5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
1RQ7A 5J2TA 3VPAA 3M89A 5J2UB 4I50A 5EIBD 5MN5A 1RQ2A 4WBNA 4TV8A 3WGNA 4HNAA 1TVKA 4IHJB 2VAPA 3JARB 4DXDA 3VO9A 5KX5A 5LOVA 5FNVB 4WBNB 3RYCB 4ZHQB 2VXYA 5KMGA 2RHLA 4F6RB 5JVDA 3HKBB 3JAKB 4O4JB 4XCQA 5JH7A 4I50B 4O2BA 4YJ3B 5C8YB 5CB4B 4LNUB 1Z5WA 4HNAB 4TUYB 4EB6A 3VO8A 2XKAA 4DRXA 3HKBA 5LYJA 4O4LA 3JAWA 3E22B 2VAMA 5ITZA 1JFFB 2BTQB 5FNVA 2R6R1 2VAWA 3WGJA 4YJ3A 5M7EA 5GONA 4LNUA 5LP6A 4B46A 3N2GA 5EZYA 4X1IA 5MN4A 4O2AB 2R751 1TVKB 5CA0A 3RYIA 1OFUA 2RHHA 2Q1YA 3JATA 4TUYA 5KX5B 5LOVB 4X1IB 1Z5VA 4X1YA 5IJ9B 3E22A 5J2TB 3RYCA 5ITZB 1TUBA 3VOAA 3HKEA 5KMGB 3WGKA 3ZIDA 4I4TB 1W5EA 3WGMA 3ZBPA 5IJ0A 3CB2A 5EZYB 3JAKA 4O4JA 5BMVB 3RB8A 5LA6B 3JASB 1FSZA 3N2KB 2BTOA 4ZOLA 4YJ2A 5LYJB 3JATB 3VOBA 4M8IA 3HKDB 3RYHB 5JQGB 4E6EA 4ZI7B 4X1YB 2GVIA 4IIJA 5C8YA 5CB4A 3R4VA 3HKEB 2Q1XA 1SA0A 3HKCA 5CA1A 3HKDA 3RYHA 5JQGA 1W581 4B45A 5IJ0B 4U39A 4O2AA 5EYPA 4IIJB 4X20A 4FFBA 3N2KA 4TV8B 1SA0B 3HKCB 4O4IB 5EIBC 5CA1B 4ZOLB 1FFXA 3UT5B 2RHJA 5IJ9A 4KWEA 5EYPB 3JALA 4I55B 4X1KB 5IYZA 4O4IA 1W5FA 5CA0B 4EI9A 3RYFA 3JALB 4I55A 3JARA 5LA6A 3JASA 3C8LA 4O4HA 1TUBB 4FFBB 1RLUA 4YJ2B 1W59A 4I4TA 5JCOC 4EI7A 1FFXB 3UT5A 4DRXB 4ZI7A 3JAWB 4O4LB 4U3JB 4O4HB 5JVDB 4F6RA 5BMVA 5J2UA 4X1KA 3WGLA 5IYZB 5GONB 5LP6B 3V3TA 4TV9B 5LXTA 1W5AA 5JH7B 4IHJA 4O2BB 2RHOA 3M8KA 3RYFB 3N2GB 4U3JA 5LP6C 4EB6B 4X20B 4EI8A 2XKBA 4TV9A 1JFFA 2BTQA 4ZHQA 5LXTB 5MN6A 3ZBQA 1W5BA 5JCOA 3RYIB
chains in the Genus database with same CATH superfamily
4Z2AA 2CZQA 4F4IA 2WWXA 3G7NA 1RJ9A 1JQLB 1YZHA 4NAVA 4XDGA 4BCDA 2RGWA 2X76A 3K79A 3TXSA 1JE1A 2JLRA 2WZCA 1LI4A 3M6XA 2HMWA 3S27A 2JFZA 3JWHA 1NNSA 2WA2A 2EZ9A 1R6DA 5EJ7A 2HR3A 4HJXA 1BEZA 4ZOAA 2WNSA 4K9LA 2IH1C 2VWHA 3AIKA 3IUSA 3ZDZB 2WNIA 1RYZA 4G0MA 2AQ8A 2RHLA 1WCXA 2C2ZA 2CLDX 1OV6A 2YC2C 2W0FC 3TKYA 3DW3X 2BKXA 1WB7A 3NJ8A 4I55F 5CNMA 4U8GA 5K51A 2JDID 4H44B 1R4AA 3WGOA 1XQ9A 4OI0A 2B5VA 1A7KA 2G6BA 1A27A 1Y6QA 2XKAA 4FYHA 2CYAA 1W75A 4JASB 4OHFA 2BN4A 3G0CA 1AO0A 1J42A 3I55V 3LIIA 5LLSA 3VYSC 1T2CA 4RIHA 4Y98A 1E3DA 1F2DA 2C8VA 5KHIA 1RZUA 1S5PA 3NKLA 1Q8RA 4IH9A 4YAKA 2I4RA 3ZZTA 5B66Z 1GAEO 2Z98A 1EXNA 2VAVA 4KLNA 1Z6ZA 4UDOA 1H4VB 2FWNA 2B9ZA 1GNPA 1OV4A 3KHNA 1JH8A 1QFSA 2IP4A 4FS8A 4GZMA 4YTEA 1KDVA 1N1GA 1ZIDA 4G0UA 2GN8A 2X0DA 2MMCA 4RJLA 3DMNA 3AUSA 3JCMM 5GV7A 4GX2A 2PMEA 4EJMA 1HEIA 6PFKA 4ER3A 4BY9E 3CSUA 1PEKE 3BHPA 1G5RA 3DLPX 1L4NA 4I4TB 1E4EA 4WFEA 2QN6A 4IVPA 4Y2VA 3PRJA 3DEYX 3KKQA 1PGJA 2PGXA 4JVOA 3SS8A 2WFMA 4CMIB 4WFFA 1CNFA 1RRPA 3M70A 4QGPA 4ERNA 4MUIA 3CCMV 4RFLA 5J58A 4ZVLA 3E05A 4L6AA 5K1ZA 3ZH9B 2G04A 5LFAA 2PZAA 4F9EA 2UVPB 1U7XA 3P3NA 1UP7A 3EIEA 4S2UA 3UK1A 4EPVA 1A4XA 5CB4A 5CXSA 1KMCA 2MWMA 3QA3E 3X3HA 2QRJA 5EY5B 3H4VA 2V74B 1E9SA 4LFAO 1EDOA 2OKCA 2PT9A 3BJZA 4GBGA 4ND5A 2NM0A 1K7SN 1QG0A 3L4BC 1KYWA 3K03A 4HO1X 4OQDA 1KJIA 3I83A 4OD0A 2M6KA 3UCEA 4OQFA 4F1KA 4O4IB 4ESHA 3ER8A 5AVYA 2CVHA 1YRBA 4BOYA 4D8YA 2ZI9A 4YJHA 1CUEA 2OSBA 3CMMA 3SOPA 2P1DA 4G25A 2GLTA 4MA0A 1W2WB 5I3ZA 3VMFB 3LVRE 4E03A 3TB6A 1VG0B 3KDPA 4QAQA 1ISRA 3DBVO 5ARDA 2UYOA 4E7OA 1Z0FA 3IMPA 4RADA 1X1TA 5JXWA 1EM1A 5AKYA 1KZ9A 1IAVA 5LBQA 2FEAA 1Q8IA 3WGGA 3EGXA 3FYEB 2CE7A 4QL3A 1HLGA 5BR8B 2EEPA 4R0VA 3R8XA 3GLGB 5DW3A 1GQOA 1CLEA 2PIAA 2C3PA 5KEIA 4XGQA 3P2YA 1YQDA 2Z57A 4CI9A 2Q3HA 1U7ZA 2XLBA 2OFWA 3DCYA 3A3KA 4WY5A 4A8JB 5JAUA 3PFHA 4PBTA 2JANA 4EGSA 4PVDA 2PX5A 1BEEA 4BMNA 3UNXA 4W5RA 4P4LA 4TZZA 2QJ1A 4B44A 5IBPA 5BORA 3TBKA 3S03A 1YK1A 4OFWA 1A97A 1Y42X 2N75A 3FIUA 4C0KA 2BJHA 1SCQA 3T9BA 1C7QA 2BOBC 3C7DB 2GX6A 2H52A 5G3ZA 3GPLA 1EXWA 1FE8A 4RO2A 2AJBA 3T3EA 1P2GA 4BYMA 4Q15A 3S55A 3KV3O 3FY4A 5EKTA 1BKSB 3J7AC 4EG1A 2VSXA 5EJ8A 2DG2A 3C6KA 4LZJA 4G0VA 1MZEA 2Q5FA 4PHTA 2VJMB 4ERXA 1MB4A 1GU7A 2A1UB 3G9ZA 5CW2A 4RIGA 1AHHA 1SBQA 2HHLA 4F3KA 1BCRB 4LPKA 3AJAA 1GWNA 2GCEA 4WUTA 1DAKA 3LDTA 3E3AA 1ECPA 3FF4A 1GY8A 2Z9DA 3WDLA 1GM5A 1NKDA 3ZMTA 2I67A 5DX8A 2D6FA 2J8ZA 2WF7A 3HP1A 3ZGVA 5JDIC 2WEKA 1OR8A 3BCUA 3VPDA 4S2EA 3QELB 5AUQA 3ZKWB 2PA3A 4Q9LA 3FRHA 4I8DA 1MO6A 1ZOSA 1C4KA 1FP7A 2JF0A 3JZIA 2QRMA 4R8RA 1YJNF 1IMOA 3AY7A 4ZHSA 4DW0A 3PNSA 2GVZC 4JNKA 5CBKA 1AMNA 4KPEC 2G83A 3UKJA 4YCNA 3GBVA 1M8GA 2FMTA 2XZTA 3ESBA 3FSGA 3ZJTA 4KQXA 3HMQA 3REGA 2HMYB 2ZIZA 1CRPA 1HTWA 3ICEA 1WXDA 3MDOA 3P9QA 1PV4A 1HDRA 3D4OA 1YZQA 2RGYA 4FBLA 4IIYA 3PNOA 4K5QA 7REQA 3O85A 4MQEB 5DLPA 1WCYA 1WAMA 4EWLA 4EPXA 1YHZA 4QPDA 1GRRA 2JFGA 3TRKA 4Y2SA 1MOQA 4NLLA 1MA0A 2HXSA 3ZHSA 4E6EA 1QHSA 3RN4A 2AR7A 2OAP1 3K09A 3OZ7A 4XWYA 1PK8A 3RBXA 4ITVA 4YDRA 3RUHA 1AA9A 3T7AA 2K7FA 1QYDA 3LUPA 1EVZA 1Z0SA 2GASA 2ZQYA 4MJXA 4WZAB 3K0AB 4Q6WA 4A03A 2QJTA 1EWQA 4FN5A 1EP3B 4EOGA 1FYFA 3INGA 4A8PA 2IT1A 1VECA 4CS3A 3MCZA 1I33A 4OU5A 2Q6KA 2ZRBA 3OOHA 3CC7V 5EIBC 3QWHA 2QD1A 4DK0A 2WLNA 2ZSKA 1EFTA 4MLZA 3WTBA 1NVBA 1E1LA 1Y98A 3DT6A 1MA3A 3KRTA 1BMQA 4MUHA 1B14A 5A04A 3JQ7B 3R6DA 3EGEA 3GFQA 3R6WA 3A2LA 3M6WA 3NI2A 