5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
5KX5B 3HKBA 5CB4A 1W59A 4LNUB 3HKDA 5CA1B 3HKCB 3E22A 4U39A 3N2KA 2BTQB 5C8YB 4X1KB 3JAKB 5FNVA 3VO9A 5J2TA 2R751 3M8KA 1FSZA 2RHOA 5JVDA 3JAWA 4O4HB 4I55B 4O2AA 4XCQA 5KMGB 1TUBA 4DRXB 5JCOA 4EB6A 1Z5WA 4F6RB 3RYIB 5EYPA 4U3JA 4ZOLA 5IJ9A 4X20A 3VO8A 3HKEB 1TUBB 4DRXA 4YJ2B 4FFBA 1RQ7A 3RYHB 5LA6A 3JALA 4I4TA 3WGKA 4F6RA 1RQ2A 3JAWB 4U3JB 5IJ9B 1FFXA 1SA0A 3RYCB 4X1IA 5CA0A 5LOVB 3RB8A 3ZBPA 4YJ2A 2RHLA 4IIJA 1W5EA 3E22B 3RYHA 3CB2A 4B46A 1JFFB 3WGMA 4I50A 5BMVB 4DXDA 4X20B 5J2TB 3JASB 2RHJA 4WBNB 5M7EA 4X1YA 5JH7B 4I4TB 3N2GA 1JFFA 4M8IA 5J2UA 4HNAA 1TVKA 4TV9A 5JCOC 4X1IB 5CA0B 5KX5A 3RYIA 4WBNA 4ZOLB 3VOAA 4KWEA 5ITZA 1W5FA 3N2KB 4E6EA 4IHJA 4FFBB 5BMVA 5J2UB 2VAPA 5LYJB 4EI7A 5CB4B 5JH7A 5JVDB 2XKAA 1FFXB 2XKBA 4O2BB 3WGLA 5EIBD 5GONB 5LP6A 2GVIA 3JAKA 1RLUA 2RHHA 5LYJA 5MN6A 4EI9A 4O4JA 4I55A 4O4LA 5ITZB 3JASA 2R6R1 4IHJB 4EI8A 4ZI7B 5GONA 4X1YB 3ZIDA 1W5AA 4ZHQB 5IJ0A 3JALB 1OFUA 2Q1XA 2VAWA 1Z5VA 3WGNA 3JATB 4HNAB 3ZBQA 1SA0B 3HKEA 3VOBA 3RYCA 5LP6B 5FNVB 5LP6C 3JARB 4O4IA 4I50B 5EZYB 4TV8A 5EIBC 4YJ3B 3JATA 3RYFA 3R4VA 4O4LB 4O2AB 5LXTA 2Q1YA 4TUYA 5KMGA 3HKBB 5LOVA 1W581 5IYZB 2VAMA 5MN4A 4IIJB 3HKDB 5CA1A 3VPAA 4O2BA 2BTOA 3N2GB 4EB6B 3C8LA 3JARA 4O4IB 5EZYA 5JQGB 3UT5A 2BTQA 5C8YA 5EYPB 5MN5A 3M89A 4X1KA 5LXTB 2VXYA 1TVKB 4TV9B 4O4JB 4TUYB 4LNUA 5IYZA 3HKCA 4O4HA 5LA6B 3WGJA 4ZI7A 4TV8B 4B45A 5JQGA 3V3TA 3UT5B 4YJ3A 3RYFB 4ZHQA 1W5BA 5IJ0B
chains in the Genus database with same CATH superfamily
3M9LA 3PFIA 1F0YA 4K9NA 3WWEA 2G1PA 1Z0JA 3U9LA 4YT8A 5CYGA 2W6JG 4ETWA 1CRZA 1HYHA 1GN9A 1SCDA 1VMDA 2H0RA 3JYPA 4AS2A 5B8FA 3EHDA 4HNHA 2AZTA 2XH8A 3DW3X 4NMXB 5C8YB 5EE0A 4QDJA 5FUMA 2Y1CA 1J20A 4KSCA 2W00A 3AXTA 4JI8O 2J7PA 4K35A 3LYHA 4HYYA 1JRLA 3IOCA 2IBSA 1UBMS 3X1YA 1M1YB 2C2AA 4J4BA 4KN9S 2AT1A 2G83A 1MNQA 4RZQA 5H80A 3R7NA 2HEPA 4G41A 1UPBA 5C37A 1NT2A 3ZVRA 5ULLA 1L5SA 4Y98A 4JLVA 2C88A 2BEVA 4UUMA 3BG5A 3LQKA 4LF5O 3WIDA 1T35A 1Z0DA 1OFIA 4EFDA 5LN1A 5H7XA 5KKCA 5BWOA 4N3BA 5DWQA 1XYVA 1ODCA 3RARA 1FNBA 2PGAA 5HIKA 4BUJA 4PX5A 5H02A 1RQ2A 3TW8A 4UNSA 2QM8A 3BABA 2HFJA 3AG1C 2HD4A 2VSFA 1ADCA 3IVCA 2UXCO 1T36B 3SXPA 2ONYA 3U3OA 2W8ZA 1O4WA 5I47A 4WXHA 2D2EA 3P10A 2G5TA 3FXAA 2E5LO 4XX0A 3SZRA 1ZMTA 2MT9A 4IGAA 3NHUA 4MVYA 2GO1A 2VYCA 4DLSA 3W04A 2GKGA 4CMGA 1R1BA 5AVRA 1HNWO 4CIBA 1QORA 2DWQA 3VC7A 3T4XA 4JI2O 3U3MA 1EVLA 5C93A 4GF5A 4HX2A 1Y4SA 4YRIA 2Q5EA 1L3CA 5JRZA 2YI9A 4RL6A 3CWCA 5EEGA 2Y76A 3LW8A 5JY1A 4NDZA 3OFVA 2H3HA 4QLBA 5JS6A 4X95A 1U0EA 3UXYA 2AE2A 4JI3B 1TIPA 3TGLA 5EP4A 3D81A 2EIJC 1MEJA 3E8HA 3CPJB 3ENQA 3FUUA 4KE8A 4Z1VA 1FSGA 2V55B 2ZWVA 3R24A 4OHVA 4QVGA 4YFYA 3S3XA 1C9NA 2WT9A 3BIOA 4OQPA 2WZDA 1HZZA 1R7RA 2V5AA 1W96A 2QSZA 3FAKA 3LVFO 4N9WA 1QAHA 3ELBA 2W58A 2HUPA 4TOIA 4OJMX 4HZIA 1SPBS 4X3LA 5CN0A 5AOVA 1QCZA 1XCGB 3EPRA 2E75B 3V4SA 5HZGA 1EINA 2EKZA 3UPUA 1G8JA 2ZBVA 2I2WA 2AI1A 4KXNA 4FNMA 1QJ4A 4F8JA 1H8HG 1BXRB 1X7XB 4YRLA 4G0WA 1DKOA 1NY6A 4EAAA 2V3VA 2OC4A 2F1IA 1QYXA 1NZFA 2PU7A 1TJ5A 2O48X 3AOEA 2HS4A 4D0LB 4Y0NA 4ZGWA 5IC4A 3K70D 3A2LA 3QKSB 1T9CA 2ZB8A 2XHBA 4FN4A 1GO1A 3L0SA 2FK7A 4NICA 3KEGA 3DCJA 3EVDA 1NBAA 3QYPA 4IMPA 1KRXA 1KDYA 4F12A 3B2EE 1MQSA 4JASB 1CNMA 4GX2A 1YZNA 2XVYA 3BE5A 2JLQA 1AGNA 2E1RA 2V1XA 3G2OA 5ALKA 4JXZA 1FYWA 2V7BA 3DVSX 3WK6A 5AW2A 1Q3TA 4PO8A 1S2MA 4DCSA 5C32A 1SHZA 1U8ZA 1NTKH 2JJ1D 1CJKC 4JIGA 4ZP1A 3UC9A 4B4OA 4DA8A 4OIMA 3U61B 5KHOC 3UJCA 4CEHA 1WDTA 3O1JC 2H1FA 4NNJA 3O8CA 1VKHA 3L0OA 5H5NA 4L2IB 3QUQA 1IUNA 1K9VF 2XDQB 5CLLA 3HKCB 1WV0A 4M9RA 3G8CA 3MUFA 3EYWA 4LYGA 3IAUA 3PHCA 3P26A 5FKJA 1I7FA 3FPAA 1B3RA 2EIJB 4K8ZA 1V11A 1WB5A 1QR8A 2NU6A 2JW5A 4W4KA 4BB6A 1DIRA 4OOFA 2H18A 3PNYA 1EP3B 5ED0A 3T3MB 3H8JA 1H0KA 1STOA 2EKQA 4G2TA 5REQA 4E94A 5JJBA 3MSCA 3RADC 3C74A 1YBHA 1NUUA 2HF8A 3GV0A 4KGDA 4F45A 2B83A 3PC7A 2Q9AA 2FW1A 3U7RA 4P7GA 2ZUSA 3PCRB 2WJGA 4Y7DA 5ANRB 3UZUA 4PAWA 4FUTA 4RFLA 3VAZA 3CC4V 3W5BA 2XLBA 5KKNB 3E58A 4TN5A 3HS3A 5LKRA 1HDCA 3ORFA 2ILVA 3T9CA 3IUEA 1NVVQ 1EBFA 1OBVA 3QUTA 2CHGA 1JILA 2JNWA 3MWGA 4IIUA 4K9OA 4C0JA 6AT1A 1KI8A 1YUNA 5CD1A 2AH5A 2WI8A 5HE8A 3X2SA 1JLSA 1SU4A 5BVGB 3RYHA 4LWSB 3JWIA 1XCPA 1E6CA 4E2FA 1SQFA 3VI4B 3AM1A 3A0UA 3PCXA 3RF6A 5G0VA 4P4TA 4PA4A 1OU4A 3IP8A 1NLFA 5DECA 4AICA 3DSQA 4UXNA 2VCYA 4RH0A 4II7A 3L8DA 1L5HB 4XWGA 4F85A 1QQ6A 5B30A 3K0KA 4GBMA 3BWCA 3FSGD 1SBCA 3DHWC 3Q72A 5AIBA 3T5PA 2EGGA 3C5WP 1UT6A 1XWWA 2NAFA 3AB7A 1LUVA 2J32A 5AK4A 4BAUA 3RC2A 2LIPA 4RFVA 1E5LA 5LQMA 1XQXA 4M46A 3G6BA 1NQOA 3STXA 1VQMV 2DULA 1UDWA 2OB2A 2WYVA 2LJ2A 1ZJJA 4EKNB 2Q2OA 2CV1A 1M83A 4AKIA 1XR3A 4P4SB 4AMYA 4RTNA 1F17A 2CDAA 1I32A 1E3WB 2UZ1A 3U4MA 1KK0A 5C52B 4X62B 2B5UA 2QROA 3FUXA 1VL6A 5AM0A 1GA6A 1VJ5A 3RSOA 5BN4B 4YQZA 5BWCA 2AWOA 3WLHA 4Y18A 1RZVA 4AJOA 1K3FA 4BT7A 3U48A 4AZ3B 1XZ8A 5EERA 1Y82A 4WN3A 4FKZA 4CMIB 4UUBA 2WJYA 4XIFA 1DAGA 2B5OA 3KQWA 6CHYA 5FLKA 5BSMA 1JJVA 2OHJA 5AWFC 