAB 3HJRA 2C5LA 3ZXIA 2PH5A 2NSYA 5TMBA 5HFMA 2QWRB 4DZZA 2X0JA 1QRUA 4NENB 2FFBA 4M8LA 3FWHA 1ZGHA 4XD2A 4ZVRA 2ZJ6A 4WVFA 4CEJB 1QMPA 2JLZA 2ZRCA 2RHBA 5LWQA 2PSHA 1H65A 3OICA 1Z18A 3HCWA 1J23A 4D56A 2NADA 1PJ4A 2FXVA 4BGDA 2ZIAA 4LCEA 1F06A 4JJEA 4WBSA 4ZT4A 1M4UA 4CRWB 3SM9A 1CDEA 2GSDA 1U0FA 3OUZA 1KVQA 2OGWA 4YBZA 5C5EA 4KIFA 4DA8A 4N6OA 1V3UA 1PLKA 1Z4LA 4I1RA 1X80A 2ZYIA 1ILWA 4KQ9A 2LNDA 4CDRA 2YWXA 1ODJA 3B7WA 3RE1A 4WT7A 2WVAA 3UQ8A 2BGIA 5T5QA 4URXR 4ND2A 1EGMB 3H87A 3AHFA 5GTDA 1II9A 4JI2O 1N1DA 3JZDA 3FD9A 1YBMA 3ZMTA 1WDTA 3ZH2A 4BMZA 4M0UA 4Q0MA 4DCCA 2HFKA 3I2HA 2A7WA 2DW4A 3E61A 5JW6A 4RVSA 2Q4TA 3LFUA 3LUPA 3ABSB 4W5TA 4RMNA 5TPWB 4AKSA 3GWZA 2JGDA 2W2KA 1X7YA 4I8DA 5D1HA 4PAMA 1X1EA 3ZCXA 1G64A 5EMHA 5ES4B 5IANA 2ALJA 5FADA 3BXHA 4FSHA 5H9VA 3AG7A 5JXGA 2DHRA 3BMXA 3OWOA 3C85A 1VGQA 3ZK7A 4DSNA 4I9UA 4IL6Z 1ZRHA 4N1AA 2IM9A 1NVXQ 2X40A 4BV3A 1NBEA 2QL6A 2V0GA 2BMFA 3QQ5A 5HQ3B 1FX0A 5LQUA 3RSQA 3PP8A 3GRKA 4KAJA 3CLTD 1PFYA 5CD9A 4UHHA 3SF8A 1FRFS 2Z09A 3S81A 1IVYA 3Q7PA 1KAMA 4ZO8A 3WNBA 5A9RA 5DBEX 1EAYA 4ZVOA 2F00A 1KOLA 2OYQA 2A3NA 3QXXA