2R00A 3GZNA 4G23A 3VC3A 2B34A 4IGAA 4RULA 4TMKA 5EE0A 5LQNA 1UBOS 2EW8A 2VXBA 3OQIA 3PUWA 4J75A 4UDNA 4E70A 5GZ1A 3CVXA 3OX2A 4YCAA 5K3FA 5JNLA 3Q98A 2II6A 5F52A 3U7QB 2Q73A 3CRAA 2CTWA 2YRWA 4L8WB 4D9NA 3GN2A 3ZU2A 2MMGA 5J4YA 4AJNA 1JWLA 5CG1A 4JBNA 3ASOC 2AC2A 3B53X 2A7WA 1L5OA 1IBCA 1JAZA 1ZMRA 1O96B 1ANKA 4WGGA 4UZSA 5FXMA 4NV1A 2HFEC 1FYEA 1N7JA 1NP6A 1V11B 3QVSA 3AY0A 1GT6A 4NBSA 3D8UA 1TO6A 2WKSA 2VS0A 3V4ZA 1GYPA 1UXOA 2VEDA 1ZUNA 4M0UA 2GDSA 2P2GA 4MVXA 5HK8A 2ESRA 2VIIA 4UDYX 4QXMA 2ZR2A 3GYGA 1NJ1A 3OT7A 4J2HA 2AJ8A 1HNXB 1OCRC 2DPHA 2NGRA 5D51S 3V34A 2XD4A 4WBNA 2HOQA 2NW6A 3BCSA 3F78A 3AYXB 4UPDA 4AY5A 2VHZA 3M4YA 4WT7A 1U8UA 3CPSA 1TCUA 2ZQ5A 1JR3E 1WV1A 3PKIA 2QTFA 4KN8A 3ENZA 1OAAA 1G21B 1PG2A 3KOMA 3N70A 3P9PA 4NYIR 4OXRA 3SZ3A 3WLSA 2C9YA 3T06B 1Z0AA 5JZSA 1K7YA 1J7HA 5C5EA 1DEXA 2AT1A 4O59O 5DLEA 5JJLA 1YB5A 2ZBPA 1B2RA 1QTNA 1PG5A 4KIGA 4ND7A 1NMXA 2VOJA 3WKEA 4C5CA 4H3VA 2FWPA 5K9ZA 3WLRA 4TYWA 3DVAB 6CHYA 3PSAA 3GLSA 1V5IA 1U2SA 3L7MA 3H6GA 1RR6A 2QTSA 4NOLA 4IIVA 3TOSA 5A2QM 5IW8A 2BF7A 5EXXA 2YI9A 2Z04A 1UEIA 1CZHA 4JYMA 1CWUA 2PRJA 1I4WA 2KI5A 2P5OA 4G9GA 3TTYA 2QRLA 3CXRA 4R51A 3FDJA 1Y89A 3K04A 3O31A 1S72V 4M7OA 3SLKA 3L07A 3IALA 3EQ9A 1GIAA 4I6JA 4V39A 3KJXA 2OYQA 4HYQA 4RHUA 4WK4B 3F7NA 2RFLA 3HBJA 4M98A 5C2JB 2P7HA 2GT1A 2ZSBA 2WB2A 4PYJA 4I2NA 3LECA 2R4TA 2VLBA 2XECA 4LWOA 4R5MA 4WDRA 3U19A 3VZCA 3V42A 2I66A 3PDWA 2WLKA 4YAUA 3K31A 4B31A 2I4MA 2UUOA 6REQB 3WLIA 4LEIA 1LD3A 2O0JA 1QGYA 1RIFA 1QLEC 1QG6A 3EZNA 4MMXB 4G65A 4WXRA 3GEDA 3IESA 2IP1A 3NRBA 4MJLA 5EXPA 1NQWA 3UK6A 1YTFB 1UKEA 2H59A 2BTOA 2C2MA 3EGIA 3IE2A 3R6TA 3RI3A 1QQ5A 4JLVA 4D99A 4C89A 2F23A 4ZI7B 1G42A 1DBWA 3WJQA 1J2TA 2H7XA 5EC2C 4EF5A 4HAUA 1F7UA 4UCFA 3TKLA 2P35A 4DQDA 3ZRSA 4DGQA 1P18A 3AIOA 1NTZH 1J0DA 3HXOA 4JQCA 2C2GA 4MRSA 4EO4A 3ZDBA 4NUTA 2WINI 4O2AA 3CT4A 1T8TA 3OM0A 2AF4C 2I7DA 3SE7A 4YRTA 4CXMA 1I2BA 1N2SA 3ZN1A 4YV2A 1K5HA 3UW3A 2VYND 4EHNA 1I3CA 4GI3A 4PCAA 5AHOA 2RHJA 2BL4A 3O2JA 5FA6A 4PWTA 4F5WA 1XLWA 5BXYA 3L6EA 5FHQA 1GPUA 3FPJA 4EKIA 3DMTA 3DOFA 2VK1A 3OTGA 4NBTA 5JASA 2O07A 1GRQA 4Q16A 4BYGA 4E5UA 2FLWA 1DHRA 1VIYA 3M3HA 1EFAA 5IULC 2LWIA 1W36C 1NC3A 1OFIA 3KC2A 1GZ4A 4YXWA 4IR7A 4KO1S 1T9KA 2BCJQ 3UMGA 4CLRB 5JD3A 5CBPB 2DBQA 2X7XA 1CJBA 4RPHA 2H65A 3NBYC 4RD1A 4JI8O 1YTLA 2QSJA 2XNJA 5BSWA 1IM5A 2P4EA 2YDEA 2C97A 3EPRA 4AP6A 3LO8A 2AZTA 2WKRA 5IARA 4LF4O 4YC7A 4YI3A 2XZLA 3QVTA 4YXWD 2G4CA 2HXGA 5AJXA 1DDGA 2CXPA 4ALNA 4BKQA 3BEDA 2PYDA 3JW8A 1SVMA 2GJ4A 3M0EA 2GWHA 3G17A 1LDBA 4OU4A 2NYRA 5LZ4A 4WZ6A 3EGVA 1SKMA 3T3PB 3H1KH 2NQTA 4G4ZA 2R8RA 2YZGA 1V3VA 2V7QD 3Q6MA 2ZJZA 4HXGA 5IJAA 1A8PA 1KEVA 2MSLA 1GXSB 3SFZA 3IAS1 2WYVA 1U7UA 2WKQA 3ZDDA 1F2TA 4RPKA 3NDBB 5BXZA 1PDOA 1QHXA 1NUTA 3O75A 3ZXUB 4QBFA 4PTLA 1YS9A 2WAOA 3HNPA 2VWGA 2OFPA 4JKIA 1QGOA 2QTWB 3CEJA 4WASA 1G1XB 3A2MA 1C81A 2PMBA 4EY4A 1B1CA 1RYNA 5AVOA 1JIIA 4YECA 4MCIA 2GBGA 5TVKA 3CD6V 3EMVA 5ESRA 3ZMZA 4PU0A 3K05A 4GNRA 2OENG 3BFJA 3D6VA 3OF3A 4O2RA 3VDXA 4B84A 5G2OA 1YR2A 4DRXA 2Z4RA 1KVQA 2LCIA 1PZMA 1O94C 2QVZX 3COPA 3GLHA 5KHOC 5LQAA 1CUHA 1NDHA 1K7EB 4B7CA 4A10A 2IXAA 2GZDA 5A3QA 1WN7A 2C5LA 4WOCA 1DHTA 1VQMV 3DOHA 2X58A 4OHUA 3H5NA 4EKDA 3ABLC 3UN1A 1BFUA 3GRFA 3KWLA 5CXQA 2YJZA 2ZAUA 4ZTBA 4AO7A 3ZUGA 4EY5A 1E2PA 4KGDA 1NBIA 2NSLA 4GVPA 3IT3A 1A98A 1G1AA 4DR4B 3SYAA 1KBHA 3B1WA 4X92A 1NTRA 5I47A 1LUWA 1CK2A 1T4CB 2CN1A 3HDTA 1PNQA 2HADA 2DJVA 5H4HA 1B76A 3USZA 4QHYA 3W1WA 3MIIA 4FDUA 4HEA6 1KO5A 4ALKA 4YCBA 4W5HA 4C4YA 2F62A 1KVSA 1SJ9A 2ZB8A 4MVJF 4PX9A 4CM6A 5EZYB 2YNMA 3CO5A 4P5EA 2Q4RA 3UGQA 2ZM6O 4EEXA 3THWB 5J23A 3G2HA 2DGDA 4BX2A 3ZD6A 2NMVA 3KCNA 2AK2A 3A0HZ 3NRJA 1C0IA 4I3GA 4QTZA 4WCVA 5EESA 3C3SA 5BNWA 2Z1FA 3GJ5A 5LMNB 4DV2B 1ZD4A 3D8BA 2W6MA 2GEBA 1CX9B 1XWFA 2GN1A 4BNTA 2W4MA 1FK8A 2NACA 3ZE2B 5CFQA 1HSZA 2UYCA 2PTHA 3RYHA 5JQGA 3A0RB 3HCDA 3K6JA 5DEOA 4CLOB 4OX9B 3C74A 4D3SA 4ODIA 3KD2A 2WIJA 1WAZA 2VT7A 2Y48A 3HB3B 5CT5A 2MINA 2AMYA 1KFEB 3VPHA 1ZVVA 2H7CA 3CLRD 2IGBA 2H3OA 4TTVA 5DULA 4F4FA 2TECE 4S05A 2XMGA 4B7EA 1DKLA 1MAVA 3AP2A 3QHQA 4M22A 4DA9A 4WGFA 4BMPB 1IHPA 2JIRA 4CCYB 2G9RA 4DLRA 4Z54A 3BHJA 4OSEA 2COKA 4MKIA 5AVSA 1AZLA 1LWOA 1G2OA 4MW2A 2O8DB 3W9BA 2A88A 1UMBA 5E7JA 1NTKH 3L7DA 1GOTA 2O57A 1YS2X 1VMGA 1BL8A 3CFYA 2K7ZA 1D2NA 1G20E 3PF8A 3VPBA 3WKAA 3WIBA 4HEHA 1WO8A 5HZHA 3U7HB 3O8RA 2DZDA 2AN3A 4OKNA 1C4OA 1WZNA 1RPRA 2Q5LA 1GPKA 1ZJYA 5EHQA 2P5UA 2QJOA 4D5GA 2VQ3A 2J5KA 5IVDA 5IDWA 4PEVA 1JG4A 3JQDA 3W8DA 4X1KA 1P1CA 5IBQA 1UJ5A 4YASA 3WK4A 2VWKA 1W5AA 1QHEA 1RLIA 1Z18A 2XQJA 4JU8A 2IXDA 2Q07A 4L28A 1UOEA 4MCAA 4QVKA 4TXLA 2WHRA 5FOTA 4AK9A 1N3LA 1D4AA 1E2EA 5C1OA 1WCIA 2IZ5A 1QFYA 1L7EA 1YOVB 4C7XA 4Y1FA 1CEZA 1NJIH 4R6XA 4WACA 5EA2A 1JEQB 3RTAA 1BHO1 1ZM2A 2NNWB 3RAEC 2A4KA 3K0AA 3IFSA 1KFKB 5DM0A 2NO9A 2Q7DA 1THMA 3MTDA 4RF4A 4UQOA 2VDLB 3RKRA 1E2IA 1E2JA 2WJZB 3X2FA 4ILEA 4JUBA 1Y6GA 3EPJA 3VU3A 1CUZA 3UUFA 2VAPA 1MVNA 5HHTA 1GN3A 3ZOZA 