1OZFA 2FWJA 3PQDA 1M6NA 4BLRA 5FWXB 4OGKA 2JHFA 9LDTA 1JWLA 2FWNA 2AQHA 3DP7A 1DWUA 1PKEA 2RHRA 4DCTA 3DKRA 3L1KA 4PHFA 1PGOA 2VCHA 1VQPF 4BAYA 1A8SA 3BMCA 4I9WA 4GOMD 1Z2GA 4JL6A 5F1OA 1YA4A 4KIUA 4Q66C 5EKXA 7REQB 1U1GA 1ECLA 2GCEA 3JQGB 3ZP4A 1OUMA 4IMIB 3FAVA 4M8SA 4XGKA 5DHPA 5HY2A 1KIFA 5HJ5A 1WE2A 3PR1A 5TJHA 4PAOA 1T3SA 1WU7A 1BD4A 1HSZA 1W0JG 2HMAA 4UXHA 3EDYA 3LBNA 2Q46A 4WZ6A 4ZT6A 4CH3A 3PG5A 5DNYB 5JYDA 4TXNA 2RB9A 1H9CA 4OB8A 1Y7HA 1YZBA 1NJIH 1RYNA 1RYYA 4L72A 5CR9A 1DVRA 3KT0A 2KGWA 5I3ZA 2R65A 3BFPA 3HBAA 3F5SA 5AJXA 1NSYA 3ZJ5A 3BCUA 4HB0A 3DMRA 3F3SA 3OQ6A 4P53A 1JHZA 2QR3A 4RS3A 4XIIA 1FLVA 3AY7A 4MRRA 1Y3AA 2QE7A 3PAFA 5EJEA 2H2AA 3F1KA 4I1YA 1P2GA 4AAYA 3BIJA 3T1YB 1ZIDA 2B34A 2IH5A 4GX0A 1UKEA 3QNWA 3NIGB 4JVOA 1I36A 2QJTA 4G5SA 5HMLA 5I4BA 5B66Z 5DKFA 3EDMA 2QL7A 2G06A 1JPUA 1U0BB 3LY5A 4JVNA 3ZTYA 2AL7A 5ADUS 2BEUB 1JR3E 1ONSA 3M70A 2O3RA 4HO1X 5DLQC 3ZHUA 2XUOA 3H5AA 3FFAA 1KBQA 1P18A 5B55A 3A3NA 4QVIA 1D3AA 4BVSA 1F06A 221PA 4Q0MA 3V8BA 3COSA 3UGKA 3HPQA 2O7RA 3DFIA 5I4IA 3QO7A 5C5EA 2FWPA 3M82A 1P2TA 1ZZEA 3E8GA 1HLPA 3C8HA 3PFWO 5EPOA 3W5IA 3JQFC 3N5CA 4U4AA 4CI0B 1BS1A 1X7YB 1F8XA 3O75A 2RHLA 4HPWA 1AUQA 2VPYA 2J59A 2ZBFA 3EIUA 4QYSA 3SLGA 1OROA 4KW7A 1E3EA 5EWMB 2C78A 4BVAA 1KF0A 4PRYA 3R3HA 2GQ0A 3BBPA 2IDJA 3RVOA 3NAZA 2ZVJA 1KK3A 4ZVLA 3LWOC 5B6PA 2VQ6A 3C2QA 2W7TA 4DMHA 1K86A 2I1LA 4ILEA 1HNWB 1EKXA 1TB4A 4JJFA 1M2JA 1U99A 4HGNA 4HXYA 4KV9A 3WWZA 1J5EO 2EBHX 3AEKB 1YHQV 3N86A 4LJ5A 1VQ5F 5TS2A 4IQ0A 2G36A 3GG9A 3Q88A 3FNHA 5HWEA 1G16A 2PKWA 4R0MA 3P9SA 4R9VA 2I2AA 2ISCA 5DH9A 4DGSA 1K5PA 1DDIA 3BFVA 1DO8A 1VPDA 1EAYA 5IM5A 5A3RA 4FLZA 2P0EA 4RQAA 3MIIA 2NUBA 4B71A 2VH1A 1VIAA 4DXWA 4J91A 4D9CA 2IKQA 1JDPA 1OTYA 2ZTSA 2NO7A 3B9RA 3G9XA 2X0KA 3U81A 5JQWA 1T1JA 1T36A 3U11A 3IQWA 5KIAA 3LOQA 2QR4A 2R44A 1ENVA 1DAHA 1EDDA 3JAKA 2JHGA 1TC1A 3BSFA 4OFWA 5EVCA 2O0HA 4W5RA 4C7OA 3HVJA 1UBGA 4PPNA 5C5CA 3PDIB 4YAGA 2HNKA 2QN6A 2GO7A 1KKMA 4O8CA 4PXYA 1P29A 2AOUB 2XE6A 1JHYA 1Q8RA 1CY8A 3NV9A 1A8HA 3N3AC 4L57A 3W5UA 3W5AA 1YVRA 4V0ME 4EEKA 2GUWA 1KIAA 5HK9A 2PV7A 4PC7A 2ZR8A 3T3HA 2BFEA 1RAHA 2C4NA 3O95A 5BSGA 4K87A 2OV2A 2OYRA 4X44A 4WJKB 3ZJVA 2O8DA 3DM5A 3QO8A 3H42B 1H0HA 5JV5A 2M98A 1Y1SA 4J2TA 3W9SA 2EOAA 4JUBA 1L5FA 5B57C 4ATNA 5EIOA 1YFJA 3NORA 4NZMA 2WSSG 4O1MA 3MYRA 3AH8A 3SJAA 3TLCA 3HB5X 5I7WA 3QVJA 2TECE 1VDZA 2G9IA 1NSFA 2QYSA 4WZBB 3ZDBA 2ZYHA 3GUUA 4GPIB 1AKEA 4Z3OA 3PDJA 1SG9A 1NUAA 5C7OO 4X64O 3P7MA 2A7WA 1G1XB 4H60A 4JXKA 1FMTA 4Q20A 3MWDA 1SXGA 5E9AA 2EIKB 1SZPA 3DSRA 1AKMA 13PKA 1F48A 1T9DA 2HS3A 1ZSYA 1RZ3A 2LUOA 3PKIA 4FDLA 4JC4A 4MQ6A 2Q7GA 2G72A 4ONEA 5EY5B 1WXHA 1W94A 3LHIA 2DERA 1A82A 3OO0A 1I6WA 5FNVA 2AF3C 3HVIA 4QTZA 1YTFB 1MQ9A 3DAOA 1G4HA 5JAQA 3SC2A 1O95A 2ZUFA 1HH4A 1PRYA 2IHBA 4EVIA 3O9OA 2CVZA 3RSFA 2ECQA 4Y6PA 5LMZA 4ENQA 4OQFA 4U7HA 4BJ5A 1TIKA 3JZFA 2CTRA 4WBNF 2HJVA 2A4KA 3K12A 4F72A 4XB6B 1E4VA 1N34O 1X2BA 1LTKA 1YMVA 3VO8A 2XUGA 3LZ6A 5BSVA 5BUQA 3TEMA 4OFZA 4J1NA 1Z2NX 1X9IA 4WFKA 4TSFG 1BHBA 2GJ4A 4MS2A 4J4HA 2VDQB 1A71A 1G8PA 3TKAA 2CDYA 2ALJA 4Z7NB 1SKVA 1ZWZA 5HY4A 1CR4A 1LVHA 2Z1EA 3HC7A 4JLUA 1C8KA 4NV0A 4ZVVA 4BOYA 5KYUB 4WFGA 1O9HA 1KMIY 2HZBA 2I6RA 4P0QB 2FUG6 5AJYA 3OUTA 3ZU6A 4N12A 4DV7B 3SOZA 1REQA 1U8XX 1NFFA 1J1IA 2UZHA 4MW9A 2WLLB 3MIZA 3NZEA 4MPJA 2GEUA 4OMCA 1PG5A 4E11A 3SGIA 4HB4A 2D0DA 4LF6O 3LPDA 4MO2A 1VQPV 3H6KA 4PLZA 4NWOB 3N07A 1R8JA 3TNYA 3EPLA 2C7QA 3P9KA 5DM60 4ANFA 4X24A 4QQRA 4BLVA 1Q2UA 3AFHA 4DCJA 5HKKD 3VIUA 2ETVA 3A4TA 3QVLA 4TKLA 1N2OA 5E2AA 1Q6IA 1RBYA 3H5WA 2WQ7A 4EHHA 1JU4A 4BQNA 1WZ2A 4C4SA 3R6LA 4UD6A 2NXJA 2QG9A 2RG7A 3Q8XB 4NENB 3PV0A 4NFHA 1XCBA 1VQKV 1DAMA 2F43B 3SLRA 3UJAA 5HOQA 4FZJA 5J2UB 5GGYA 3V4FA 5ILOA 4C6SA 4M0EA 3UJ7A 1UKBA 4YV1A 4KFUA 3UICA 3FLAA 1ESCA 3PHLA 3ROEA 1EZ4A 2I22A 2YNMD 2BE7A 2FE1A 2WWRA 2HLDD 3MTEA 4YEDA 1A9ZA 1L7VC 3WRXC 3CZMA 4OAPA 4Y67A 4GZRB 4BUCA 2EHDA 1YDMA 5CLHA 2JA2A 2WWXA 3A4LA 2RD2A 1T9HA 2J9YB 4DQKA 2D00A 2VYQA 2GB4A 2UYKA 2GOYA 4IJUA 4YUAA 4BVJA 4C8IA 1C2YA 4YP9A 1CKEA 1W52X 2ODWA 4TYQA 4ZQCB 2BUBA 4QA9A 2CZCA 3UMJA 5HW0A 1UADA 5LU9A 4K2HA 2FZEA 1C0LA 1M1YE 2IJGX 2X86A 3KDSE 1OYWA 1WDMA 2BBSA 4DWOA 2J45A 3IVRA 1B76A 3DV2A 4PCUA 3BB3A 3HRKA 4G85A 4IS2A 1I9CA 2VP0A 4P38A 1TM1E 3HSYA 4U00A 4KR0A 2GBOA 2IXFA 3FH0A 3QVXA 3VSEA 1V1RA 2VF7A 2YHUA 1X1AA 4HAIA 4O8ZA 4YJFB 3HN7A 3NVAA 2HB6A 4RXMA 3RKRA 5ES3A 4L8JA 2YIJA 4LE0A 2FGKA 3LOUA 3AI3A 2VGNA 3C3JA 3R23A 1Z33A 4I1UA 4HS9A 1W0JD 4TKUA 4ZAZA 1ILWA 2XYPA 2UUCO 1L3IA 1T5TA 1O9GA 4AQYO 2E49A 4OHBA 2W6JD 4BGVA 2EL7A 3MGAA 3EXHB 4LXYA 4AROA 1HZJA 2AUTA 4X54A 4TKVB 1DJQA 1ZGAA 5DCYA 5HF8A 3SR4A 3KZNA 2WMNB 3H19A 1NP7A 2IODA 1DO2A 3L7AA 5IDVA 4MO9A 3CCBA 4F6LA 5JU6A 3GDFA 5CDSA 4DUGD 3C48A 1EUCB 2IHVA 1USIA 4V0KA 3WHIA 3GAAA 3BGSA 4LSZA 4PDVA 1UDXA 4Z7JA 1FUIA 2AZDA 4LF7O 1PT9A 4ED9A 1LLCA 3E53A 2DKFA 4P80A 3FCSB 3LWDA 3DNFA 4GU5A 3PGXA 1EN4A 3WB0A 5D3KA 3WAJA 2W2NA 3OIVA 4CKCB 4LCUC 4QIWF 2FETA 1RLMA 4YI3A 3H6HA 4J7KA 2DYRB 2A9PA 2EWMA 3ZHQA 1V8PA 2HHJA 2V6JA 3JQ8A 4DRZA 3L84A 3NM5A 1J0AA 4EB6A 1NXVA 1QQBA 1ZL8A 1I6LA 3K0FB 1KDOA 3MD9A 4YY3O 2XD4A 3C14C 1Q0HA 3SBDA 1LX6A 2OCBA 3BDIA 3IIKA 1ZWLA 5COQA 5IP5A 1OAPA 2JLAA 5GPBA 5F2KA 1KI6A 1VL0A 2QG4A 2R4UA 2XB8A 3DT6A 3CVUA 1JR6A 1X39A 2RI1A 2Z2IA 3RSQA 4YAIA 5HA5A 2DOKA 1E2UA 5IT4A 3A0BZ 2CHUA 1R0XA 3U7FB 4QNHB 3TSWA 4J03A 5DBFA 4GX1A 4URUR 4B4WA 5F2VO 1WDWB 3I9KA 4YXWG 3M6AA 1M34B 1W5EA 3M1AA 3RH0A 3GNLA 1II8A 1SC6A 3EXIB 1TZKA 4LW8A 3VTAA 1L4GA 1U5BB 1FQOA 5AQ1A 5KVCA 1CYDA 3KM0A 2F6RA 4PE5B 3IMKA 4KK4A 3I5YA 1OCCC 2DUUA 4OLJA 1AU9A 4P82A 4U2EA 2R97A 5F3WB 4ARUA 4UD2A 4LAFA 3B13B 1IV4A 1NRIA 3HDQA 4PBRA 1J70A 5KNDD 4AUNA 1X7PA 2DCMA 3B40A 1T3GA 2DR3A 2XJ9A 3L04A 4IOLA 3K0TA 3LK6A 4I66A 1AS3A 4P93A 4QODA 2G38A 2J5RA 2RGEA 4BX2A 1D5CA 5FOQA 2Z3ZA 2YWBA 3IS3A 3LWVC 4QLAA 4RHAA 1Z74A 4X00A 2BJHA 1S3GA 1NVAA 3DLTA 3M5DA 1H23A 1SULA 5BMVA 1ONBA 1VQ8V 1GDHA 4BFXA 5DLDA 3SPHA 5DI9A 3VYUB 1XHFA 1ZK3A 1GHTA 4J76A 4L4SA 5LMNO 4B76A 3O1IC 3ESCA 1NBMD 5JARA 4IGKA 3K6RA 1YBVA 2JFWA 2GNPA 4PHHA 2PV0A 4FOOA 5FWAA 1W0JA 4ZQGA 3DC2A 1JU9A 2XCIA 4C7JA 2O14A 1JT9A 1YV9A 4UHJA 4DCVA 4EY4A 2Y1EA 4DR4O 4D43A 1WVMA 2ASEA 2EJWA 3JSAA 4A03A 2E2WA 3QHDA 1CRLA 2WJHA 3ENVA 4P4LA 1YQUA 3W8FA 2PKCA 4RNCA 5I8WA 2O52A 1AGPA 2P7HA 4TXJA 3ZYCA 2CNKA 2J48A 2Z08A 2PUTA 1NJ5A 4HUQA 4OJYA 4UU1A 2PX2A 3PX7A 3T99A 2FUEA 1PNVA 2FZVA 2GERA 3VKUA 4BNWA 4DDKA 1QP7A 2W6PA 3GUHA 4LGCA 4PLFA 3WMFA 1PKXA 3TNDA 3NVKI 3RLIA 1XV5A 5IUKC 1VCOA 1AGXA 4EJ0A 2XNJA 2DWCA 3N7UA 5K8JB 4PY2A 1K8RA 4B9EA 2C95A 2O3TA 2A5YB 5ICMA 3USZA 1L8LA 5K45A 1U0SY 3B1VA 4O4IB 1KDPA 5HK8A 4QHYA 4KEAA 5MN5A 4I4IA 2EQ5A 1RHKA 1VSQA 2VQSA 1XAGA 3C3PA 2ZDIA 1OCCB 5BUZA 5AW1A 1P0PA 4UFZA 1AGRA 1DRKA 4FUQA 3WLJA 4FEEA 3AHFA 5ADVA 1KJYA 1FXWA 2Y6UA 3RYFB 4RTOA 4K9LA 1ODEA 2LXNA 1WCIA 2JBAA 4R9SA 1YI1A 3O8QB 3R09A 2QMYA 1VOTA 2UU9O 3TIIA 1B42A 4GQIA 2HRYA 1XEQA 2OMKA 3DEAA 3NLLA 4WLOA 5JAOA 2H63A 1JDBB 2XNCA 4BVKA 2Y92A 2JGDA 2NMVA 1Q92A 2HWYA 3D36C 3NIFB 5TGZA 4P8RA 1WF3A 3CKMA 4B8ZA 1WZUA 4R69A 1S7CA 4X6YA 1XKXA 3EMDA 3GD7A 3OZIA 3A1SA 3A7DA 1IJFA 2VHXA 4WY2A 4BRUA 4KVAA 1JEYA 4KHPB 3B9BA 1WL8A 1QGZA 4UKDA 3B51X 5ALYA 4ZCIA 3RABA 1GQSA 4DSNA 1XL6A 2VIIA 1ULUA 1AQUA 4MUBA 4QZVA 4FM9A 3AERA 4KGZA 3RK4A 1R16A 1K8QA 3BCCH 4AL4A 3WXMB 3W9BA 5LCXA 1QYWA 3OJOA 3MCTA 2ZJZA 3CC8A 3N3BC 1BKDR 4COOA 5KDLA 5G4VC 5AXAA 3O92A 1PUIA 4D4GA 5BUCA 3AEUA 3K0CC 5KWIA 1W87A 1CERA 2GTSA 2HA4A 3FCEA 4GLJA 2VCEA 1MJFA 5KJEA 1O96B 1WSBA 4GXQA 1BL8A 1X19A 2GGSA 2IELA 4IDOA 2ICAA 4Z0PA 1FPMA 4DA9A 3KFLA 1XE3A 3MTGA 2YWRA 1KQGA 4ZAXA 4NE7A 3V48A 4U7OA 1TCVA 3DTYA 2EG9A 3H3XA 1V6AA 2P9GA 3KWMA 4JUDX 2UYPA 1YR6A 5E9JA 1ZRHA 3KVYA 1FS6A 3I5AA 2O2ZA 4EZIA 1R5NA 1YS1X 2VAXA 1BXZA 1KR5A 2GPSA 3N2ZB 1DGQA 1QH8B 1LNQA 3D01A 2QPTA 2CHVA 5EE1A 3V6MA 1XVLA 2BYTA 3M6XA 2KI5A 3IRUA 5FL7D 4C7OB 2OBYA 2OXCA 1YR1A 2QXTA 4LRUA 5BXQC 3TE7A 1YJ5A 3GMDA 2XSZD 3RIYA 1DKQA 3OX2A 4FJCC 3L71H 1GVNB 2P2LA 4I6GA 2J3KA 2OYQA 4JVSB 1N0IA 1TI7A 4RKRA 1W0KA 4CKXA 1YJWV 1MG1A 2YFQA 3SZGA 3ZEAA 5E4FA 4CUKA 2QTWB 5KWEA 4JGBA 3W1WA 1KEKA 2I9KA 3ETEA 3JU3A 1IZYA 3T0IA 2ONZA 2Q5HA 1W76A 5DV9A 2X5OA 1JG1A 4BNGA 1GKUB 4FWBA 4RLSA 4X0EA 3IV9A 3UY4A 4CKBA 1L4NA 4NU6A 4TS9A 2UUAB 1YJAA 5E7QA 1EFVA 3V2GA 2FP3A 3BD8A 4GM4A 4JSTA 1DSSG 3SXUB 1QF7A 4RF3A 1JHAA 1RXVA 1P5ZB 4UE3S 1X42A 2D8AA 2E3CA 1QE3A 2OQRA 3QJYA 4P81A 3OQHA 3BIXA 2DW4A 2ISQA 5HUQA 3UM7A 1E2KA 2KQUA 3SIRA 5AK5A 3RS5A 1GDTA 2QAGA 3DVLA 4ND3A 3RUDA 1S2OA 1N0HA 4R6XA 1CVLA 4MTLA 3Q0TA 2W4QA 3AIKA 1VSVA 5FCDA 3NV7A 4OHYA 1XUOA 4J7CA 3KYCB 2O19A 4EG1A 1VSBA 1U3UA 5BWBA 1ZBQA 3VTIC 2WAYA 4LJAA 2OHWA 3OESA 2BKXA 1SBQA 3TX2A 1WMDA 4BEJA 3KOZA 5A04A 4KXVA 3QRWA 4LMPA 3V1NA 5CBFA 3A9CA 4ARZA 2GD1O 2I67A 1AB3A 4Q3CA 1GARA 3IAEA 4F84A 4G5YA 1NVPB 1I94B 4GIBA 5LFAA 1VIBA 1IJEA 1POXA 1ZC4A 2SICE 2ZJ1A 4HN4B 4P3NA 4NBSA 5DNVA 1YHYA 1R8XA 5AOCA 2WOJA 5ER6A 3W5VA 2CLMB 2DPLA 3BMOB 3WNQA 2YUAA 1HF3A 3BE8A 1IZ0A 1KEZA 4BMCA 2BGWA 2AI2A 3RA6A 1BEZA 2Q1UA 2BFOA 2ZB7A 4J16C 1MVOA 4Y9DA 3RG2A 4PA9A 1Z68A 3RTCA 1GPLA 4AMGA 1F51E 2GXAA 4UMFA 1P6QA 1CN7A 1X0XA 1XNRO 2ORIA 3OZRA 1BX0A 1QK3A 2F9LA 4B08A 2PT9A 3M4NA 4RYDA 2WWVD 3U9SA 1HEYA 5FBWB 2C07A 5B4VA 1NY5A 2QU8A 5J23A 3WHKA 4Q4DA 2GPBA 3CZ5A 3PUIA 4Q3EA 5IAJA 4DC1A 3ZGZA 1WNTA 2Y0CA 4WL0A 1VA5A 1OCOC 1KRWA 1DIGA 4F4JA 1OXSC 1SUDA 3PICA 4UW9A 3RODA 1SEVA 3GA7A 3WLPA 1CP2A 2FOXA 4PRZA 3R3SA 4W82A 3KEOA 5FTLA 1WJZA 2M7WA 4D92A 2DFPA 4EYOA 3UGTA 3TXSA 3RYIB 1L4EA 4P84A 3W05A 2B9EA 3UAWA 1PTKA 2ZDIC 3LE8A 1RDFA 4Y0VA 3BL8A 5T4BA 4AO6A 2WICA 2W6CX 4B3JA 1NW3A 5BR8B 3R74A 1P1FA 1VQVA 3D8CA 2IYYA 1BGVA 3JAWB 1SHKA 2FFQA 1FJGO 1DELA 1Z4NA 3CEMA 2O8EB 4G1UC 4UDNA 1JR9A 2NZ8A 3U3JA 2HXYA 1S2NA 2BGRA 3LVBA 3ZNOA 2QTFA 2V4UA 1DC7A 1EFRA 1LWNA 4FD3A 4JZ2A 1R9NA 1IG0A 1MCZA 1TPYA 3AVYA 1PR3A 3W34A 3AESB 3MOSA 4X1YA 4PFSA 4F4UA 3RCBA 1C7IA 1E2HA 4L76A 1THGA 