1XMOB 4N5NA 2QKAA 4KJZA 2JBWA 2XKJE 1FMLA 2R5WA 3BJRA 2YCBA 1YS4A 2VDVE 1NN1A 2Q2NA 5FTWA 1FDWA 1KB9F 3IAHA 4EPRA 3TCXB 3A10A 4YEDA 1NVXQ 2XRZA 3DQPA 2JGFA 9ATCA 2OD9A 3FKSA 4L1KA 1CQXA 3HUDA 2V1UA 3Q2KA 3L75H 2XIJA 3BD9A 3W2TA 3ZZ1A 2HJRA 3B48A 2GARA 1RWWA 1YQGA 3VX4A 2CHUA 3UHFA 3C85A 2A14A 2FPXA 2VA8A 3LZ6A 4K9PA 1KC8H 2GSWA 5H70A 2A6PA 4YRLA 4CI0B 3RFXA 2JAHA 3PEUA 2YC4C 3ZKAA 1APBA 3SYQA 2A94A 5LB2A 4TSFA 4DMCA 1AR5A 2GKGA 3TGUH 2B0JA 1TVEA 3ODPA 2RBKA 2ZJYA 3PEFA 2OO3A 3FFXA 1JPJA 2V5UA 2BMDA 3P9YA 1QYCA 1IE3A 1VLJA 2WM3A 1XHOA 3QO7A 3BH7A 3QBEA 1RAHA 2ZIGA 3FFAA 4GYCB 3ITDA 4P82A 4TV9F 5EFOA 4MV9A 3NDIA 3PQ5A 2DPLA 4DXWA 4DMUB 4B3BA 3E8HA 2YJ3A 3HCNA 5D7NA 4B3FX 4K46A 3GRKA 4AZVA 1K66A 3OHPA 1LZLA 2X9QA 3EHBB 5EPOA 3E2PA 3ZK9A 3KAJA 4H13B 4B09A 2HL6A 2H1OA 2WFLA 2AW3A 1PL0A 1UFOA 4FB5A 3JAMA 1XVLA 4IX1A 4M0EA 1L8OA 3KKKA 5FNZA 2UUPA 4R8SA 3PJRA 1TO1E 2OLJA 2WUFA 3BF7A 4OO3A 3ABUA 1JOYA 3LWRC 1IJEA 1ZD8A 3DE7X 3KYCA 1U0FA 3JZDA 1W52X 2GVIA 2JIMA 3NBXX 1ECFA 2DFLA 3FBAA 5DASA 1LLFA 2QJRA 2AG6A 2FX2A 3I09A 3ICCA 3JYLA 1LR1A 1NN5A 3FD9A 2WZQA 1CUIA 2JJQA 1O95A 1XK6A 2QGFA 3KETA 1JFTA 1ZCZA 2A3NA 1AS2A 1LLQA 1NT2A 1WW8A 1UPXA 1LWNA 2GPTA 2X5NA 5IDJA 3EA4A 3K0HA 4PQGA 3RBVA 3KB1A 1CUSA 4M1SA 3L7NA 2ZBQA 1ABEA 4TZTA 4UAUA 1JJFA 4IJ6A 3AJDA 1FFXA 2V1DA 1YITV 5IJZA 5EYPB 2H2AA 4GD3Q 4OHXA 1SKVA 1FDRA 1M1YB 1RBYA 2RJ3A 4TTAA 3EC2A 1QZ3A 3D7RA 1TIBA 3P9IA 3KUUA 2HC9A 3KOZA 4MPPA 1FX0B 3LL4A 1VBMA 2HRUA 1JR4A 1WUIS 4D0RA 4AD8A 3LRTA 4RVNA 1C9NA 2WJVA 3CF4A 3ZWAA 621PA 3L46A 3UMBA 2YWXA 1PKXA 4B6OA 5EIFA 4O8CA 1RU3A 4DCOA 1PG0A 3INYA 3HR4A 4Q1BA 2XUDA 1E1RG 2P9ZA 1UOQA 3KM0A 5A2QA 1SIOA 1LDYA 2P62A 2W6NA 3CNQS 4MWCA 4NBNA 1SUEA 5KYXB 5H9WA 3HLTA 3GVCA 4XQ0A 1EG2A 1RKBA 2YY7A 8AT1A 2ZI7A 4LG1A 2HU8A 4QBIA 2QUKA 3IV6A 2FYTA 2UXBO 3VHQA 4BX0A 3JVHA 1O4VA 4DHWA 2OR3A 1SH7A 1J9GA 1O0CA 1I0HA 4I9GA 4YRNA 5DGDA 3GO4A 3N87A 4IEIA 2O59A 2BFNA 2XD9A 4NYMQ 2WTUA 4DMKA 3MJHA 2IELA 5EWLB 3DOOA 2EKQA 4NZOA 3K94A 3PITA 3U3MA 3ZUPA 5MN5A 1QIDA 5JAZA 4AY6A 2Z6QA 2GCNA 2QTMA 4GPBA 4FIPC 2UYJA 1QK4A 3FWYA 3SU8A 1J7KA 3QKRB 3W8RA 1Z0JA 3GLIB 3T0FA 1ZGGA 5FOUA 2LZ0A 4EVQA 4AHCA 1RM3A 1KYQA 1XHZA 3QUAA 1N1MA 3STZC 1EP1B 2QGNA 3RIEA 1SC3A 2XNSA 4N7RA 4CKCB 5LQSA 3F7OA 4D97A 1E1NA 1CG6A 2EILC 1CZKA 1Q1BA 1U28C 3RR2A 4AXXA 1CE8B 1PNOA 1M6VB 1OKKD 3SQOA 3F0GA 3QO8A 3E03A 4J9VA 4J0JA 1BGWA 4ERHA 4IUDS 4XIJA 3D3WA 3FKJA 4UBKA 3GJQA 4WE3A 3TNYA 4B32A 1Q43A 3NHUA 5I9IA 1B6GA 3L8ZA 3EW7A 4DM3A 3PL5A 1EFPA 4MV8A 1AKQA 1ODJA 3D0OA 2PNJA 4BB5A 2XOXA 4JJAA 3VVMA 1O4WA 3WNZA 5A0VA 1XFAA 2QRVA 4TRNA 2I8AA 1R4ZA 3CX7A 3EVBA 3KYDA 3PNBA 4DC1A 2VSOA 2E48A 3R5JA 4BDSA 4DJEC 3CCQF 2PGNA 4HNTA 5JAPA 1TA8A 2YSUB 4ZXPA 1H4TA 1ZJZA 4MW3A 2AIFA 1RCTE 1XRJA 3JQ6A 4MINA 2C2OA 2Y0EA 5D1NA 5HQJA 2OCXA 1P8AA 4RY9A 4Q4AA 2W2VA 3I37X 1EDBA 5TJHA 3CRVA 4RH3A 4EEKA 2ATVA 1IUPA 3RFVA 4B3RO 5LA6B 3KSRA 1O94A 2R4UA 1MC4A 2GJ9A 1RWXA 3BTSA 1MT3A 3M8AA 1FMJA 3JTMA 5J3JA 3D8NA 4CG2A 5K6AA 1R0XA 1M1NA 2R6AA 3K0SA 3F3KA 3A8TA 2Q9UA 3GRCA 4EHHA 2BLLA 3TSAA 4BT3A 3JSLA 1I5EA 1IWOA 2XA1A 5A2QN 4BNWA 3WL8A 1AHIA 1JHZA 3F3SA 1JRLA 1ODCA 4P3NA 3HHPA 2W2PA 3W7TA 2H1HA 2WF6A 3J81M 3CW9A 3DO8A 2I87A 3FWHA 3R23A 4RCZA 2GLUA 1M72A 5GM1A 1Q1GA 2ZGVA 3PENA 4N03A 4PLGA 1ZMBA 4PSVA 3PQDA 4RGQA 1HR0B 3GA0A 3HDQA 1JV2B 5JWOA 4A1OA 1JILA 3PRYA 4BKRA 1P6QA 3ZI0A 2COUA 3QRWA 3R41A 1QFMA 2I4TA 2B37A 2W98A 2PX4A 1XD2B 4QYMA 2O7NA 1U8EA 3M6LA 2C2HA 2DAPA 1LB1B 3OTWA 1M6EX 3B2EA 1KXJA 1SKQA 2A4MA 5ADVA 1Z22A 4F7WA 5C8YF 1P81A 1GTRA 1AJEA 3RS2A 1OA0A 2QVBA 1BCSB 5GMOA 2R5FA 1A1SA 1DIGA 2R68A 4G5YA 2I9KA 3ECSA 4Z4EA 1RP7A 4JHLA 3UCSC 4H16A 1KI1A 2Q0AA 4Q1FA 4DBLC 9MHTA 4CBVA 5IYDO 2G25A 4V1CB 1R8YA 3B6MA 2D0PB 3S1LA 1US6A 3VYUC 3ZXYA 1A9SA 3HZZA 5KNCD 2WJPA 5KWJA 1R16A 4PDMA 1ISFA 5J40A 5EIHA 4EFDA 1VP9A 3ZHYA 1XHEA 2W2XA 2C03A 2X19A 3C8DA 3OT5A 3HAXD 3ZXSA 4NZZA 4KUHA 4L6CA 4MYTA 4M2LA 3O91A 5DWDA 4WN9A 3N0XA 4G5XA 1PD0A 2XT9A 1DVRA 1U99A 1TMKA 1T4DA 3MNFA 1Q1EA 5B37A 1Y7LA 1WE2A 1XUOA 1PWHA 3DDHA 2F3RA 1FDTA 4P80A 2O9JA 5HDBB 4HDQB 4L2IA 3NTXA 2ISCA 3GEIA 4BP8A 1J70A 4W4LA 3MINB 3FVVA 4D6TH 4EGCB 4RA6B 1XJ0A 1VIBA 3NVIB 3IT1A 4WK2B 2DY1A 2QTPA 5ESDA 4OH1A 3D36C 4FK5C 1VHJA 4RE5A 1DAHA 2VDRB 1VMEA 1ZVKA 1UKYA 1JECA 1PX0A 4IH1A 2Q68A 3F1KA 1DKQA 3SEFA 1CQPA 3ZIUA 1P3Y1 1EQUA 3N0VA 1VI6A 4BNVA 4FVTA 4WA8A 2O3SA 4DR3O 3EZGA 3RAFC 3WYFA 3TTWA 1ZK3A 1QVGF 1P7PA 2HK6A 2PGDA 2GXQA 3AUFA 4X45A 3UXMA 4WFHA 1Q82W 1XJQA 1J4AA 3ETCA 5IM4A 3SGLA 1CDZA 1CUYA 1J95A 1SERA 1RYEA 1PWEA 3OHSX 1C5KA 1H38A 5DBHX 3WK6A 2XCUA 4PNPA 1W25A 1FVOA 2JBHA 4P7BA 2BM8A 1OWNA 1DFGA 4I7EA 4Q7KA 4ZGBA 3P9SA 3UGJA 3ROMA 4R6ZA 4KO3S 5GP1A 2QWNB 2HO4A 3I9NA 3KU4A 4HDNB 4QULA 5GOTA 1NUQA 4RTLA 1ISGA 3IA2A 1KI6B 3ZWXA 4YV7A 1HX7A 4DPLA 2AJDA 3ZX5A 5JZOA 1JBKA 1TO2E 4LVCA 4X9QA 4NAHA 4NOJA 5EL0A 3DLIA 2UUCO 1U2QA 1LSSA 2B98A 1EJ6A 4YV1A 1AROP 1ZX1A 1E58A 1Y3BE 3VBBA 1H2ZA 4H1TA 3IDQA 3MUNA 