2FC3A 2Q6TA 1G2QA 3LVQE 2P7TC 3AKCA 5KYWA 3BAAA 1XLTC 3L6BA 1WPRA 2WFLA 4YIKA 2I4TA 1TK2A 3HE3A 4JLWA 4K1XA 2P22C 1DKRA 1XVTA 1SBNE 2KB0A 3CW8X 4TT3D 1NSTA 5EESA 4ON9A 1XHEA 3Q8WA 2XV1A 4UQOA 4XR4A 1D2CA 2PUHA 1ETUA 3L8EA 1R50A 2Q27A 2JJ1G 1D9ZA 1PZEA 4X63A 5BN5B 3V6LA 1VLJA 2XB2A 2IYRA 3SQLA 3L41A 2P2SA 1YB4A 3THSA 4FONA 1WPGA 4WXYB 2RGNA 5K0TA 4LF9B 1ULSA 2QLJA 9LDBA 2ATXA 4A0GA 4ZVQA 1MN6A 3BWYA 3NGXA 1S9DA 3CY6A 2OD2A 3GWGA 1XZNA 4DQUA 4KO3S 4QYTA 1UWLA 4IYHA 1VHWA 3KALA 1Q50A 2X8BA 3IKEA 4H3SA 4NYMR 4QE7A 3WDMA 4ZYWA 4XWKA 2WLTA 3SXJA 3E8MA 4TKVA 3VJLA 1Z25A 4Y1RB 2PD6A 2DM6A 2IHKA 3FNQA 4HDRB 3GXBA 2WSYB 1RWQA 4DV6B 2CHFA 2PMCA 3COZA 4L4UA 3BWMA 1JHMA 1QLEB 1T0HB 4LHVA 5A5FA 1F2DA 2MSLA 3RVPA 3U4HA 3DXFA 1KZ7B 1DBSA 5A4IS 5KYXB 2K9PA 5MN4A 1E4YA 1KZYC 3OEED 4MAMA 4MW7A 1VMKA 5JLAA 3KD2A 3NVMB 2PRIA 4LF8B 1PNQA 3FHJA 1EGMB 2RC6A 3GLIA 4RVNA 4CEHB 2BMWA 2W6OA 1G8AA 3NIDB 1CDZA 2L2QA 5CM9C 1TUEA 2AGVA 2G0NA 3D6NB 1RLGA 3MJRA 3P0FA 3RVQA 2FX2A 2ONJA 4JXJA 3OX1A 3HKCA 1CQZA 2OB1A 3SNHA 4UHKA 5I5EA 3AF4A 2OIEA 1N3YA 4M0MA 1BWRA 2YY7A 4BKUA 2H7YA 2ZBQA 3NHMA 4S1OA 2AW9A 1JVNA 4RA6B 1N5DA 4C6HA 5B1YA 1J1UA 2O8BA 2WIGA 2B2CA 2WALA 2Z3WA 1KSJA 3S70A 1YDWA 1UJMA 2W48A 4FYMA 4JOSA 1HQDA 1P75A 2LW7A 3RKUA 1O0CA 3UKMA 1JHUA 2AE1A 2G9RA 5CCEA 1XBLA 1S9HA 2PYDA 5K20A 1KYXA 1Z5OA 4A6XA 4E5NA 4BAGA 1O6ZA 1QM5A 1H66A 3R6TA 4QT4A 5JS2A 1TF7A 2YCLA 4O4HB 2YXHA 2FMFA 4MI1A 4O4IF 4PZAA 3NCHA 2OORC 2V7WA 3CLKA 4LJKA 5GGXA 1E0JA 2C59A 4MPDA 2OHXA 2GJ9A 4BLSA 4ISBA 4Y9TA 5BN3B 2BAGA 4BWYA 4DA4A 4JI4O 1MAHA 3WXBA 4C7KA 3IUSA 2IXBA 4ZT3A 1BGYH 1F60A 1QYRA 3LPNA 3C6XA 1IPHA 4G0UA 1L9XA 1CF4A 2Z2XA 2GBGA 2QTPA 2AI3A 1OX4A 4QGAA 4DUZO 2PQ6A 3RYHB 1UZNA 1DCMA 2X0RA 1E1RA 3EIWA 3C3SA 2PQ0A 3EQ6A 3IDZA 3CCCA 4R7TA 1MUUA 3P19A 4DLKA 3AEQA 3D3WB 5C80A 1ESZA 4S0XA 2H31A 4RZXA 5AW5A 1UF9A 3GJYA 3HL0A 4QU0A 4C22A 1W36C 3ICWA 4CZ2A 4MWEA 2GDJA 4D9IA 2P5OA 3GT3A 3V1KA 2ZR9A 2CW4A 4X7MA 1G21A 1GKKA 1YB7A 4MRVA 3GYQA 4LWOA 2FW7A 3H9VA 2C9BA 3CG4A 5AI5A 1U2DA 3PHIA 3UJBA 4CZZA 2C58A 5B58C 3EZ2A 5CH3A 4PO9A 4YCDA 3ITEA 1ZM4A 1T9GS 4FYXA 2HPVA 3OZ7A 4UM5A 1AY0A 1Q74A 3IAYA 3CNNA 3GJ0A 2J9ZB 4YP7A 3U4DA 5CXUA 3K1JA 4GMKA 2JEZA 1T5OA 3AEXA 5JSZA 5B1HA 4B87A 2XMDA 5H2FZ 1GNRA 1NAIA 2QD1A 2JFOA 3EWIA 3L6DA 5ECYA 3VX3A 1JTEA 3HDJA 3G68A 3O5AA 5DCVA 5EJMA 3E9MA 3OZEA 1K5SA 4R1SA 4UNPA 3HSKA 4CTMA 4PN3A 5BR1A 3WLAA 5ENDA 5AVUA 3H9EO 1KO5A 1A8PA 1PGPA 1BN7A 2GESA 1JQ5A 4PM4A 4RAQA 4JYMA 3LQ1A 5LGNA 2R3SA 1SK9A 1ACLA 3G0IA 1GCAA 1G5TA 1KYZA 3JTEA 1JVBA 3L18A 4LV8B 4P3YA 4V1CI 3Q3IA 3RKSA 3PR3A 5EE9A 4BT4A 2CBXA 3MWEB 1JYSA 3EWNA 3M6WA 4LCJA 1AUPA 4LA4A 1UM9A 1C4OA 2BI8A 4NZ9A 1Q6ZA 5DEDA 1XWIA 4M1EA 3GLTA 3IODA 5FLYA 3GDHA 2EJUA 2Q6VA 3B1YA 1H1LB 5AJVB 4DEYA 4X97A 3AG3B 1IBKB 3CB4A 3PIIA 4IHAA 2BFAA 2C3MA 3K05A 5H81A 3S7TA 1OYOA 1PSWA 1EZZA 1PG0A 3JZMA 2VSYA 5KJFA 2R85A 2XMRA 1JA9A 5LYYA 1E7QA 2YFYA 3TRJA 4ZZ1A 5LXTA 3BSWA 1YQWA 3UUGA 2YV3A 2C0PA 3L8GA 1N3BA 5DTEA 3OTOO 5EHIA 3OOSA 1OJLA 3H9JA 3QVMA 3WLSA 4B6EA 3MWJA 3TL2A 4D8XA 4EA8A 5JAPA 4KMOA 3E3MA 3GK3A 4U7GA 4ZTBA 1C0EA 1EQ2A 3VYSB 4XXHA 1ORVA 5TMDA 4AP9A 1Y7IA 3FFXA 4IFEA 3DR3A 2ZVYA 3F3KA 2EZUA 5DHUA 1K7EB 5HUJA 1BEEA 5K4GA 2NT4A 1SWVA 1E9FA 4UFOA 2IY8A 2VDMB 3DEIA 3F6MA 1RHMA 1ZD5A 2XTAA 2EBUA 1U97A 3WWPA 5CFRA 1YC5A 3COPA 3LKZA 1K7SN 3V4RA 4E5YA 2W2LD 3FZQA 3F8TA 4L5CA 1FDVA 1O94A 2BFMA 3JSNA 5HDQA 5HKAA 5L3SA 3IE1A 4RMJA 1W30A 4LMBA 2OWEA 2OYCA 1ZGGA 4AMBA 1CU1A 1VIYA 2GVNA 1T3HA 3K8YA 4UQPA 3IKMB 3OEYA 4I5SA 2PYIA 3QFTA 3RUIA 1AZLA 5KYTA 2YI8A 4MW4A 5H4HA 2A4MA 1A0OA 1X15A 2ZJFA 3QKWA 3TEJA 3LC1O 3I56V 1VA4A 1SCIA 1YR9A 2G25A 1J42A 2A79B 2A5JA 2G88A 3LH5A 3A4IA 3CNBA 3QYJA 2AHOA 2ZYWX 2GF0A 3A28A 4HUQB 5EXEA 4AN1A 4IDQA 1IZ7A 5ARBA 3TZBA 4PNPA 3OMLA 3N0TA 4TL6A 4DTIA 4ZN6A 4RS4A 2VEDA 3IQEA 3KJQA 4FLWA 2ZD9A 1VPTA 1U2SA 3CGGA 2PZGA 1GRCA 3N0VA 3ORSA 4GYYA 1GN3A 1Z4IA 4HUJA 1QVVA 3BTSA 3T4PA 1XHZA 4QDXA 4AWBA 4CU5A 5CDUA 2EP8A 3L6OO 2RJ3A 4W4TA 5D7NA 3D64A 4DV1O 4U5QA 3S4YA 4WKNA 3PITA 4EX6A 2GWRA 2DB3A 3RHZA 1RSOB 2WUGA 5H3HA 5KOJA 1Y0BA 4QDKA 4QUIA 5AKGA 1X3LA 5AUOB 2B0JA 3ZJ4A 5CA0F 4NI5A 4IWXA 3SYKA 3D3IA 1BW9B 5F23A 3EH2A 3T7KA 1XFAA 4K86A 2ZODA 1X52A 1PDVA 3UHFA 4B7XA 2Y05A 3DBOB 4J7XA 3JWJA 2DUNA 5CNJA 2QF7A 3GNSA 1BVHA 1G6HA 1EA5A 2XVXA 2OE2A 3O8QA 1QLWA 1ABBA 2PHNA 2AD5A 3QBEA 4C05A 3SQNA 1WSAA 3OFNG 4FKMA 5KJ1A 4S35A 4PS0A 1I3OA 1SHUX 3IDFA 2LGJA 4EUKA 5FWDA 3DF7A 5BXYA 1JQJC 3OMAB 3HDYA 2V7GA 2PHZA 4G0YA 1XTRA 3OX3A 1F5NA 1RPNA 1NUQA 1MRNA 2OVFA 4J1TC 5JZ9A 4ASUA 2O7NA 1Q90D 1AG9A 3C43A 4DBLE 1E3QA 4YMTA 1Q20A 1HDZA 4HRAA 2BFEB 4A5UB 3G1UA 1QBGA 3SHFA 5JPCA 4XEHA 2C1XA 3WKCA 2ZRKA 1UBRS 1HZZC 3PFFA 5IM4A 1NBWB 2QWRB 4ZGGA 2O06A 1V9PA 2JASA 2RK3A 3UFXA 4I08A 4HNTA 4J11A 1T29A 1V35A 2AN9A 3GRYA 3CVVA 1PFYA 3OA2A 4NKRA 4HEJA 3RRZA 1N8RW 2V7VA 1PFWA 3E70C 1N2JA 1EK2A 3GUYA 3IOBA 5AKKA 2BE3A 3R8XA 1Q1BA 2ZCUA 5CGZA 2CNNA 1E1CA 2GNOA 3H1LH 4EF4A 2XADA 3I83A 4E5PA 2GNAA 2UXNA 2I6DA 1EFPA 2GARA 2KYRA 4UEOA 2AR9A 4EGCB 2Q7XA 3TXQA 4G65A 3I1YA 1GYQA 2YMPA 2NW6A 3KQPA 4R2LA 4D7SA 3M6LA 4BLQA 4MHOA 1AO0A 1X7HA 3SJBC 1NBIA 1NQ5A 1G1AA 3R5HA 4RTPA 2H9IA 4HEA1 3AJAA 3IQDB 5T3YA 8GPBA 2EKDA 2ZIEA 3O2NA 5HFAA 1E7RA 4X8MA 1ENPA 3H9GA 1QB7A 4PR3A 4DDVA 3NT5A 2YY6A 4TROA 4WN9B 1E6KA 3DCYA 1S2GA 3MBKA 5DMXA 4ARSA 3GBVA 1NYQA 1XDSA 3BKXA 3L3BA 5TARA 4A27A 1L7NA 1U28C 1QONA 2NQTA 3JX9A 3CC4F 1O89A 1N32B 2ZB4A 2WVJA 3VZBA 2WQ6A 4TMKA 5JVDA 3JAWA 5SZIA 4TQGA 1VIVA 5C4IA 4TZKA 2FWRA 2MYPA 3ZY3A 1D2MA 5FULA 1XVAA 3OONA 2EYQA 2J4CA 1G7RA 2Q4EA 3E6AA 1RWXA 2J3HA 2XUQA 3G1WA 2VK4A 3X1ZA 4YRGA 3BCSA 2EFDB 3I8OA 3P2MA 1SFRA 2BBTA 2VDJA 3T5TA 2JLWA 1CRPA 3HKEB 1XDCA 1NVWQ 1PQ4A 2IEBA 4UHEA 2VHEA 4L5AA 4GVLA 3JR3A 4U9HS 4AB1A 1MABG 1CEXA 5CT5A 4NYMQ 3BTVA 3KZOA 2HL6A 2V98A 4RA6A 3IQZA 1XHXA 1ZGBA 3ELWA 5KOIA 4QARA 3CT6A 3GEGA 2FZCA 3WB1A 3CH4B 1OX5A 2PPVA 4PZCA 2B82A 2JK5C 2VWJA 1CZLA 1EFLA 1IEWA 2VATA 4UUAA 2LBWA 1X7WB 4XTRA 5BURA 1YDXA 1PIWA 2EAUA 3V97A 1NXXA 3VBBA 1YRYE 3HYTA 5EKDA 2BCJQ 4KIJA 5EJAA 1GTG1 1E2DA 1GG9A 1SKQA 5JCZA 4DUYB 1B3BA 3HVKA 3VDMA 4ZZIA 4PPYA 5IRCD 2OCGA 4E07A 3K5NA 2GFIA 5K0FA 4FWTA 1M75A 4GYKA 3T06B 4RTRA 2V1UA 1TRKA 1H1DA 5E95A 2OCAA 3LZCA 1RZUA 1TU0A 2D1SA 3EGEA 3K1TA 3Q9SA 3SSMA 1DL5A 1YAHA 2Q4OA 2HRRA 2QWOB 5A9SA 4OB7A 1L5ZA 1C9DB 1DIOB 2JGLA 4NCIA 3EGIA 2LBPA 3G8BA 3GUZA 3ZDAA 3FHCB 3K0DA 3VJMA 2J46A 4K6OA 1H2NA 1WP7A 2BSXA 3LK7A 3NOOA 4HWOA 4CYMA 1DWOA 3G5TA 1VE1A 3CLSD 4AI6A 1AKTA 1QHFA 2EJCA 4ZC1A 3HMKA 5HE9A 5IT9M 1ZRSA 1T5HX 2VXCA 4I1IA 1U1DA 3CCFA 3MCAA 4IYRA 1RZRA 3VJRA 2ERCA 3G13A 4X66O 2I1WA 3PL5A 2P0YA 3O8DA 4LJYA 1KR2A 3VHLB 4CFZA 1U63A 4WH0A 1CW2B 5I7HA 2JIPA 1A5ZA 1LB1B 1V1RB 4KXYA 10MHA 3PT5A 5FLXM 3D36A 1ISMA 3MAAC 3S29A 1ZCBA 2NG1A 3O2JA 3D3KA 3C5VA 2NQ8A 4PXAA 5DNAA 1P8JA 4CRWB 5KTOA 5A5EA 4YECA 2OFXA 3BRWA 4JBXA 2IP1A 4OJNA 3H1PA 3ND6A 4U6SA 3F5MA 3IEUA 1QLEC 4BFCA 2FR8C 4DY6A 2H2DA 1DJOA 3JQDA 3FDIA 3NGMA 1TK3A 4JBHA 1KBZA 4QAQA 4JI1O 3N8KA 2OTJF 4L51A 3WC4A 1RMYA 4G4IA 5F77A 2QX6A 2J0SA 3IMCA 4GBJA 4UE6A 1TZBA 2G1KA 1FF9A 5CBPA 2OSVA 2PGXA 3QXGA 4P58A 4UUOA 4CLOB 4YJ3F 1QFJA 2YWXA 1CEQA 3OQMA 4O4HA 4CC5A 2P1DA 2SKDA 3EC7A 1N5OX 2I4LA 4YHBA 4BU0A 3G9QA 2D5AA 3AG5A 4MV9A 4J0GA 4RLHA 3OPYA 1CQIA 3F7MA 4YMUA 4C0XA 2QTVA 1SBHA 2AEEA 1DGSA 2ZP1A 2DUMA 1H1LA 1FJXA 2CNOA 1F8GA 1CV2A 1Q84A 5H5JA 3ZWYA 5MFZA 3GYBA 3MWDB 1BSVA 5HGXA 1R66A 3LQYA 3M4ZA 1X7ZA 3MWYW 5CM8B 5FJ4C 4AUEA 1CQWA 3M0EA 1HW7A 1U3GA 3QW2A 4IH1A 4RV9A 3PYLA 1NU8A 4PF1A 1GZ6A 4AMVA 2H8EA 4OXRA 1TA0A 5CT6A 2VP9A 1U8FO 2ONKA 2WSIA 3U56A 5KX5F 1ZPDA 2ECKA 3U4CA 4WFAV 1UBOS 3HB1A 3HBJA 2ZOVA 1SQSA 1U2ZA 4XM1A 1GH6A 5KI6A 3QVKA 4CKWB 1GZSA 1SM4A 2CMDA 4G86A 4NE9A 3T1OA 4H3VA 4IFBA 4G28B 1XMQB 4D9GA 1COWD 5FHRA 5AVQA 4BNVA 2LBXA 1PL0A 1NXTA 3ZE1B 4F38A 1W36B 2RGUA 1E2GA 1E1QD 3LP5A 1YI0A 4L27A 3ST7A 2HT6A 2Q3BA 4Q24A 3A06A 3HNPA 3I6MA 4DR6B 3WHLA 2JJYA 4KDFA 1JL3A 3BMNB 5IWAO 3OU2A 4HH4A 3BN3A 4Y2RA 1JLMA 3I1FA 1IEQA 4C7XA 2XUDA 2H7VA 3QO5A 1TO6A 1Y8RA 3A36A 2HP3A 3ED1A 1FP6A 3OQ1A 1SUEA 3CH5A 3A0HZ 3SEZA 3T4UA 1HNXB 3OD1A 4JQYA 5GOZA 1X13A 4WINA 4N41A 1IBMB 4UTXA 3TR0A 1HL7A 4H1WA 1DHRA 1P74A 3QLTA 4ZVTA 1CQJB 3C8ZA 3Q7SA 1N9KA 4NK5A 3OEEG 2Q7EA 1GCOA 1K27A 2JRLA 1UJ5A 2ROQA 1VHQA 5DEOA 4AWXA 4FFPA 4K0KO 1II0A 4FCWA 4G1FA 1MHPA 4JBNA 1JU3A 2X3FA 1SIUA 2V6MA 1IN1A 4NENA 1RM0A 1KKCA 5EIBD 2POQX 4L8WB 2CGNA 4DL9A 1ZM7A 1NVBA 1OREA 4EGAA 1CR1A 5F5XA 3IURA 1FU8A 4INOA 3IC5A 2R96A 3NHPA 5FOVA 2WJIA 3LDFA 2HQOA 1IPAA 3K96A 3V1YA 1Z17A 3RSLA 4X7PA 4ZHQB 2VQFB 1LPAB 3FCAA 3P45A 4I0XB 3NXSA 1R0KA 4RTJA 2DSTA 1VPEA 4L5BA 4HTFA 1SNYA 1DQSA 1TPZA 3IVMA 3JWGA 5K6TA 1KARA 5KEIA 3T95A 1B23P 3BE6A 4O4IA 1ZD9A 5AQEA 4B40A 4CXMA 3IOYA 5IYDO 4O4LB 1JAXA 1MFZA 2E0IA 2X6TA 2NPOA 4M99A 3S8EA 1Z4JA 3V8MA 4D7AA 1M67A 3ZK8A 3MERA 4LSWA 3HYCA 3I9MA 3RC1A 4MW0A 5CT9A 5B5SA 2I78A 1AGYA 3SVLA 2DJIA 4LUCA 5L6LB 1IJBA 1DC4A 3K9WA 1BZKA 3NDJA 4ZI7F 3BREA 1YQGA 1FDUA 4JEIA 3UW1A 1YOVB 2GSDA 2UYYA 4HDQB 5CM2Z 1JFVA 3T5AA 1VF7A 3FYEB 3S02A 1KIMA 2NR5A 4ZI7A 1OAKA 1KJ8A 2PFSA 1K5QA 3DFKA 3RIHA 1DAOA 1X8LA 2YYAA 3IXLA 4OPMA 1W5BA 3UWMA 4ZVSA 4AY2A 1AOXA 4CQNA 1K6MA 1VHDA 2FP4A 1ZYUA 2XYRA 1SUPA 3GJRA 2CSUA 3K9GA 3OEEA 4IUDS 4RW0A 5ERXA 1TYCA 5HEKA 4DJ5X 2C42A 2BUAA 1P49A 1VLMA 3OSUA 2ZRMA 3MRTA 2C2KA 5JY6A 4PGMA 1L5YA 1W73A 3NTVA 2UYNB 5L95A 2MHCA 3UMFA 2ZK7A 1WLEA 1M0WA 2EFYA 1SVKA 4XCQA 3MWEA 4CCWA 4POOA 5IZCA 2BFBB 5F5NA 1NVEA 2QI9F 2BMAA 2UKDA 4L08A 1J1ZA 4FPPA 3M6UA 4RYLA 4AJIA 5EHNA 4LWQA 3K09C 3SSAA 5L3GA 1KH1A 2NYUA 1YI8A 4PGGA 3THWA 3EDRA 3QLEA 5GINC 1N5LA 1WKBA 2XWSA 4GW3A 3LF2A 4LZAA 4BIUA 4XDKA 2VUHB 4HLUA 3W7XA 1XG5A 2I8CA 4GL4A 1XEXA 4HRVA 5JAUA 4IDAA 1NYTA 3ADPA 1NJ1A 3BD9A 2QM7A 5H9CA 1RYEA 2C03A 1NR1A 3A1NA 2ZIUB 4WESB 5L8VA 5AM5A 3FOEC 1Z4QA 3LJKA 4G25A 1G64A 1Q0UA 1QTQA 3ANMA 1TDJA 3QU2A 4XAQA 4Q93A 1UFVA 3SEQA 1GGKA 3I3SR 3OY2A 2RG1A 4XSVA 