3MCQA 4ES6A 2J9RA 5KLVH 5J59A 2O6LA 1V9PA 1NY5A 1ULUA 5AI8A 2DKOA 2DX7A 2EKLA 2QNRA 2QMUA 3E4DA 3E9YA 1NQUA 5H81A 3OIDA 1YR8A 3GLHE 1Z0ZA 3CZAA 4FE4A 4NEGA 3W2EA 2XQKA 5EK0A 3OCJA 3VA7A 2YUIA 4DY6A 3QVGB 4KVGA 2CJPA 5BUCA 5KTRA 1DQYA 1X25A 1ZIYA 1C29B 1DIRA 5CT4A 1XTQA 1SVOA 4D0LB 3DOEA 3HB5X 3GLGE 5K2OA 1C3OA 3T6KA 1T35A 2XT6A 1PU2A 2IHZA 5FNVF 5EJIA 2I2XB 3L7LA 4XTRA 1FBNA 3O03A 1NASA 1P2BA 3BGSA 2G3YA 1QG4A 2EAUA 2JIBA 2AMTA 2VDWB 2WJWA 2ZYTX 3E8MA 3KZOA 4K86A 4ZU3A 4KPFC 4DQUA 2BY4A 4ZK2A 3BRQA 4P4UA 3E7WA 5DVZA 4CM4B 4RS4A 3NWJA 1R6UA 1E32A 1WCIB 5H3LA 5B3JC 2F59A 3QKIA 1U2GA 1UOPA 4CV3A 2AI2A 1WB4A 1GGMA 1XFDA 2IOFA 4LQLA 4PQFA 3IEMA 2I91A 1C9DB 1MV5A 3IH5A 4Z9BA 5HIIA 2IJGX 3A9RA 4MWTA 3EEOA 1S5JA 1VPLA 3M99B 2VOEA 3GGOA 5F5LA 3TR6A 1DJNA 4LWZA 2O2SA 1KZ7B 1KVRA 1S96A 4R5HA 3MS2A 1TYBE 5HKLA 5TMDA 3OUZA 3Q88A 4D46A 1E8DA 2EWMA 4JEUA 3WK8A 3B1XA 3AEUA 4FCCA 4IQ0A 3IS3A 4AM8A 2WKPA 1ZD1A 1G4HA 3PGKA 3DFIA 2OTJV 3ABSB 4J0IA 3ZTWA 3INRA 3KKYA 2OMKA 2WIAA 2FUCA 4HNHA 4R84A 2HFKA 4R1TA 1UKCA 1OI2A 3EMDA 3Q7RA 3K59A 2R6HA 1QV6A 2RN9A 1XO1A 1ZEMA 3A11A 3Q3HA 1GYRA 4ZARA 5L3ZA 3CZ9A 3KCQA 1XJWA 3EEBA 2FSPA 1NV8A 1EK0A 3NIFB 4DR3B 4AAYA 5CM8B 3H1PA 3ELWA 3M1AA 4N6NA 3SIPA 1N75A 3WAGA 4FMTA 2FK7A 1F8XA 2J67A 5JMTA 2P3LA 3KZCA 1JA1A 2OD2A 4D9EA 3BWMA 1M1KW 1O54A 1KJ8A 2AZ2A 4YIPA 4QYXA 2X0FA 3SR0A 3TSZA 4HV4A 4U9HS 1K4MA 2B1QA 3HKBB 3A1FA 5C8DA 3ZWMA 2WBLC 4LXTA 2VJAA 1XTVA 1XQVA 4YJ3B 5I7WA 3CH5A 1X19A 3KQOA 3BD8A 4I5SA 3AVQA 5HP7A 2CNWD 3LY9A 4JAUA 1U0NA 5CVJA 4BQPA 1YR6A 3GPDG 2BT4A 5TQ0A 3FPSA 3F6BX 2Y8EA 4HVAA 1VQ4F 3COVA 1ZVMA 1KR2A 5COAA 4W9MC 1EZZA 1E96A 4JF3A 4L73A 2HJGA 3VR0A 3VNVA 2ZI4A 3PP8A 5JU6A 5REQA 4ABTA 3DB1A 2OT5A 1J5EB 4MUBA 5ALRA 1YZKA 2EERA 4GIBA 4LDNA 5DNAA 5IFLA 4J90A 4WKCA 3GJZA 1E2UA 4OGKA 1E79A 3GLUA 2XB6A 3VC2A 3RO7A 2FEPA 4DA8A 2GD2A 1R6TA 2WYOA 5TPZA 4ZZIA 1J24A 3ADDA 4E2WA 2ZI3A 5EC8A 4E31A 4PLWA 3NHSA 2B4KA 3PHJA 2EV9A 2FG6C 1KNKA 2FFHA 2PL3A 2PQ2A 3A1NA 3FWZA 3F4LA 3G2QA 2QX8A 3FMGA 5KWSA 4PO3X 1PX2A 4LXQA 1FUEA 4UUAA 4CIXA 1C3VA 4DSNA 1JT9A 3L6BA 3OH8A 5AK3A 5IKEA 4C0WA 1S9DA 4F11A 3ND9A 1QRTA 1T2EA 3S1SA 4DADA 3PN1A 4U6NA 2H31A 1U1EA 3VOBA 1NW7A 1Z6AA 3TMYA 1C8BA 4RSHA 1OTXA 1ADYA 1T2DA 4N9QA 1X9GA 1R6XA 3WYGA 1W47A 1E99A 4B7AA 3IXQA 5LN1A 3TW0A 2J07A 2PEZA 2AV6A 3OKPA 5E4JA 1BKYA 2EFCB 3LKVA 1CE8A 3ER9A 4CTOA 3RRYA 3AKYA 2AOUA 4KB5A 4PC2A 1FTWA 4JCCA 2AX3A 1KNJA 3FH0A 5LLTA 4HVLA 3T34A 1LRJA 2JAPA 3BXGA 3SXUB 4RENA 2CHFA 1ZLYA 4UNIA 3WTCA 1E7WA 2AQHA 5IC6A 3UMCA 3W5CA 4PPYA 2IZ0A 4BP3A 5ADHA 2WTNA 3DQQA 1YRAA 3W1VA 4ND8A 4MVOA 2O0KA 3RC2A 1U0OC 1BAPA 2DU8A 3R6LA 1PT5A 1W0KG 1Q82H 4RVUA 1GGFA 1KQSF 1K9VF 4GU5A 5EUMA 3RSFA 3U9SA 1SU6A 3ANMA 5BSUA 5JS8A 2AEEA 4DW1A 1FP2A 1GZ6A 4YGXB 5KNDA 2H08A 4P9OA 4KX5A 2N05A 2C98A 1OZAA 1LUAA 4ZEXA 2F93B 2NVUB 2QU8A 3PYLA 4E7PA 2BR4A 3SZOA 4LX0A 5KJ1A 3AUXA 1VC2A 1K3UB 1YC5A 3CC4F 2TMKA 4HUTA 4P3YA 1JPUA 3KR2A 4C4ZA 4ZOEA 2J3KA 1HNWB 3QVLA 3V1LA 1SKYE 1EB9A 4PFQA 5DK4A 1OZFA 3ED5A 3WICA 3X1JA 4BBAA 2OWEA 3V1KA 4G2NA 4DLNA 2YVUA 5JSKA 1S8NA 1YQXA 1Z7BA 4AJHA 1EK2A 1EK1A 2P9BA 3RG2A 4ZO7A 4DPKA 3K9HA 3E8XA 5ARCA 1J90A 1PL8A 2FEOA 1G20B 3BK7A 2FUG1 2BEJA 3QX8A 4LRXA 4J3NA 1WP9A 3RYCB 3FPIA 4G0OA 1JEOA 2QTNA 5U4QA 4N8SA 4WFIA 2NUTA 4DBVO 2FR8A 2NLJC 4AL4A 3D3EA 1A4UA 2EIMC 1G5TA 3DS8A 3ZX4A 2C2AA 3LF1A 1QBZA 4P4NA 1O8CA 4W8HA 5EWLA 4RCYA 5KAMA 4G8JA 3RF7A 3MYYA 3H1EA 2X3YA 4K28A 3D2AA 4BMDA 1F17A 3TRIA 5KNBH 1XZIA 3C8HA 4JJ6A 1ZK2A 4NU5A 4HGYA 4C6SA 4YDSA 5IMSA 4RWZA 3HWX1 1Q20A 1QH1B 2XUKA 3IP9A 4GDMA 2XBUA 5B2ZA 2G5CA 3AR8A 1I1OA 4LH6A 1RCUA 4C76A 2H2WA 2O1WA 1OHHD 3NVKI 1SXJB 3OKCA 1INLA 4LHXA 3BZUA 4IP0A 4U1RA 3IEVA 1LTKA 4BV3A 5KVAA 1UK7A 4E3ZA 4F5ZA 4MS4A 4N18A 1OIXA 1UZAA 2PWBA 4UVBA 4KMOA 1TYAE 2O3JA 1SXJE 1R5JA 3HFRA 2ZU0C 5BN4B 3V9AA 2R8OA 3PC8A 3B1JA 4P5DA 1OHHA 1XR3A 2P9TA 2AKYA 3SEZA 1U6IA 4XGNA 4CR6A 4D8VA 2OG2A 3HPRA 4XI9A 1A9PA 4WESA 3CB2A 2IU0A 3OE4A 1FVXA 1L5FA 3T9EA 3R65A 3GEMA 2X1MA 2B1GA 1VZ2A 2BEKA 4B3TO 4IMIB 4XX0A 4YFVA 3R74A 3V8EA 3ZRWA 3KJJA 2MTBA 2GEFA 2PMKA 2QPTA 2R4QA 4G5FA 4Z9FA 5A3SA 2R1TB 4LOAA 3N2EA 3L1HA 1HY3A 1SQ0A 4EMTA 2V4MA 2JNWA 4W5JA 2H4HA 5FH9A 2OOSA 3HJGA 1DOZA 1UOOA 2I2CA 4LXIA 3JD1A 3BGDA 5A3RA 2OB2A 3AL3A 3E2EA 3FPKA 1GUBA 1VL6A 3WDSA 2Z2YA 1RM4A 3IMKA 2VI5A 2EF0A 3L1IA 3S0YA 3ZW7A 1TF2A 4Q93A 1HT3A 5EMNA 2WU0A 3ZGZA 3V4OA 1KAEA 3PCXA 4RQOA 2IEZA 4JBHA 5GGXA 1XQYA 1I5RA 1VJ0A 3DTYA 4XD7A 3HCFA 2BFBB 2E82A 3O8NA 3PFCA 4HPXB 4UNNA 2NPFA 2VYNA 4P4SB 5GADl 2YWGA 1O6CA 2OT3B 3LPNA 4MRNA 3CLTC 3V1UA 4JI5B 3QX9A 3BORA 3PKZA 4JR1A 1A4RA 4BB0A 2C5SA 1GM7A 1NQTA 3G49A 4NJOA 3OE7A 3C6MA 4NZNA 1VQ8F 2WVJA 2IRWA 3T7KA 1GRCA 1GZUA 4X00A 5SZKB 2G80A 4CHGA 2OAGA 1SQPH 1U4NA 3L1VA 5SZIA 4UOQA 1NVTA 2I6RA 3GD7A 3KTDA 3KB8A 4HZIA 4CKZA 4IOLA 5BVHB 2PUWA 1H85A 3ISTA 1YV9A 1VQOV 2OZKA 1X1DA 4EAAA 3LL7A 3VOSA 1GQ2A 3QYJA 1H3NA 2XMQA 2CNDA 2O52A 1VGQA 3COWA 3X0DA 4MLDA 1V48A 5JDCC 1GHTA 2PUDA 4PXSA 5P8WA 1NNI1 4DSUA 5HTOA 4US2R 5I48A 1J97A 1DPGA 1DBVO 2QM7A 3Q3CA 5IAKA 2OC4A 1U80A 4FI3C 3JS5A 4EY6A 3DLHA 3SJBA 4DG5A 5H5NA 4UUMA 3ZE9A 3MWYW 3U4QB 1WPBA 3K1YA 5CH5A 1YZLA 2LE0A 1BS9A 4P08A 5DYTA 1L0BA 5EVCA 1V1RB 3JTEA 4FYIA 2OTLV 1LZKA 1UC8A 3NPMA 5KMGA 1GNRA 2B69A 2FRXA 2UZ3A 3COZA 3GNSA 2AF3C 5JSFA 2WHQA 5KREA 2J9FB 2BKLA 4HX2A 1N6LA 2GV9A 3ZE6A 4DB2A 3A37A 4AURA 3L41A 2QMQA 3BH0A 2YY5A 4NU0A 4QE7A 2J9FA 3LCUA 3E8SA 4W4TA 3R5SA 3RROA 2QLJA 5H59A 4ZMBA 1TQ8A 4N3AA 4QUGA 1TL7C 4LNUA 5FLYA 4ON9A 2DFKB 4BL5A 3LDAA 3MJSA 4B46A 1NLYA 5AKEA 1BJRE 1WABA 3F97A 7AT1A 3RC9A 2QVGA 4BLSA 2JGDB 5A4IS 4I1RA 3WIVA 4UHJA 2BGIA 2ZG6A 4EW1A 2BGGA 2XWQA 3ABOB 3P30A 4FU0A 5CCXA 3R5HA 4F2DA 5J63A 2AMFA 4C8GA 4FE3A 2EZTA 2IBSA 2J3IA 2QV0A 4LHEA 4NCBA 4OHKA 1X7YB 4K6HA 1R8XA 2E2WA 1UBMS 1AUXA 2D62A 4PPQA 1USVA 4I08A 4PYQA 1FFWA 5ERXA 5FTJA 4DV7O 1IFXA 3ETNA 3KR0A 5JZMA 3FIJA 2D3TA 3O21A 4MICA 2OXCA 5DIFA 3VZBA 3MJVA 4PN7A 4QARA 2HRBA 1AUVA 5EIXA 2M2IA 4JJ4A 2UZ1B 4M46A 4WN3A 4L4ZA 1XD8A 4ANFA 2Q9LA 4DLUA 4RWUA 3RVPA 1W94A 2G63A 3AGPA 3D3KA 3DTVD 3G3EA 4IHQA 5ENZA 5B1IA 3FOCA 4DLTA 1SETA 3O73A 4YCCA 4UUJC 2QRZA 1D5WA 3J7TA 2QTHA 2RKWA 4RPCA 3IJ5A 1WQ4A 3EG5A 3TLCA 5IJ0B 1FJGO 3BXZA 5LZ2A 3K12A 1W9HA 2B7BA 1ZI8A 2C7GA 5GJCA 3MHHC 4RS3A 3DXRA 2F1HA 3N7TA 1HP8A 3RNLA 1WRBA 2GZLA 4G0XA 3QBTA 1EK5A 1Y9AA 3QV2A 2ZLBA 2Q0QA 3R3SA 4U00A 3WMGA 5JFGA 4JJ7A 4PGFA 1R3KC 5DN6G 3RV4A 3ZWQA 3I5AA 2LGWA 3REFA 1AMUA 3AC0A 5KYVA 2IW1A 4O3FA 3TN7A 5DOZA 1ZNXA 2HREA 1BU8A 2PKRA 2JFFA 1JHQA 3ANYB 4YMIA 3AWIA 5BN5A 3QVNA 1HDJA 2XA2A 2FYUH 1OLXA 5KSWB 1QO9A 3T1CA 5EE9A 1E0JA 1SRYA 1E3LA 2VDKB 3I42A 5WRFA 4D3FA 2VN8A 3GH1A 3GOHA 4JENA 5CA1F 2GZRA 3EUWA 1WXXA 5HJ2A 5IUNC 4NDAA 3LY8A 4JLJA 2LDXA 1KERA 1ZN9A 2ZR0A 3GCZA 3TIIA 3P3PA 1JXOA 3DJYA 4GKAA 3I9JA 4UCWA 5ES4B 2H2FA 2OE2A 1Q7TA 3DEHA 3OQBA 3GLFE 4HNSA 3VMFA 3G0HA 4O25A 4W9NC 3D7NA 5JNRA 3AB3A 3IUNA 1XNRO 4OA8A 3PQFA 2W2LD 4PC1A 1DUSA 1U9ZA 1RIIA 3F7VC 4JJEA 4ZT2A 2FHSA 1MOSA 5BR1A 4JXXA 3U4MA 2JAWA 2XXAB 1A82A 1BNCA 1KI2A 5KOHB 4M1TA 3DC2A 4RFVA 5B1AB 1WEHA 1UFIA 2JK1A 3E53A 3NP7A 4GDFA 5J2UB 4UM8B 1U0EA 5EIBD 5HM8A 1OGYA 4M8NE 1K5QA 4EFEA 3ZCSA 1EBFA 2WP0A 1R18A 3AL2A 3MJCA 2IH3C 2UYNB 4LUCA 3SDLA 3ICOA 1VJGA 3WOVA 1UEJA 4BXOB 2FDCA 3WWPA 2FWIA 2I4NA 3C8ZA 4TKUB 4QUHA 3NVMB 4OKIA 5FI1B 4M76B 1NBWB 2HGZA 3P9XA 3QZUA 1UBKS 4YT5A 1YC2A 3IBCA 1CQIB 2E4AA 2I71A 2P4UA 1QS0B 5LUBA 5C9ZA 2DXIA 4A4DA 4KDEA 5LBIA 1GKUB 1FPMA 2Q6LA 2ILTA 3CC7F 1QTIA 1JXMA 2WLLB 1U6JA 2CDRA 2RAFA 4QM7A 2JGLA 3RVKA 2E4UA 2B9EA 2CF6A 3NONA 3RTGA 4D4KA 2Q3JA 3FYSA 3PQ7A 3U37A 2R6R1 4AI6A 1NT4A 1QTRA 5BQPA 1HM5A 5GJBA 2G76A 1ZH8A 1QRDA 3FETA 5DHQA 1VL0A 2IXFA 3ZWOA 1DLIA 1SZCA 2NQ8A 3C3JA 3PGJA 2C9CA 1IIBA 3N8IA 4J16C 4DYDA 5EHXA 2JASA 4HLCA 1UR5A 4JODA 1L5KA 2OQVA 4JA0A 1OI7A 4BHTA 4QXQA 4P3PA 4AMUA 1PFKA 2QY6A 3TVDA 1H2AS 3HE3A 1NW8A 3TZLA 3RYIA 1BS1A 2B2CA 2ZAMA 3CG6A 3R66A 4NG4A 2QXTA 3ROKA 1KYYA 5BQFA 2PFGA 2LFRA 3VR6A 3A6JA 1ZMTA 1Y0BA 4O4LF 5FHRA 4DWWA 1LW6E 2EDCA 2CLSA 3WGMA 5ICSA 1YZ3A 1ESNA 2ZXEA 1EA7A 5E0OA 4O4JA 1NW5A 3R5XA 1ZL2A 2ZU6A 3L70H 1U04A 2B99A 2O2GA 3G59A 3QKSA 4JP3A 1DKMA 1KSHA 3BA6A 1S02A 4GICA 5K0SA 3HYSA 4XYBA 2XE8A 2Z6VA 1T3ZA 4LNHA 3HU3A 1CRWG 1UBGA 4DCVA 1HH4A 4NVPA 1VQPV 1KDPA 1ODLA 3UG7A 3W6PA 3WHKA 3NTRA 4PLVA 4PSUA 2R47A 4K9SA 9LDBA 1IVYA 1E63A 4QICA 2UVPA 4ETMA 1U7OA 3GZTB 3EBPA 4GR4A 4DTCA 4S0ZA 5EYPA 1Q86H 2BIFA 2P3QA 1XDZA 1FYDA 2X8JB 1ZJ5A 1IB0A 1ZOLA 4ZQBA 3KJIA 1T34A 4J1TA 1XPJA 1AI5A 1VHTA 1M4UA 2X6BA 4BVRA 4LV6A 1Y37A 2I80A 2IIBA 4O1MA 4FZVA 4LOJA 4XQ9A 4MQ4A 1BGXT 2GHTA 1EEHA 1M7HA 1O95D 2VXOA 3BULA 3L0ZA 3F7YC 1VSUA 4Q9KA 2BFWA 3IPCA 3AKEA 4INJA 4QOEA 2ENUA 2ZUBA 5B12A 2I55A 1J8VA 4D8UA 3BAAA 2D4AA 3ICQB 3PFGA 3NR2A 1X70A 3HJNA 2I65A 2W11A 1PK9A 2XWSA 4FFBB 3QEMB 4LYFA 4KFCA 4JLKA 2QYHA 3VBCA 1DKUA 4Z1MD 1E5QA 1X74A 3DG9A 5IKXA 3PUKA 2I78A 1OBFO 2RC5A 5J2UA 4OPAA 1H0SA 3GW8A 2QT1A 4G5SA 3GRRA 4H7PA 1FQOA 2Q0XA 2KYRA 1MOFA 2NSHA 5DF1A 2HSJA 4WPGA 4XDHA 4MZDA 4ER7A 1DJOA 7ABPA 1KEUA 3UO8B 3U7JA 1ZL8B 3ME5A 5CT8A 1MXHA 2ZR7A 1FY2A 1Q7YH 2W0XA 5BR8O 4LCEA 4ZHQA 2R8XA 4UQPA 3GIWA 3C41J 4EBBA 1VLVA 5IHPA 3NLLA 1FXHA 1UM8A 2DWUA 2D0DA 2E4VA 3K4PA 1I30A 1SHLA 3TSCA 3GOQA 4I4TF 4GAEA 5BPHA 1T5TA 5IABA 4OJQA 3DT9A 4JI2B 2D2VA 3RWMB 1JG1A 4BGEA 4DAEA 4NHEA 1EXMA 1T2VA 1W2BU 1L1RA 1PZEA 4HAXA 4OPHA 4Y0VA 5C37A 5L6LB 5ULLA 3OCVA 2WLMA 1XAGA 2EWCA 1N6KA 1Y4AE 3ANTA 3KTFA 4IJKA 3R0JA 2JEYA 4BNIA 3A4TA 4DMGA 3W04A 3ZRXA 4BX9A 4KN5A 1OFHA 4GMKA 1RI4A 1D04A 4NCHA 2OCLA 2XQIA 3VYSB 1OJLA 1WZUA 1NQ3A 2UYQA 4KG7A 5CM9C 4EB6A 1YXBA 1TK2A 2VAMA 1EWRA 2AR9A 3QU2A 4J0QA 1OYYA 2YYZA 1LS6A 2ZF8A 4BN5A 2FP4A 2L35A 4O33A 2IHBA 1R73A 5IAEA 3K1AA 2CL0X 3B2NA 4DA6A 2B2XA 2V55B 4NNOA 2XE4A 1YDGA 1JMVA 2QMYA 3EHDA 1UF9A 4ZT7A 3UJBA 4NR1A 4ZHYB 3KXDA 3OKAA 3ROTA 4PZPA 1QLJA 4ZAWA 3WIUA 1K6EA 1Y1PA 1KAMA 2X0LA 1BXKA 1IXZA 1H0HA 1W44A 4B3GA 3E8FA 1I6WA 