2HDOA 3W7WA 2BHRA 1D4ZA 2CYCA 1UBHS 4CM9D 2ADMA 1Z6PA 2PY6A 3NONA 2H6LA 3BA9A 1XFDA 2DQYA 4M1MA 1KJ9A 3BJZA 4ARAA 5CU7A 2WWWA 1BOFA 5AVMA 2E4UA 3FNBA 3N2GA 4YAJA 5ADWA 5DVZA 4L5IA 1YB1A 2NSYA 4YAEA 2R7KA 2DCUA 3A10A 1UK8A 1QG2A 2L0XA 4P5EA 3ZS8C 3G23A 3ABZA 5DW3A 2C04A 5H68A 2VF2A 5GZ6A 2FUG1 3RRJA 1X7DA 2I6GA 3KS9A 5F2NA 1EFCA 1QC5B 3WZMA 2BEWB 2YV1A 3PNQA 4EG8A 3IH5A 2PZEA 3OOEA 1V8OA 3NJ4A 4QJ4A 3QXCA 2EJVA 3AVOA 3JYLA 4KQFA 4Y6QA 3GT7A 2IYXA 5CB4B 5K8VA 4TWBA 4E2ZA 521PA 5JT1A 3GAFA 3KSBC 3DONA 3KQKA 1S8OA 2RHHA 3E9ZA 4UHDA 1FJ2A 3ROGA 3STVA 2BSQA 3K3PA 1BO6A 1JAHA 4UBLA 2N47A 3PQEA 4MWSA 3U44A 1DP4A 2DHRA 5BV2P 5EC8A 3E03A 2P79A 3LX5A 4GI2A 4OATA 2ZYRA 4OA5A 1UKZA 3O93A 2V7QD 1YA8A 1UOPA 5HG0A 3LNMB 3B6IA 4D56A 1ORDA 1XTQA 1GA4A 2GEKA 3OE5A 4OUDB 4LJSA 1OCEA 3TQTA 5G1OA 4RABA 3A1FA 3HACA 4ARZB 2ZWPA 5FQNA 5LZ2A 4N03A 3LNTA 1WN7A 4FI3C 5FUXA 1ZVQA 1IVYA 2OWDA 2QENA 4PRKA 4QJBA 4C6TA 4M0PA 1U2QA 5BSRA 4X8LA 1AA9A 1IATA 2C2HA 5EMKA 5A4FS 1XBIA 5FEUA 5IX8A 3IGAC 4KXWA 4MKHA 4PO3X 4BWGA 1PHPA 4URZR 2F17A 5ESDA 1ULAA 1YJCA 2AMJA 1YR2A 3VM6A 1KVRA 1QZ3A 4CV0A 3HCEA 3Q0EA 1RWPA 5H82A 4U2GA 1JIUA 2KW5A 3GBPA 1FTGA 3DKPA 4EEXA 5JC8A 4QOFA 4MW8A 1LRLA 3DZCA 3MBOA 4M0FA 2EC5A 3UOAB 3T6KA 1AKYA 3EQ9A 3GRZA 3HKBA 2IX9A 1SZTA 1L0LH 2CTWA 3G1TA 3BF8A 3G79A 4YLGA 4CMBA 5KC8A 4Q9AA 2WF6A 1Y4UA 3G0DA 2NV6A 5JZOA 2JIRA 1I2BA 3QHPA 2OIGA 3MDOA 2Y9PB 3LUKA 1IN7A 1ZD2P 2P2DA 3UHJA 4BE4A 4ZJYA 2RE8A 2OQVA 5F2EA 3D7NA 1KHTA 3D00A 4Q34A 2G63A 4DILA 3DQPA 2LFRA 5A9RA 2DFDA 3QLVC 4MDFA 3GZNB 1SS3A 3MS2A 3QXHA 5EE3A 1KAHA 4BT3A 4B3HA 2SKEA 3AUJB 1BIFA 3DS8A 4OTZA 1O94D 4UUNA 4DV0B 5TJ9A 4M2LA 1P0FA 1EN5A 1JEYB 1QKJA 3CD6F 2JVJA 4MTGA 1JKFA 2B1QA 2J5QA 2YRWA 5LA6A 1CP9A 5E7MA 3ZXIA 5FA8A 1E1CB 4K6FA 3NKVA 2B21A 4UBNA 2RB4A 1YB6A 3GJ4A 2YIAA 1TMKA 3O9MA 1P0QA 3D4LA 4G24A 2CF6A 4O02B 4CUZA 1EVEA 4RHYA 3OPYB 4DV4O 3C3DA 3U13A 3E2EA 1CF2O 3OR7C 2FUNB 4QHTA 4HVAA 1E69A 1TL7C 2JD1A 4B46A 3EDCA 4FR5A 4G0XA 2WA3A 2I7VA 3R20A 4NH4A 5JE8A 4ZVUA 3VR6H 2D6FA 4IF4A 2FPIB 3ZWVA 3E0XA 1H1TA 3WADA 3O31A 2A0XA 3A26A 4JSRA 5F73A 3FCYA 2ZNJA 3ABKB 3IR6A 4NBVA 1RS0A 2JD0A 1H7MA 2GS9A 3OZVA 1JA0A 2QNBA 5D2CA 2VDPB 2W2PA 4B3GA 4NPAA 4CW7A 2AC7A 2E4VA 2QTTA 2XEDA 2Y67A 2V3WA 1KYYA 3ZEIA 3IYLW 4CKZA 4HAUA 5LDGA 4D57A 1I7SB 3OPQA 4D9NA 2I7TA 5KQRA 3EBOA 1Z56C 4H37A 4ZA2A 1SBTA 3HVUA 4KE9A 1XRLA 1C8BA 1CDEA 4LVUA 5C3UA 1IN4A 2OA0A 4CG2A 2JFPA 4WXRA 4BMDA 2ZUTA 1QH8A 3H04A 3IESA 4QOEA 1BWPA 1K08A 3VV2A 2LDXA 4M83A 4B7UA 1DDGA 2QVCA 2UYOA 1XWFA 4I2NA 4XB1A 3SMVA 5JVDB 4JOCA 1Q1NA 5JXJA 2XKBA 3PXUA 4R8VA 3X1DA 1MX9A 1SCUB 2C0CA 3PJSK 4AN0A 2PGOA 4TZ0A 1Q0QA 2VPPA 3ADDA 3BXFA 1Y34E 2KG7A 2V3CC 4H1UA 3S8MA 2YW2A 2HP0B 1O5IA 2Q6LA 1GX1A 4R8RA 4BB0A 1M1YA 3L77A 3SYNA 3PC8A 4DIMA 4P33A 5DYNA 4B32A 3U7EB 3AGPA 4GAEA 1ZXXA 1W5AA 1JEAA 1G98A 3SU8A 4GICA 5HY0A 4FU0A 4HBZA 3H8SA 4FSXA 1GU0A 5A7FA 4NAHA 2KG4A 4F60A 4BTEA 2WU1A 3TUJC 4AUMA 4CLOA 2YZMA 4YJKA 3C0KA 4FMDB 1SUSA 2UXXA 5EZYB 1CS4C 2H1HA 1E2FA 2OBBA 3H9UA 2H7XA 4R8LA 4L3VA 4CU2A 3T3DA 1XZBA 3S03A 1O3YA 2C5HA 1CCWA 4PTZA 3RK1A 5JD4A 1GZVA 1NTRA 3OX4A 2XMSA 5NULA 3NASA 3W1EA 3SX2A 3IOEA 4ZCTA 3DOJA 1ZHOA 3E3LA 3HWSA 2XCRB 2C0QA 3FZYA 4IDHA 2PRSA 4H6VA 3ZCRA 1A9SA 5IKXA 3I6BA 2PXXA 3GEHA 1EDZA 3ITNA 4ND6A 2W71A 4XDZA 4Y2GA 1ZISA 1XLTA 3UXMA 4ZHQF 4AJHA 4CM5A 1AE1A 3NHFA 1CLUA 1ZKMA 3G6WA 4NK4A 4DARA 3WGJA 5T57A 2PSDA 1E1RD 2Z1NA 4LOLA 4KIGA 3VKWA 3WZ2A 4ZHQA 4WTOA 4HBNA 3AR2A 5BW4A 5K8TA 2XRZA 1TYEB 2BZ0A 2LV8A 2LNDA 4LFCO 4IDPA 1VARA 3G5AA 4QXQA 4BP3A 1I6MA 3HCOA 2F9FA 2I6FA 4I1SA 4KO8A 4RA9B 4LXUA 1P81A 3Q5GA 2DYYA 1I2AA 5DRYA 4DV3O 1QIHA 1Z34A 4BBJA 4PBTA 1ZXBA 3O47A 4BFWA 4RK5A 5B1BC 1F2TB 2QJRA 3SEFA 2O1WA 5JH7F 4Q21A 2A9VA 4N3AA 4OGQB 1RFYA 1P6UA 1Q11A 1W4ZA 3GPCA 5ICFA 1Q7YW 1K5GA 4YALA 1NC3A 2PEYA 5F52A 4D79A 4A73A 3TTTA 3VISA 3AEQB 2JRIA 3D3WA 4MUMA 1J06A 3G0OA 1ZFNA 4KUGA 2F1OA 3OICA 3SF8A 4ZQIA 1ZR2A 1QP4A 1F8UA 3EF3A 3QFRA 1E3TA 4KX5A 2MIIA 2Z2YA 4KBYA 3AG1B 3MJTA 2JJ2D 3UWOA 5KNBD 1GPJA 1W29A 2VYFA 1D9XA 1XRSB 3HNOA 1E77A 3NW9A 4JI8B 4I4CA 3UW3A 1KSGA 3K1AB 2JGRA 3ZQ4A 4DMLA 5GW7A 3LIIA 4OU5A 4P3OA 2GM9A 3T9FA 3U1TA 1KZ4A 4AP6A 5C81A 1ADJA 1BHAA 2OO3A 3HR4A 3SM3A 2MDTA 1KI2A 1T6BY 1WB6A 2JIQA 5LNK1 4QGBA 3R0XA 4BDSA 3K6SA 3TW4A 2UYNA 3OOWA 3ECAA 4WLUA 2Y99A 3VYSC 3JCZA 3A32A 2IBZH 3CKYA 1EEHA 2HRBA 1LDYA 1V5WA 3ETJA 4YS6A 4PZ9A 5DXAA 3IBYA 3ABTA 4WUVA 4WERA 1GGEA 3QE3A 3PKZA 5AHWA 2IYWA 1H8ED 2LKDA 3N05A 3HDVA 4RDIA 4HNAA 2H1WA 4RUFA 4LF8O 5EWJB 3K0SA 1U2RA 1Z82A 2GPNA 2C9DA 4JDUA 3BUSA 3P9IA 3ZDEA 2Z3VA 1W42A 1SZXA 4MRAA 2OILA 2HMVA 2X0FA 2QYHA 4WCVA 3WG9A 4XFDA 1VEWA 4RGQA 5G0TA 2IXTA 3SJAC 4JBLA 4O08A 2IZ0A 3W7SA 1NRWA 3R8CA 3IAS1 3OTWA 3KHUA 1N5IA 1Z5ZA 2HBYA 1EB8A 2YXNA 1F9AA 2OVBA 3PQ5A 4KC0A 4LZOA 5IBPA 3H11A 1RQRA 5AKYA 3SJBA 4CDGA 1LJUA 1TYAE 5LUBA 1E8NA 5D01A 1KOJA 1ZH2A 5DX8A 1OKKD 1W6RA 5T6BA 4O4LA 2QWXA 4LKRA 4RWUA 3DQQA 4RGYA 5IKPA 2YFHA 4PSDA 1YAJA 3SMQA 3SSNA 1LSUA 3AF2A 3I28A 2B4YA 1UBSB 3V7QA 2C7BA 2UYGA 1U7PA 1NIJA 4CIXA 3A70A 1CUBA 4INZA 2QEQA 3OEWA 1SHJA 4JH0A 2ZI9A 3WL6A 1JTVA 3HZRA 2QTAA 3T7SA 1QF6A 3OU7A 2PZBA 1UXKA 4LI3X 4TRRA 1QMPA 1H5QA 2ZCJA 1U5CA 5EC2C 2O8VA 4B7CA 3ZTTA 2VK2A 4WMLA 1T2FA 4AJNA 2PTMA 5JSHA 5KSZA 5FDFA 4R4JA 1YHQF 3T15A 4GGPA 1CYEA 2HMTA 1NI5A 3RK0A 3TLXA 5BVGA 3MLEA 1CJVC 2WJJA 1E6WA 4MRMB 2XAGA 3O4FA 1I1OA 2OENG 2CL6X 2PWPA 3CLVA 3QVGB 1Y5MA 1ENZA 1X1RA 1O57A 5DNUA 1TRHA 4NNOA 3EEYA 1E1QG 2N04A 4REQB 2AXEA 3KJFA 2R4TA 1R5JA 3X44A 2FH5B 5KYXA 1L8DA 1YWGO 4MK4A 4IL6Z 1COWG 3H3JA 4KN6A 5LPNA 2ZYVX 3X2QC 1IQ0A 2PAFA 3IERA 2A78A 3R4CA 4K0RA 4R1UA 4C20A 2B37A 1B8UA 1UXGA 1R4NB 4JUAA 1USUA 1BQEA 3E1SA 2BFNA 3IP6A 5EXSA 2PD3A 4ZCRA 2NVUA 3O4IA 3SBXA 1QQ7A 2NX2A 5LOVF 1P1BA 3TQCA 4ACAA 4AKHA 2C99A 5LXTF 4DQLA 3BT7A 5SY9A 2GPYA 2YH2A 2YBDA 5ITWA 3B1ZA 2AHYA 4WBXC 2P5YA 5AT1A 4BLWA 3M84A 1BU5A 1EJ0A 5BR8O 1UDRA 3CF4A 2XCSB 4PA6A 2ONCA 1DOZA 3K09A 5C5IA 4JAVC 2WZBA 1GGMA 2X8WA 3SPCA 3NB0A 1VL2A 3Q9UA 4LECA 3OECA 4HY3A 5ALRA 4F3NA 4YRNA 5JTTA 1ZAYA 2PWBA 3OTQA 4ZKDA 2QN2A 3A9RA 2JLYA 1EHIA 1JG7A 2E3JA 4OMFG 1H9AA 2O2JA 4BL5A 3ZJTA 2X9QA 1CUVA 2RH8A 3KBBA 2W8BC 2ZE6A 1FPQA 1VE5A 1GPYA 1U6JA 2YS7A 3PRKE 4R3WA 4QU5A 1BYIA 1BJRE 3D6JA 2CT8A 3PC4A 1AN0A 5A0FA 1PJCA 2KTUA 3FPHA 4B2YA 1KQPA 1V9SA 3JVUA 2GZSA 4E03A 1G5IA 1NLMA 2ZXFA 1R2QA 1V5FA 4DLLA 4DZRA 1ULZA 2GK6A 4RD6A 2ANCA 4EYQA 1ZM9A 1RLOA 3I58A 4MARA 5I7AA 3ZN0A 1QVGF 3OGIB 3KOWA 2Q45A 1N7HA 2A9OA 1F1BA 4Q4JA 2WYHA 4MLZA 5KHHA 5FBRB 4GP9A 2IV7A 3WBBA 1NXWA 1SXJD 1F4VA 1IHUA 5DB4A 2VK1A 4LSMA 4MYUA 1MO6A 1BC5A 4DR1B 1T2DA 2I71A 2VTDA 3Q9NA 3C7AA 3ROPA 2XPCA 2G9QA 3QEOA 1EJ6A 2CSLA 1I0LA 3KLPX 4KWEA 4PPFA 5FRDA 1EFUA 4YUWA 4I81A 1JT2A 3FMFA 1XL4A 2C5BA 1CJCA 2OAGA 4OHZA 2HREA 1YFKA 3B8NA 4CQLA 1J2RA 2GAIA 2IEGA 4RY9A 2ODEA 2X77A 4D42A 4GX5A 4DWWA 1HORA 4D8VA 3WJPA 2VHJA 4Z3DA 3WK5A 1DU4A 2YN2A 3AL3A 4A6PA 3NXKA 4MR8A 1YQXA 3EGOA 3KE9A 4UV9A 1W55A 1NBEA 2QT1A 3RTDA 1AUVA 2EZ8A 2DG2A 2QQ0A 1DV1A 3ICPA 3FVWA 4V3CA 2BEUA 4HX5A 2ZIXB 3QMPA 2VWPA 1SQBH 2VYND 4R51A 4R5MA 4BJHB 3EIOA 4OG2A 1SQPH 2G9VA 3FZGA 4W8OA 2O50A 4O1IA 2EWVA 3D4OA 4EK9A 1K7CA 3L7KA 2JIMA 3CCEF 2IIBA 3WGHA 3C16C 2ZFUA 4LV6A 4MB2A 3TSAA 3ZXXA 3F9IA 2CXPA 1FQJA 2YCBA 3BEOA 3DDWA 4CF6A 3VQWA 5H4GA 5JSFA 2C9ZA 4X71A 4B3SO 5J4YA 3IC7A 5KAFZ 4LOJA 4QU9A 1RP3B 4P22A 1W34A 5EP1A 4MZXA 1BROA 5REQB 2MK3A 1DFHA 1TVEA 2CNWD 3M6MD 4ZV4A 1YULA 1C14A 3GARA 3N2GB 1W4BA 1VJCA 4LRTB 1G38A 2PMBA 2FN4A 4L9AA 3DW1X 4OLAA 4ZRNA 1ZN9A 4Q16A 4CIYA 3KLNA 2WA2A 2IY9A 2P4VA 4OXSA 3CNOA 5K8LA 2QJFA 1C30A 2AC2A 4F5EA 3OJEA 3HADA 1KOGA 1YRLA 2XQIA 2OHVA 3KKNA 4P30A 1Y3BE 3L05A 1IN5A 4ZAVA 2QI2A 4AJKA 2FN3A 4Q7EA 4IQFA 5TE9A 3ZE2B 4BPRA 4BVQA 1F14A 2HY7A 1ZWIC 3LA8A 1Q0LA 5CMUA 1MC5A 3CS3A 2AFRA 3DE4X 5EMJA 4KREA 3LAWA 2RMKB 4GFDA 1RXSA 1MEEA 1YIDA 3FOBA 2X3YA 3L8CA 1H2XA 4NATA 4UVIA 4WASA 4LRQA 2ZTMA 1Z6ZA 2PF4E 1LU9A 1GUZA 2UZIR 3A1WA 5IWCA 1KAGA 1PT8A 3VSBA 3H2GA 4JYAO 1ZCAA 3VHQA 3S81A 4JB0A 4ZVNA 2VNKA 4MI9A 2FMLA 1M76A 3NKLA 1WB7A 4DV7O 3LXXA 3JQBA 5DYYA 1N9ZA 3AHGA 3EIXA 4FIDA 4PI2A 4GUDA 4EPYA 5AI9A 5DNDA 1IVNA 3MJDA 1VQ6V 4LXTA 1DNPA 3PDCA 4JGIA 4TQ9A 4FB5A 5JDIC 1GRNA 3M3PA 2ZF8A 1TFRA 3I76A 3QV2A 5CNKA 2FNAA 3W3AA 1R73A 1FAFA 4L0QA 5KYVA 3OQIB 5ALFA 2EFEB 1WCV1 3V8NA 2W6ZA 3RB8A 1H2GA 2XOKG 3RVSA 3W7AA 4EMUA 5C8DA 3HH8A 4RULA 3WNCA 2CDBA 4EM6A 2UXBB 1U3WA 2JFNA 4OMUA 3QXSA 3VH4A 4X5OA 1SXQA 5EKTA 1ZJYA 1PR6A 1YVPA 1B6QA 1T0AA 1XRJA 1ZU5A 1A9XB 2Z5VA 1VQNV 1PD0A 5DE3A 4DG5A 5EI5A 5A4MS 4XUCA 2G0TA 4U7JA 4OEHA 1U2DC 1W40A 1FL9A 4FDVA 4RD2A 4J6EA 4YDRA 3CXCF 3PRJA 5A1TA 2XCLA 4KPUA 1UBNA 4NIMA 2ZQZA 1Q3KA 2FSVA 3PZBA 5E9WA 3VZRA 1TMOA 5AKLA 5CD9A 5ADHA 3WYFA 3CX8A 2ORVA 3ZHZA 1PE0A 4YRSA 4QOGA 2DU8A 3BMCB 4I7EA 2IXEA 4E6PA 5K4HA 2F9MA 3SIWA 2UAGA 5IY5B 2P6YA 1W5TA 4H3HB 4FDAA 4IRMA 1UUFA 2RGNC 4NARA 4FGSA 5CFPA 4Q3BA 4J8PA 1EIWA 1LDGA 1NX9A 5EEHA 4DHEA 2GUGA 1D09A 2XB9A 1L9KA 1XZDA 2KLBA 3DAFA 3K35A 2X15A 4A8JB 5J4KA 2EBFX 1GPDG 3O8LA 1XU4A 1QYDA 4MQFB 1N2SA 1N7GA 1WXEA 3E82A 3ASNB 1EXNA 2FW0A 1GTMA 2R86A 1CIPA 5KNBH 1OWOA 2FQWA 2EL9A 4M88A 3VR5H 1F9EA 1D6MA 1TKBA 1RNLA 5AUPB 2IQ5A 3F98A 1XT6A 2GPAA 4B84A 4ER7A 4YPVA 3TK1A 4U7NA 2RARA 3OIGA 2C9MA 1US8A 2QV7A 3OFND 4P3XA 1SA0B 5AKXA 3F9RA 4LZNA 4ALJA 4DAEA 4JTAB 4QG7A 3OQNA 1YTLA 3KKEA 4D4IA 3JVHA 5CA1F 2QTZA 2DF8A 4PW0A 3W5JA 2I2FA 3L8HA 3WY9A 1G6OA 2HA7A 4O2BF 2R2GA 1FP7A 3VU1A 4FX2A 3MS4A 1P4RA 1Q16A 1Z5PA 4MICA 5DMHA 4O2BA 3RVJA 2CLLB 1SURA 3SR0A 3BD6A 2PTGA 3NX4A 1OI3A 3QFCA 1N78A 3FLBA 2NO6A 3O03A 2VUIB 2YWFA 4P1ZA 2GFQA 4X6LA 1J8VA 1Z3CA 3IAXA 2QTVB 3OLQA 1KETA 1D0VA 1RQNA 1GEGA 3B8HA 1LGYA 3SZUA 2ZRFA 5A5DA 4IYIA 3HEMA 4OHXA 4DF3A 2EIKC 1JDTA 4UB6Z 2MYTA 2P1ZA 1XTKA 4G8JA 4EA7A 5AD1A 3O4VA 1SVMA 1YDEA 3K7EA 3R0QA 3M34A 3EXEB 1DZIA 2YV4A 4R9RA 4R1QA 5ALLA 5EQTA 1MC8A 4LSGA 3LUTB 1DRVA 4EG7A 1R4MB 5SYNA 1NOKA 4H0NA 1WAMA 1ILEA 4UMEA 