4CQNA 2PCLA 1TC2A 1HYEA 3A1WA 3A6KA 1QAOA 3BILA 1NOKA 5GANK 2O50A 2OLKA 1THZA 3FAVA 2FV8A 4QDKA 5JNVA 4D74A 3N6RA 1W8IA 5KAFZ 1XDWA 3AOGA 1RPOA 1HNZB 3M83A 1QD9A 3PWSA 4U6QA 2WILA 4DRZA 2IUFA 2FC3A 4LBEC 2Z2XA 5SZHB 1PEYA 3JZAA 2CB0A 1OXVA 2VNJA 1NVPB 4JKOA 4MROA 5ILOA 1F6BA 1ZC4A 2UZIR 2Q5OA 1D6MA 3HC7A 3M4JA 4IV0A 4NCKA 2JGUA 4RK4A 4UAVA 3MCVA 4QXRA 3W7BA 1T0HB 1DBRA 4RKRA 2O2YA 4LF5O 3MRXA 3CE6A 1KGSA 3DDWA 4ZKDA 1M8PA 5ALOA 7YASA 2R9VA 1ULBA 3NYRA 1WHTB 4L76A 2X6CA 4QJ4A 5D7BA 3GLIE 3AP3A 4MH0R 4JV5O 2VSYA 1HC7A 2DLNA 2GF0A 3DGEC 5DIZA 1WY5A 5EP3A 5HE8A 2WYUA 4TQ9A 3W78A 1Y7IA 1OWPA 1OZGA 3QPUA 4QXOA 3VHXA 1NXVA 2ASVA 4HN4B 2OWDA 1AN0A 1J9EA 1U7DA 3DKIA 1HNWO 5SY4A 4C3OB 1EB8A 3RVSA 1Y3IA 5LDDC 1R50A 1KQPA 2HRQA 4XOIA 3BPSA 4ICIA 4UFPA 1CY7A 1UFVA 1DWUA 1LPBB 1OYVA 4LF8B 3RIYA 4E15A 3MT0A 4XD2A 1ICEA 3ENQA 5LVAA 2Y76A 4X1OA 5H4GA 3DC7A 4ZN6A 1OY1A 2YW9A 4A8JC 4IRUB 1S4MA 1N36B 1FFGA 1G6OA 1R64A 2Q5HA 4KLRA 4LKRA 4MXDA 3QU5A 4U5QA 4C20A 1SN7A 2Z9CA 4BV9A 1EFKA 1G0OA 1YMVA 2AVDA 3CRZA 4IGGA 2C29D 3MOSA 3X44A 5ANRB 5IFKA 4PX5A 5K0GA 1LY1A 2V7EA 1SUDA 3OE7D 4OHWA 3K35A 4WEQA 1JFFA 1X2BA 5AUOB 3ASYA 4J0CA 3TQTA 1VHDA 3LUBA 2AH5A 3F5QA 3ORSA 2QPOA 3H9UA 1W4RA 2GBLA 4IKOA 2OGTA 1RQ2A 4X89A 3CEHA 3GFGA 5AO9A 3W79A 2AKAB 4UCQA 2BISA 2R8EA 5FOVA 4ZWNA 4KH1A 3KVRA 4NPCA 4JVLA 1CY1A 2F66C 2W6ID 3D4IA 5JJBA 5KNCH 1SVKA 1SU7A 3PX3A 1UPFA 3I9V6 1Z2DA 2J3DA 3EIXA 1JLHA 2Z3WA 3OT1A 3PIRA 3X1MA 3ZJYA 2C9OA 5JD5A 3OQNA 2NG1A 4AMBA 2PVPA 5AKHA 1P77A 1HSOA 3WGTA 3GCXA 2EOAA 4QXPA 5SY6A 1NMUB 3LLMA 3ZU6A 4KHPO 4C6TA 3BGIA 4UD2A 5AJVB 6YASA 1NJSA 2ITDC 4KSCA 2JEZA 3P94A 3ZNOA 5JJIA 5DB4A 2DW4A 2ATCA 4JSTA 2C9MA 4BNJA 5J1TB 2JPDA 4LF4B 1EJ2A 2ZRLA 1GA1A 3M5WA 2X8BA 4IO0A 2V8OA 4R2MA 3ROGA 3FM9A 3H5TA 2AE1A 4RUFA 4MWOA 4J7ZA 4PC3A 5BWCA 2GZAA 3T52A 1F2TB 4OIMA 4D4HA 1LDGA 3JQRA 3L1UA 3LYLA 2NWQA 4N0EA 1N6HA 4QHTA 3EN0A 5H82A 1YBHA 3RBAA 3TDMA 5HRCA 1XAJA 1W49A 3ONDA 4TT3A 2GAIA 3RS9A 3KLPX 1ZRMA 1E9FA 1RTKA 2PU5A 4NFSA 4FC6A 2CXTA 3C6ZA 4YJGA 1GSAA 3HA5A 4WIAA 3DBHB 4AWAA 2K5UA 5B3SB 2IDJA 2ORED 4ETWA 1T3TA 2VNAA 3NYWA 4QIHA 3C3BA 2G40A 5ELLA 3MXTA 1PJ8A 4CM7A 1EHCA 4JC8A 2OCBA 3T3HA 3E3LA 2O0MA 5EWMB 2CXRA 3D3IA 3WB2A 2IA5A 2ZZMA 1BHBA 3N5KA 4LVUA 1C7EA 2HMSA 2VUIB 4PINA 2KLBA 3AUTA 3WL6A 1QNFA 4JWKA 4KN6A 3AJ9A 5FI3A 4RTPA 1A8IA 2J9YB 5JSYA 3Q9UA 5F51A 1P2TA 2GXSA 1SA0A 3V00A 3OQHA 1ABFA 4ECEA 2H4YA 4DMHA 3MWEB 4HRXA 3T1NA 3ETHA 3F3YA 4N8DA 4TLBA 1AJNA 5KJEA 4CDNA 2DY0A 3VV2A 5F7JA 2YIBD 3I5MA 1H6CA 4NH0A 4YQEA 5KQSA 1PUJA 3CZRA 3NEYA 4BO3A 4UTVA 4H3KB 3AVPA 2IIPA 3P71T 1CJSA 5EP2A 3GBPA 1YCGA 4JOCA 1WA5A 2XNHA 2YWCA 4MSWC 1J0CA 2P9CA 3JPWA 4MQMA 4B3XA 5LM3A 4Z4GA 5BWLA 3SY8A 2V7BA 4FWTA 4BZZA 1T5IA 2FETA 5FORA 4QT0A 5KYWA 4H2DA 1NZ6A 1T4BA 2IHTA 1U4SA 3ZEDA 1SG0A 4U2BA 2Z8YM 3BFRA 1YTFD 4MKFA 2BRUA 3WL3A 4F6EA 2HIGA 3UMYA 1GUAA 4URHA 2QA4F 4UOZA 4RTJA 1XF1A 1Y6RA 2PT7A 4HTFB 1AA6A 4I4TA 1E4EB 3I0MA 4P86A 3TNFA 5GJWC 3N3BC 4J7AA 4CTKA 3PICA 1XIVA 2WWIA 1E5TA 3GDWA 1YD7A 4XARA 4P33A 4TVOA 5UKDA 4UMEA 4H3SA 4RH1A 3CUUA 4UHKA 4X7MA 4ZZ2A 5CBPA 2I29A 2PS0A 5TMBA 4FDMA 3DXRB 3VGPA 4JZGA 1PJSA 2C2XA 4YPFA 3BMNA 3M5PA 3ZXXA 2WWVD 3ZVKA 1F8UA 4MV5A 3MLBA 2CWDA 1MAWA 3DE4X 3ST7A 1JEYA 5LZ7A 1JDJA 4BO6A 5KJCA 2IEBA 1SUSA 4JCOA 5A4AA 4UEOA 3LS2A 1CF9A 2VQFB 3KPVA 1WW2A 4JUCA 1W73A 4IHJB 5CBFA 2V58A 2PYIA 3A4NA 4YCSA 2FX3A 4EEZA 3N5CA 1PAUA 3AIMA 1ZSYA 3AQ4A 3RC1A 3EZXA 4LE0A 4IZHA 1GUZA 1RWPA 3GI1A 4YLGA 1CUFA 1TYZA 5DTQA 2PY5A 5HW0A 1U3VA 1AVMA 3G5MA 2IM9A 4DILA 3RS7A 4BVQA 3AV0B 4AIIA 1PQWA 1ARZA 5FLXN 3SIUA 2B5WA 1OGIA 4QUEA 4U7WA 1RSZA 2BFOA 1H2BA 1Z5UA 4N5DA 1NF3A 4EJ2A 4I50B 1H22A 1LJ8A 5EQTA 4LCKA 2CCJA 3CZMA 2QZ4A 2A8YA 4QOJA 3SC6A 1U4OA 2DOSA 1DLBA 2AB0A 3GJXC 1BXRA 1YA4A 3O38A 1SOVA 5BUZA 1IZ0A 4OGWA 1AIPA 2IOQA 2GPAA 2VWQA 2ZBEA 3LWNA 5GV8A 4YJ3A 1VKJA 3SEQA 1QE0A 1W7AA 4DLLA 2HMTA 1BYUA 5F7ZA 2RMKB 4PXAA 2BHLA 4TTSA 3E86A 5FWXB 4E14A 3UPTA 1COZA 4GWGA 4JWTA 5AXDA 4UTPA 2AWNA 4IDHA 1N5DA 2F1JA 3P9RA 1NT2B 4BQQA 4HRYA 1IUKA 5D3MA 1JIJA 2MU1A 2YZMA 3RHTA 5LA6F 4RQFA 2UYGA 3QTTA 5AK4A 3ZVMA 1SAYA 2AZXA 5ENVA 4B3IA 2RC6A 2FNAA 3F6RA 2WLTA 2HAEA 2ZI5A 3DYVA 1ZU4A 4D9KA 1KI8A 2JGJA 5AVUA 1WSAA 3HA3A 1H9BA 4UXIA 1TEXA 4ACBA 1I14A 2ATEA 4BW5A 1NURA 6Q21A 3JQPA 1EHYA 2QTVB 3LGSA 4R68A 2HA7A 3WA6A 4HNVA 2OQ2A 2VCHA 2H85A 3LXXA 3T1YO 1E1YA 1FU7A 4WXEA 3BCCH 2H1LA 2RGNC 4XIGS 1RXWA 1V2HE 5DN6A 1FC0A 4CMBA 4PY2A 1J49A 1EFRG 1G5FA 4CT0A 3IL2A 3FTFA 1UCFA 1DAIA 1PFYA 4JL5A 3FDXA 4YPOA 4D43A 4X1YB 1RMTA 1G8HA 1XMIA 2QY9A 3D6TB 3KWMA 3KZ1E 5KU7A 3VR2D 3QV1A 4XJXA 4F7DA 3W05A 1TLFA 5JJCA 2DPMA 3R3WA 3HKCA 1XZEA 3B3JA 4M60A 3W5BA 1P61B 4RU1A 1PHRA 3A26A 3PFNA 4KXQA 3L9DA 3A2KA 1NBMG 2FWMX 3T4ZA 2B78A 2Z4SA 3GGJA 3R3UA 5D87A 3D6NB 3HKCB 3P52A 3Q8XB 4YO8A 5DO9A 3ZYCA 4GUNA 3RE3A 1JEJA 1XLTC 4IYIA 2FN9A 4M1WA 3TW8A 5AOVA 2W2NA 2UVQA 2H1RA 2YXEA 3QTBA 2POQX 2VYQA 3EQZA 4UXHA 4CUZA 4DZZA 4DQKA 1CS0A 4H6VA 