3I6QA 3G80A 3WB9A 1E5VA 3RBAA 2CLDX 2YJ6A 3D59A 1T9GR 4HGQA 2B8JA 1KMNA 2AF4C 5JD6A 1TJPB 5L7WA 4U2KA 4Z1MA 3ZQJA 4BC0A 1IV2A 5K8CA 3PWKA 1JKJA 2I4IA 2ZB3A 1OGJA 3JQ7A 4LF5B 4JHLA 2ADOA 4DEVA 4BHTA 3KPJA 4KNWA 4E0BA 1XMVA 3P0JA 1N0JA 4EHFA 1T8YA 3CJQA 1JR3A 1UC8A 2VTBA 3LYLA 4HDNA 2YIDA 4WI1A 2C4TA 1N1EA 3CZ4A 3N87A 3N2IA 2A88A 2CWJA 1U8EA 1M7HA 1G21E 2QSAA 2UVQA 3NEYA 1CUGA 2ILMA 1OXXK 2P9EA 3CKKA 3EYAA 4H18A 4LHEA 3REFA 5DX1A 2J5KA 3AGQA 1ZJWA 4FT4A 2O2CA 2P6NA 1UIRA 3PA8A 4IY1A 4ZI2A 5JMOA 1A9RA 2CE2X 2DH5A 3EZFA 4D9MA 5I7OA 2AFHB 4XRGA 2IP2A 5DGXA 3G2PA 1VBFA 2L19A 1T2EA 4DXDA 1VKZA 5FBQB 2WDZA 4MIKA 1G7SA 2RHJA 1H2YA 4Q05A 4DR3O 1OBOA 2QNIA 2P9YA 4XW2A 4HFNA 1NZDA 1UL1X 3IL2A 2WNHA 3D7LA 1N75A 1SXHA 4L50A 5FAXA 3C1UA 4PSCA 4QSMA 1IFXA 2HF9A 4ECAA 2QHXA 1ID1A 2X8JA 2W9XA 4JT8A 5JJCA 2TYSB 2R7MA 2V4MA 4J0CA 2PUEA 3UAZA 4A16A 3EH1A 4IHJA 3UCEA 1BDIA 3M3HA 2JS3A 5E1AC 1NL3A 2PXCA 3OF5A 3UEOA 5DHRA 4JX8A 5L3RA 621PA 3F0FA 2Q41A 4KSBA 4OCZA 4B47A 3RBZA 5KYKA 1T1IA 1XJWA 4TSRA 5KTKA 2WZQA 3F6EX 3ZCVA 4FGJA 4ZU3A 5B1AB 2M6YA 1ZGHA 3C97A 3F8SA 1H2EA 2IYVA 3HBMA 3LRTA 5ALIA 5K2MA 5TMBA 3ZCPA 4LYAA 2E5FA 2J09A 4N5DA 5TPWB 1VRWA 1FPOA 1YBFA 4PCVA 4UEKA 1NBHA 3IBFA 1M1KH 5KCMA 3CNLA 5A4KA 2AFHE 1J7JA 4YV0A 3RN4A 4LE2A 2JLRA 3CCLV 3VHRA 4B5LA 1UJ2A 2FDXA 2IEDA 1RRKA 1Z3IX 3JZIA 4V03A 2HBZA 1G59A 3JPWA 1DI0A 3MGKA 4DLPA 4ZODA 1AHNA 4N47A 1Q0SA 2GN4A 4MW1A 1JLHA 2SBTA 4IYJA 4C76A 4F92B 3MGCA 5FUQA 3I4LA 5J5AA 3ZD7A 3CQ9A 4G9GA 3O4JA 2Q9BA 4F56A 1H05A 1RXIA 1JEEA 2PX6A 1DJNA 2R5NA 3ASYA 4RCZA 3ROTA 4DIKA 3LD9A 3ZV7A 4G8DA 2OCYC 3CXUA 1U1IA 1WHTA 4KRFA 2FSUA 3HGQA 1PTJC 1DRWA 3HY3A 2ZKIA 2BELA 2QZ4A 4TXLA 1B8NA 3HUTA 4QTYA 3WIEA 3TVDA 2X2FA 1YJBA 2AG8A 3R6GA 4X62O 1ZJ6A 4YQEA 1IBRA 5I01A 1ST3A 4A8JC 1HFWA 1R10A 5J5VA 1NJIW 1ADGA 3E84A 2HQSC 4PRLA 2ZSEA 4NMMA 2PKQO 1BG6A 3UAOA 3ZZUA 4EX7A 3CO0S 2PRYA 1DKNA 1E18A 1OWPA 2DPMA 1K6EA 4YO7A 1KPGA 3G5MA 4CL0A 3UMMA 2BCCH 1VYUA 2ZT8A 3JYHA 3SE0A 4YMHA 4JI1B 3DZJA 4ZV9A 4RDXA 5DGHA 4QUDA 2JBHA 4J75A 1VLVA 1L5KA 2CLFB 2X1HA 3SK0A 3PNSA 2FZGA 5EMHA 5BRNA 3THWB 3E05A 2Y4TA 2RGAA 2ZI6A 3PK0A 4LBVA 4WFIA 4OA8A 1F20A 4BTVA 1EJBA 1FB5A 3L02A 2HT1A 1TTQB 3EJ6A 3IULA 1BE0A 1M73E 4J0HA 1WTCA 2X7RB 1YXBA 4ZZ0A 2AR0A 3L0CA 4LY6A 5B3JC 1K63A 2O1SA 2WINI 3Q11A 2G5CA 3BVPA 2HWXA 2OO7A 3G82C 1YS2X 4M6WA 5BQFA 5EZ6B 1WXFA 4CM4A 5P21A 3D5TA 4IJKA 1GFWA 3DCNA 5K2OA 1ESEA 2BI4A 5ALOA 3CEPB 1QIIA 1SC5B 1YUMA 4JB2A 2YY5A 3ZWMA 1QGED 1NTZH 4JI0B 3ET4A 1FFXA 4NMHA 3VC3A 4ZZ3A 5KUMA 3SQDA 2ETXA 3I23A 1DT3A 4MGEA 5DN9A 3CLSC 1IBLB 5HXUA 3GZJA 4XYLA 1YITV 2H4WA 3L46A 5KUKA 3LU1A 4A0FA 4Q9LA 1IOWA 4XJSA 3TFWA 5B7QA 4IDBA 3FVTA 3KOUA 4MHTA 3W8EA 4XGQA 1CZRA 1JDZA 5EKSA 1M2FA 1XNHA 2DUWA 2P78A 4AW9A 5HVNA 4DKJA 5A6VA 1U3VA 1EK0A 2VF4X 3CX7A 1VFNA 2RI0A 5J58A 1WCYA 3HCCA 3HUUA 2Z6QA 3U40A 1ISIA 2Y0DA 4JGGA 1B06A 1SQ6A 2F4VO 4YCAA 4XDLA 1E1KA 3JQ6A 1JEOA 2R7LA 2VTEA 3WR5A 1SKAA 3N2KB 3VZQA 2O8CA 1ATZA 1D2EA 2K7ZA 4PZZA 5IAAA 1Z88A 5E0KB 2FPXA 4I50F 1OLXB 2O05A 3DDZX 4QRDA 3WGQA 2YNMC 2HGZA 3U7HB 3R8FA 2IDZA 5LLTA 1KKLA 4EL0A 4UBMA 1YH3A 1J9ZA 1XMOB 1G7TA 2W22A 2WYIA 2PS0A 2XXAA 3FYIB 3EXHA 3CTMA 4C8GA 1KH3A 1WM1A 3LUFA 4FGWA 4OQEA 3UM9A 1M10A 5JC1A 4DCGA 1KMIZ 4YVFA 2QVGA 4N48A 3GRUA 4IKPA 1BTOA 4E88A 1ZL0A 3P9QA 4II2A 3EA0A 2ATIA 2YJ3A 5DRTA 1GTOA 2ZIOA 1EM8A 4GR4A 1JIJA 1T10A 1Y1QA 4R2WA 2DKNA 2H2WA 4D8YA 1PLKA 1NH2D 4I5EA 2PT7A 5KTPA 4G09A 4O59O 3E23A 5DBHX 3OIDA 3MK31 1TJ4A 4RPLA 3MA0A 4GLXA 1O8CA 1T9ZA 1QD9A 2UUPA 3NOXA 4GOKA 5JNVA 2GPWA 1E20A 1KY2A 1VYVA 4C4AA 4NHOA 4PN7A 3TJTA 3R5FA 2QRHA 3HCRA 4P32A 3FBTA 4G5RA 4C2TA 4H27A 3AFIA 3D43A 1U9YA 3RTAA 3EPHA 2PZAA 1P0MA 1QR9A 1GFZA 1VM6A 3AB3A 5B2ZA 2GD2A 3OD4A 4YUVA 5JASA 3HFSA 3PR2B 1Z13A 4JU9A 2DQSA 4Y6SA 3C8LA 2PL9A 3P30A 1BMQA 1FZQA 2FWMX 3AVQA 2BTQA 1YRAA 1VQ8F 3COVA 3KUKA 4UAUA 5HIMA 1WDKA 3RS7A 2BFPA 1QGOA 4A7PA 2A94A 3S1AA 4WEOA 1DWQA 4B4UA 4WFFA 1NUPA 4FLYA 3CMEV 1CJSA 1GEEA 4E4RA 2HU2A 2FPPA 5E6SA 4DBLC 3RFTA 2Q9CA 3GHZA 3IKLA 3N2YA 5K1ZA 3UYLA 2Z98A 1LBSA 2VYVA 4NCHA 3LPLA 5THXA 1YZGA 5CA1B 3FTNA 4YAOA 4MW5A 3SZ3A 2PRZA 2R60A 1D07A 2EULA 3RFXA 2VJOA 3NU1A 3T12A 1J09A 4D4MA 4EA6A 2EINB 2NUTB 2GJ8A 2V5VA 4KZPA 2WMYA 4M0CA 3GUCA 3GO4A 4DCNA 2Y9MB 4CG3A 3SFVA 3OMNB 3EULA 1X77A 2UYCA 5BMOA 2XAJA 1XOIA 1TU4A 3FDJA 3QKTA 4HWRA 4P35A 4YJDA 2BPOA 3WLKX 4DABA 2QTCA 3TB4A 3U39A 4ETNA 3A04A 4ZEWA 2WD8A 1IB6A 1L6RA 2JGJA 1VQOF 2NTYC 2PKXA 2ZPUA 4RWZA 4Z99A 4EPWA 3R5JA 2P9QA 2I80A 1J6UA 3EK2A 4RKYA 5JJEB 1MABB 3BSSA 4ND4A 4TTTS 3HA2A 5EGNA 5SYAA 4D0GA 4RV4A 1GAJA 1M74A 1AZTA 3KQYA 3JRXA 3R3XA 4NEQA 4XEUA 4FCVA 2ZXUA 1Q7EA 4L7QA 4M8NE 1HXHA 1CY7A 2HPHA 1B4DA 3ZV3A 3WL7A 5C46F 2ZM6O 3K14A 1NUHA 1UOQA 3WOVA 1ZCZA 5EPEA 5F7JA 4WCEV 4UV8A 4DDMA 4BO0A 1QO7A 2QIOA 3ILYA 2YIBA 1KY4A 1HRKA 4X45A 1NW8A 1JXAA 3F0GA 3OBWA 2IYUA 1QVGU 2GXSA 5FFFA 1JFLA 4KRGA 4HOYA 2RGRA 1TMGE 1ZEJA 4QECA 2IUSA 5T3UA 1AQNA 1PQUA 5G02A 1VG1A 3Q6IA