1TYDE 3U3JA 2VTDA 4FINA 3JQGA 4IOKA 2KKWA 4DV1O 4PA3A 3B8EA 3K72B 3MK31 4GLOA 4A6EA 1FKAO 3C39A 2R7AA 4BE9A 4C81A 1YI2V 1JHPA 1P31A 3CCJF 4WNCA 2DYSC 1IQRA 1FTYA 2V7XA 1LKZA 2OZLB 1DDOA 1KYVA 2R97A 3PNLA 4L8FA 2KB1A 3DFKA 4AWXA 2PSFA 3LT5A 4AYXA 3IIJA 2JFBA 4QVGA 1LLCA 1WDMA 1CLUA 1TQ4A 4JXKA 3H9VA 4YQFA 1R37A 3ZR4B 3D8HA 3RWOA 2XCSB 3WG9A 3LX4A 4EB6B 3MRVA 1T0UA 3ZI4A 5IJWA 3EUFA 4WK6A 3H2HA 1PM9A 1ISPA 2JRCA 3PC2A 4QUBA 1B7GO 4QJ3A 1OBOA 3OLYA 3NM5A 2RDMA 2WDZA 2Z2JA 4GR9A 1ZJWA 4HDSA 3L8MA 4CQMA 4C2AA 5M5BA 2BHNA 3DHNA 4N3NA 1P1IA 3UJ7A 4YY3O 1C9MA 1PSWA 1YQUA 2E6UX 4OGGA 4QECA 5KWIA 4XWOA 1ONSA 1LBQA 1IEWA 2CXOA 2YN0A 1GKFA 1QBKC 2BV3A 3LYUA 4QASA 5MHTA 3O4FA 5FWAA 1T1GA 2GD1O 3C3WA 1F06A 4JTAB 4X71A 3V1NA 2ENWA 3CGWA 1ZM7A 2GZMA 2R7NA 4RKWA 1PO7A 1SVUA 2XYQA 1IN8A 3LKZA 2F1MA 1W4BA 1W5SA 3BDVA 3C6YA 3U4HA 4B6JA 3ZRWB 4DZTA 4Z49A 5I01A 4JKYA 4BY9D 1A0OA 4C22A 1KH2A 1VTKA 1NI5A 3GCGA 2QSZA 3TI7A 3AKCA 4Y3UA 4DXHA 1U1GA 1U9YA 3DPUA 4OFZA 5FPKA 3LDHA 4C43A 1VKHA 5AVKA 1BMFG 1AKRA 2PUHA 4JUAA 1MZPA 4OUDA 5D85A 4GMHA 1KETA 1TU3A 1KK2A 1SXJA 1NVWQ 4J6EA 4YLEA 1MIHA 3VC1A 4V1CI 1VLMA 5EUQB 4GRAA 3X1ZA 3LY5A 3UB4A 4BO0A 5H16A 4BVHA 2FWBA 2EILB 5DXFA 2DFDA 2BSKB 4N0PA 3CXCF 2OUIA 3DM5A 3IP6A 3FRJA 1RZRA 1M2WA 4G85A 2ROQA 1Y66A 3LWDA 1JFLA 1GPWB 2WA1A 4KIWA 3CPJB 3L7AA 4XIFA 4INPA 1PR2A 2CXNA 2EX3A 5DECA 4FLZA 1YR9A 4ZHVA 1R5OA 2ZUVA 4UHDA 1PJ3A 1WXWA 5TT1A 4DXAA 5LBTA 4DQVA 1GQYA 1RI3A 3OG9A 3FW1A 4TYQA 4U02A 5L4SA 2JLWA 3FMOB 1ZOOA 2Y1DA 4XVQA 4JTDB 3LGAA 4Y9RA 5DRYA 2WDPA 4FYPA 1JU4A 4JROA 4UEKA 3CUWA 4LRQA 3HJHA 5DLYA 3AVXA 1RYBA 1VEWA 1E3TA 1N8NA 1NJ5A 2QWXA 4Z8XA 4AKEA 3TINA 2EP8A 3LFHA 4X65B 4J49A 3VTFA 1NA5A 1HTBA 2PD4A 5DYYA 4DV1B 2M1ZA 5IVIA 4B4VA 1EM6A 5EC1C 1NSFA 1X7HA 1Z6PA 4ZANA 5FP0A 4E12A 4B3SB 2PXXA 4YRCA 3EXHC 1FXKB 4QQNA 2F7SA 2C96A 3S02A 3ACCA 3G8BA 1TOAA 5A3VA 3G9QA 3TIGA 2ZT8A 2A7QA 3GWGA 4KSBA 1ZBDA 4YYZA 1MDFA 3QVKA 4N12A 1GUYA 3QUWA 3HL0A 3JD4A 3QTCA 3ZD8A 4B0OA 5CFRA 4ABMA 3IHKA 3NTVA 3ZEAA 3RUIA 4NFYA 3UF0A 5FFFA 2QA4V 1XNQB 5I7SA 4XPIA 3NGXA 3CKLA 4E07A 4TUYF 2JIZG 2HM7A 3CR3C 1WZIA 1KAOA 4IBOA 4HVTA 4IIDA 1FXKC 1NIPA 1IQPA 4QJ5A 4RVOA 4X95A 5EMHA 3UAOA 3AERB 4C6HA 5IT5A 1T6BY 3K5MA 2PWZA 3OU6A 4MWZA 3EASA 1N2IA 4OOFA 1WF6A 4FLEA 4B43A 1DARA 1AQNA 4IQGA 2QSUA 2W2TA 2CW4A 3L40A 5H9CA 2JJ2G 4YR7A 3OM9A 1HNZO 2J9XB 3JQBC 3RK4A 2NLOA 4BNYA 2GAFA 2PV7A 1VPDA 2PZGA 3KD3A 3OLWA 2JD2A 4Q3LA 1Q3HA 1Q6HA 1R0KA 1U7HA 1URPA 2GUWA 2ZTMA 1VARA 1Q12A 3P20A 4IJVA 1C30B 4J94A 1NULA 5KOJB 1I80A 4KZPA 3RRXA 1DCKA 2WIKA 3M5CA 4DDWA 4UDXX 2PYZA 4EG8A 5CHYA 1DF5A 1UC9A 3AF6A 1XPRA 3MHTA 1H2HA 1KVUA 4K6CA 3FR7A 5AJHA 1PEDA 2QXUA 1BRMA 3BA9A 1W5BA 3SHWA 2R2AA 2PL1A 3JCZA 1YHQV 4YUWA 1G9XA 3TRJA 1K92A 2IYRA 4WCFC 3L73H 4BMYA 2Z1TA 2F9MA 2YR0A 3GMDA 1CXZA 5FLXA 2CVZA 2RGBA 3TAXA 3ZWVA 4ZI7F 3PXCX 4L74A 4ZREA 4LH7A 1DKRA 2BMFA 4YJ3F 4BJ6A 4ENQA 2W6CX 3AB7A 2ZJOA 1LSJA 1BCSA 2DCUA 1H8EA 4K0KO 2FZVA 4OI2A 2LBXA 1D8TA 1Z15A 5AIBA 1ECGA 2FPGA 2ZROA 3O4JA 4WFAV 4Q82A 3LX5A 1JVMA 2HU5A 1GO3F 4XBFA 1JB1A 1EBUA 1GL9B 1LJLA 3DZKA 5CJPA 4Q34A 2QE6A 3VR5D 3FUUA 2GVDC 4DSAA 4F5EA 1RKQA 4E5PA 2CSXA 3WU2Z 2XAQA 1RNLA 3FOZA 3LO5A 2W6IA 1MBZA 3A6EA 1U65A 2ATKC 1T9CA 4NKGB 1EWKA 5TPWA 3L6UA 3URKA 5DHSA 1VA4A 4BBJA 5ALMA 1Y5IA 5E7IA 3RJ9A 3V9PA 5CFOA 1DGQA 1KKMA 1T8WA 1OWMA 4M7WA 1M6VA 1MVLA 2FEKA 2WAXA 2VQFO 2BO1A 1B06A 3HYRA 5TRTA 2ZUTA 3PG5A 2OZEA 1FFSA 3I23A 4QGAA 3HN7A 2X23A 3HACA 1VI5A 3SQLA 2HHHB 1CUUA 4HZUA 4MA4A 4RYDA 4CS2A 1KFCB 2AC7A 3AUKA 4QTYA 4RXTA 4CLXA 2JA2A 4MTOA 1Z5VA 1V5GA 3FPHA 3LUFA 3OZUA 2Q28A 3L05A 4OMUA 1FFDA 4GC9A 4EA8A 4A1FA 5JZVA 4DCGA 4H1VA 2BF4A 1YJNV 2P3SA 5DEDA 2XMZA 1LBEA 3N59A 4LRWA 1E5XA 2JARA 2JIZA 3HV2A 4M1QA 3L8CA 4CEHA 3B9BA 5CVCA 1UWVA 4KXYA 2JFHA 2CUTA 3TB4A 1RM0A 1L9XA 4KR7A 1AGPA 1B8PA 2VRCD 4XYEA 5F12A 2V6IA 4Q4AB 3E81A 4A6DA 1IJKA 3DW1X 3IDFA 2RHGB 3QQPA 4Q18A 1G2IA 3ZV7A 4G1BA 1XXHA 1G19A 1Z4QA 2WSBA 3OESA 1MPXA 4OXSA 1FW8A 2QVYX 3JR7A 4ZO9A 3IBTA 3HKEB 2I1QA 3HDJA 5KOHA 3UM7A 4WCFB 1JJBA 3C6XA 4WLUA 9LDTA 2A92A 4KP4A 3BVPA 1IV2A 1PR5A 1JHRA 1XDSA 4I9UA 3SBXA 1ID1A 5G53C 4A16A 2VKTA 4JB3A 3IEIA 5G1NA 3TLMA 5CYOA 5BSKA 1M1XB 5CXUA 4FOOA 2HYDA 1V39A 5EHZA 1NRJB 2WIGA 1JMKC 3OM3B 3KQWA 5EWMA 2X6RA 1G3MA 1EZ4A 3FNHA 1W19A 3TAUA 3CCJV 1P33A 2IDZA 3B3GA 1XZNA 3IQDB 3JYHA 2YFYA 4MVCA 4X5OA 1WB6A 4F1JA 4DDUA 2JA1A 2F4VO 3B7GA 5BNTA 3L5KA 2LP7A 5CDHA 5I8WA 4I55A 4OBBA 5FF9A 4CGZA 1VYHA 1C2TA 5L3QB 1YNOA 1G64A 4NYJQ 2ZRCA 4ZI5A 2RH8A 1QPZA 3WLKX 4AS2A 3NWOA 4RUEA 1W85A 1RLMA 1COWD 2NZUG 3WJPA 2Q5JA 2YFKA 1ZDMA 3A06A 3WHPA 2QUAA 3AW8A 3FHLA 4CF6A 3PD0A 2ODTX 2GRUA 4M0CA 5JBQA 2PCJA 4HVCA 1TGOA 1W36B 3HXLA 1V8OA 1BG6A 2QRPA 1LDEA 5TY0A 4KQEA 4KO2S 4AN0A 5ECDA 1SC5B 1PNRA 1CUVA 1XU4A 1XNGA 4QQRA 2QQ0A 3G67A 3Q8KA 4EAQA 2V6BA 3BAZA 1I7FA 3JYQA 5FBWB 3RG8A 1T0JB 2Q5IA 5CDTA 2PUGA 3WLQA 3PYXA 3G79A 2W8BB 4G1CA 2WT9A 1CQJA 1FTGA 2FPIB 1T26A 2LBTA 1VQ7F 2W2LA 2X1VA 3O74A 4QDXA 5IDYA 3TZKA 3IDSA 2Q8PA 4C7KA 4GXTA 5LOVA 1SCDA 1SUFA 5E3HA 1KI9A 1XQ1A 2BEVB 3AM4A 5HPYB 2I3BA 1ZHFA 4KHPB 3ZJUA 3QTYA 1G5HA 2Q67A 2V9CA 3M82A 3V8NA 4AUNA 2ZJAA 4PNZA 1FJHA 2HNKA 1NVEA 3V7NA 1WZCA 2H07A 3O1LA 3LXRA 3QJGA 2GRJA 4JA2A 4LJ7A 1EGQA 3PC3A 1TGVA 3UT6A 4WZBE 4F3CA 3ZIAG 1YRYE 2CLMB 1P5JA 2DSNA 3JYPA 5A5EA 4FOTA 1HE2A 1OWOA 2FMKA 1WMBA 2BSAA 4UC0A 3PDHA 3ZY2A 2QW8A 4UPEA 2HJDA 1JQ5A 3LP8A 3CMEF 1H0KA 2OZPA 4JB0A 3FZNA 5EKDA 3I45A 4X8HA 5KHAA 4HMQA 5BNFA 3IAM6 3OEYA 1RPJA 2ZYDA 1S5LZ 3QM1A 2FN7A 4NEHB 4CR7A 1C1YA 5ALNA 1LFAA 3OEHD 4F60A 3DE5X 4K40A 4CIDA 1SUWA 2X9GA 4L8JA 2ZIEA 4HLUC 1PJQA 2G7ZA 2IHNA 1MQ9A 4EUHA 2YOHA 2B92A 5JSUA 1PWYE 1V0JA 2FPIA 4IDPA 3CLSD 2CHGA 1K68A 3IEWA 2YV5A 3SR3A 4AUEA 4YUVA 4Z4HA 4PJ0Z 2CNOA 3ORHA 5EINA 3T1TA 3ZHTA 1N0IA 2C5GA 1NR1A 4XSHA 3OD5A 2NTYC 1L8DA 1CV2A 1PR4A 3HJTA 3M2TA 5FR2A 5HS6A 2GJSA 2SKEA 2ERCA 2YJTD 4KMSA 2LTAA 4YS6A 3VR6D 1E0DA 5LD2C 4HQOA 1MHPA 1Z38A 2IUSA 5BP7A 4MWGA 1H42A 1NSTA 1RHJA 1GTMA 1NMQA 2R65A 4FYKA 4JB2A 3U81A 4CLHA 3VNUA 4JAVC 2ADOA 1JG2A 3MD0A 1QPGA 2GTAA 1W581 2WM9B 2V6FA 4U7GA 2I7XA 4WOJA 4HT3B 4IWXA 4LRYA 5LC1A 2XGMA 5GTDA 1PGNA 2ORWA 4JQSA 4OLBA 2AYYA 1L5VA 1JLMA 3QVOA 1G7TA 1UZLA 3QEOA 3N05A 1MORA 2IK8A 2WWRA 4RF3A 3VISA 1NKSA 4EHIA 1CUXA 5JEEA 5KDDA 2BFEB 4PTYA 1NJGA 4BFZA 3B82A 4YP9A 1UWCA 3A31A 3CCRV 3TLXA 4X6LA 2FKAA 4ZU1X 4ZVPA 1SVSA 4H0CA 2IY8A 3NNDA 4HWGA 1J22A 2HCRA 1TQDA 2IU6A 3Q3EA 2OCYC 5DSXA 3BSWA 3GMTA 4HSEA 3NVKE 4C6RA 3HJAA 3A3OA 4AW9A 3B6NA 2J31A 3CYFA 3HYNA 4UEQA 2HS4A 4TM8A 3ZU5A 1GM8A 2QUJA 3N9IA 3WLOA 1GEEA 1G8JA 4ZZ0A 2QPLA 4IH4A 4Y6GB 1L7BA 2JZOA 4LDRA 4I4CA 4CQLB 4O29A 3H9GA 4PICA 5K2MA 3RYFB 4OQZA 4X85A 1VDMA 4ROSA 2QUBA 3UXYA 1O0BA 2MT9A 5BYBA 1OIWA 3J81k 4DUPA 5HJ7A 4DUZO 2WG1A 3AY6A 3EIWA 3Q4HB 3QIAA 4X8OA 2Q62A 3P2OA 1K8AH 4P5PA 1UPAA 3R7WA 3L5OA 2DYRB 2CL5A 2E76B 3SJCC 2ZSDA 4KQIA 1TIPA 4H33A 4OUKX 4RM2A 1XP5A 3UA3A 1KEEA 3ZU3A 4X8LA 4K9MA 2CK3A 1KJJA 3B12A 1S4QA 3ON1A 4F38A 5KYYB 3ES9A 2BJWA 4FS3A 1BX1A 5F77A 4M9CA 2R70A 1G8YA 4PA9A 3O1IC 4R0MA 1SQGA 3N8KA 4ZVKA 4DCUA 1F7VA 3RYTC 4Q02A 4CG3A 4FLWA 1GYQA 1N5KA 3Q3GE 3QGMA 3R0XA 4MP3A 4N5MA 4DRYA 4N5LA 2FKXA 2FDXA 4TKLA 5IG2A 1QR2A 3IOCA 2ACVA 1GV1A 2A1UA 4JR0A 4UVDA 1TA0A 1MAAA 2A1TS 1ZH4A 3OEED 3F5SA 2O3QA 2QN7A 1W29A 4Y2HA 2P9YA 3IPXA 1Q16A 2UZ0A 2HA6A 1S3SA 1SHJA 1CF2O 3OP4A 2CTPA 3EVTA 1H2KA 2CJYA 3DDSA 4DV5O 3A9WA 1IBRA 1QWSA 2OSVA 4TMZA 1QBGA 4LGMA 3H11A 4LA4A 2HWKA 1L5HA 2XHEA 5LNK6 1I51A 4JDPA 2LQTA 1JFSA 1RJWA 2FA9A 4QAJA 3ESAA 3E9MA 1MV8A 1X4TA 3HS3A 1R0CA 2CJWB 3G8YA 3VR4A 2YW2A 3FYIB 4LF9O 2Z3ZA 3ZN0A 1F3OA 1M75A 1NXSA 1P2DA 3QNEA 4PLPA 4RVHA 1Q92A 2QNBA 3N8NA 1OCRB 1KZYC 4NICA 3IQZA 4IWNA 4CHTA 5LL6P 1Y74A 4LAFA 3E35A 4U7DA 2RGGA 5IH3A 2X0NA 1YOBA 4CCAA 4KTTE 5AM1A 5HQ3B 3ESRA 3W06A 2DQYA 1XEFA 3PE4A 4OM8A 1ECLA 2HA3A 4RVGA 2OCIA 1Q90D 1JU3A 3Q3JB 1B6TA 2V9ZA 2XPCA 3IMFA 1SD2A 1C30A 5FI5A 5KOJA 5C80A 1JIVA 4C82A 2JEOA 1JKJA 2HV8A 1T5HX 4HLQB 3SX2A 4J7KA 3MMXA 5U1PA 1H48A 5CGQB 4DLKA 3N2KA 4JI4B 2PS1A 2ACKA 3KOXA 2Q4PA 1QHHB 3PT9A 5CA1B 4GCZA 1T0AA 3FCAA 3TQSA 4CV2A 1LC3A 2ZJ7A 5JNTA 2WJYA 4UHHA 1X15A 2Q6IA 4D41A 1GDTA 2DE0X 2YI8A 1IBMO 1CR4A 1ODTC 1P1KA 2FLVA 2JNBA 4TKMA 1QAMA 2X13A 2X2EA 4GEKA 1FMFA 3VKFA 5IRCD 5KYXA 1T13A 1HQYE 2ZSEA 2YH2A 5AVVA 1ISSA 3PEWA 5BT9A 4FP9A 3N76A 4IL5A 3N07A 5FV4A 4M88A 9ABPA 1L3CA 4ZVUA 4RK0A 4BR6A 2PZSA 1QFJA 4XRRA 1O03A 4DTIA 2EDAA 3AG4C 3LDCA 1IXKA 5F3RA 4RPJA 3VO1A 3L7IA 3WNDA 3N6XA 3KTOA 3S2UA 3QNMA 5FX2A 2Q4TA 1FXKA 3ONNA 2JBAA 2A9KA 4RPGA 1Y74B 2HDOA 1HBJA 4JSYA 4L8YA 1P5HA 1DTOA 1Y1SA 4NG5A 5G40A 3ZQUA 1V37A 4X7RA 4B2PA 2DB3A 1DTWB 4CODB 4CNBA 2VH2A 3T3OA 4L16A 4ER0A 4O02B 4IT5A 4X20B 3A4MA 3OZCA 4Q1VA 5JXGA 2JD0A 3L93A 1HMYA 4CM9A 3A25A 4JL6A 2OTMA 1T1SA 2RAUA 4JQZA 1KYXA 1OU0A 1XQ8A 2B8TA 3U4QA 1H2LA 1YIAA 2ZTLA 3MJ4A 4MV7A 1YKFA 2Y0BA 4R81A 3VYTB 4Q9AA 4J4TA 4DJDC 4FC7A 3ONFA 3IE0A 3CSXA 2H51A 4FTWA 1P1FA 2FR8C 3DOCA 4ER5A 5LMNO 1DAOA 3CMCO 4DJTA 1MPTA 4X6YA 3K9GA 5JO9A 2PNFA 3C6BA 1G7SA 1K6JA 3BXOA 1MSDA 5BQ3A 5LKRA 4PRYA 1AU9A 2UXCO 3CGGA 3IFXA 5ADWA 4BUCA 3EQ8A 2GYYA 1CB7A 4ZA2A 4CLRA 4B8ZA 2YCLA 2C2BA 3T41A 4YIHA 1I2MA 4Z86A 1MJ5A 1B26A 4RHEA 3JQEA 2SECE 1OV9A 4WH0A 2XQGA 3ZK7A 4RVDA 2P6YA 2ZP1A 1CK4A 3ICWA 4KL1A 1JTEA 2IS4A 2P11A 2OORA 2ZIXB 1QJCA 3VM6A 4DLAA 2NV6A 3SP1A 4Q48A 2AFHA 1Z0UA 1E9AA 1MENA 1VF7A 4H37A 5A71A 4I4IA 4RMHA 1T9GR 3BZBA 2A86A 1VJTA 4UTRA 1E1RA 1SPBS 5L3RA 2C7PA 4EMBA 3K5OA 4FZ3A 4LZOA 4NXMO 2NU7A 1ACLA 1FDIA 1VJ1A 2YJNA 2VSFA 4GECA 3GLKA 3PEYA 3C2QA 3RUPA 3BXXA 4ZPXA 3TYXA 4DBZA 4EA9A 2C1ZA 4DR2B 4ZYXA 1HDEA 1D1QA 1WTAA 4MVJP 5L4LA 1JZTA 2QR2A 3A28A 4L8GA 1G18A 4E3WA 1QK3A 2C31A 1LK5A 3UCFA 3C9UA 4B6EA 3RVLA 2DVMA 1T9AA 1OX6A 3MAAC 2GEVA 4LP8A 1RS0A 4G0YA 3L8HA 4JK3A 4TT3D 4UQLA 2JI9A 3EUEA 1YL5A 2OBFA 4A0GA 5KKAA 3SS7X 3GA5A 3ANSA 3WL7A 5E2IA 3SD7A 3BG5A 3CRMA 2EBOA 5B1BB 1TCBA 2HPVA 2HSWA 3CH6A 1G41A 1YZNA