5JQGB

An apo tubulin-rb-ttl complex structure used for side-by-side comparison
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
427
structure length
423
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Pironetin reacts covalently with cysteine-316 of alpha-tubulin to destabilize microtubule
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 173
structure length 423
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jqgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jqgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jqgB01
2VAPA 5LP6B 4TV8A 3WGMA 3VO9A 4FFBA 4O2BA 2R6R1 5J2TA 3RYFB 4XCQA 2RHHA 4TUYA 4HNAA 5EIBC 2BTOA 2Q1XA 5JQGA 4O4LA 4O4HA 1W581 5C8YA 3RYCB 3JATA 5ITZB 3JALB 4I50A 2R751 5CA0A 4IIJB 3RYHB 4I4TB 1TVKB 3N2KA 4I55A 5CB4A 5JVDB 3R4VA 4X1YA 3N2GA 3JAWB 5JCOA 5BMVB 3VOAA 3ZBPA 5LYJB 4DRXB 4TV9B 5EYPA 4F6RA 2BTQA 4WBNA 4ZHQB 2XKAA 4IHJB 5MN4A 1FFXB 4EI8A 3E22B 3HKDB 1Z5WA 3JARA 3M89A 5LOVB 1Z5VA 4EB6B 3JAKB 1TUBA 1JFFB 1OFUA 5KMGA 3C8LA 3HKCB 4X20A 4ZOLB 3RYIB 5MN6A 5IJ9B 5KX5B 5EIBD 4TV8B 4O4JB 5LA6A 4FFBB 4U3JB 5FNVA 3WGJA 5M7EA 5J2UA 4X1IB 4ZOLA 4YJ3A 5IJ9A 5JCOC 5GONB 5LP6A 4O2AB 5MN5A 3WGLA 5JQGB 3RYFA 3V3TA 5CA1B 5JH7B 4KWEA 4X1KB 3UT5B 4ZI7B 2VAMA 3VO8A 2RHJA 2VAWA 3M8KA 5IJ0A 2VXYA 3RYCA 3CB2A 5IYZB 3JALA 3JASB 4F6RB 5LXTB 4EI7A 4IIJA 3RYHA 4I4TA 1TVKA 5JVDA 1W5FA 3JAWA 5BMVA 2RHLA 4DRXA 4TV9A 3HKEA 1RLUA 5EZYA 4YJ2B 4IHJA 1SA0B 3HKBB 1TUBB 4LNUA 4O4IB 2Q1YA 1W5BA 1FFXA 4B46A 4O2BB 3HKDA 5J2TB 5LOVA 1RQ2A 4EB6A 3VPAA 3JAKA 4TUYB 5LP6C 5ITZA 3ZBQA 4M8IA 1JFFA 3ZIDA 4HNAB 1RQ7A 4O4LB 4O4HB 3WGNA 5C8YB 3HKCA 3JATB 4I50B 3RYIA 5CA0B 5CB4B 3N2KB 4I55B 5KX5A 4X1YB 3N2GB 4O4JA 4U3JA 2GVIA 4X1IA 5EYPB 1FSZA 4U39A 3WGKA 3VOBA 2BTQB 4WBNB 2RHOA 5GONA 4O2AA 5IJ0B 5LYJA 1W5EA 3JARB 5CA1A 5JH7A 4X1KA 3UT5A 4ZHQA 4ZI7A 1W59A 4B45A 5KMGB 3E22A 5IYZA 3HKEB 3JASA 5LXTA 4DXDA 4EI9A 5EZYB 4X20B 1W5AA 3RB8A 4E6EA 4LNUB 5LA6B 5FNVB 2XKBA 4YJ2A 5J2UB 1SA0A 3HKBA 4YJ3B 4O4IA
chains in the Genus database with same CATH superfamily
1YV9A 4F97A 4NSNA 2RE8A 1K88A 2Q1XA 2C7BA 3GO4A 4GNRA 5CYGA 1E2PA 2DERA 3EWSA 2JD2A 2FEXA 2PUTA 2NVOA 3PXGA 2IW1A 4DOMA 2EZOA 4HATA 2IW3A 1FX0A 4HVLA 1LX6A 4IHAA 3F6RA 3CZRA 5FWNA 1XJ0A 1XX6A 3W05A 1P18A 3VR5H 4H59A 4P7JA 4R40A 2D2FA 2H4ZA 3RUHA 4ZA2A 1WB5A 4IEEA 1LSOA 2O1SA 1AKUA 2VT2A 3AI1A 1D4AA 3BF7A 1RBYA 5K05A 3COZA 3OGCC 1CUGA 4CEIB 1CEYA 4JFRA 1QUFA 3K0HA 3S7TA 3ZHZA 3GT4A 1ST2A 3VOSA 1D03A 3CUYA 2COEA 2OV3A 4Z9YA 4JT2A 1XVTA 3ZJUA 2V7UA 4V02A 5I48A 3PRJA 1Y3BE 4Z4EA 3OUSA 4O2RA 3MWFA 3OPMA 1N7GA 2V65A 3F5DA 4FIZA 1YFJA 2PWAA 1C2TA 3IPLA 3SZGA 4DVGA 1UDXA 1ZH6A 5J2UA 3A3NA 5JCOC 2WIGA 4DQLA 3FFMA 3PEYA 4QEKA 3GCGA 1C8KA 4C4WC 1UDWA 2F1KA 3IR5A 1RABA 1LW6E 1KZ4A 1E0AA 2ZVPX 2NPIA 1KYOF 4MS3A 4M83A 3F6PA 1ML4A 2PSHA 4LZOA 4C22A 3D6JA 1KU0A 3SE0A 3AM3A 3HM9A 2ZXFA 2KWIA 3BRWA 4L22A 4CQMD 4XE5A 4B73A 2A35A 4RMGA 3VRHA 4R8CA 2F90A 3RB8A 2XH8A 2AZ4A 2VTVA 3GN2A 4DMRA 1Q1QA 1L5QA 4WK2B 5BQXA 5IRCD 4ESEA 2IU0A 1C3XA 3EN0A 2VP6A 3VOAA 3FKQA 3DOFA 1Z0KA 4WX2B 4PAQA 4ENRA 5L3QB 3D5EA 4YAJA 1QF6A 3A6EA 4JLKA 3VYUB 2BCJQ 1TM1E 4G37A 1J8QA 2FDXA 1UJ6A 4KIWA 4QOGA 1XZDA 3OPVA 2AC7A 1N2XA 5LD2C 3TOZA 1V9SA 1HDRA 2XVXA 4ZVMA 1W30A 4I1IA 1YR7A 3KYIB 1VQ1A 4DXHA 3V80A 4DV1O 3AVXA 4Z4HA 1LXCA 5EESA 2M6LA 3ZWPA 3UJDA 2QTVB 4ZEOA 1NXXA 3EEYA 1SY7A 2DWQA 3VU9B 1U8FO 3U62A 3JARB 1PUIA 5KQLA 3FCAA 3SKXA 1OH7A 3A37A 1V2GA 2PWPA 4HDRA 3FSEA 1XN4A 3HL0A 1YCFA 3WQHA 4H7IA 5A7GA 4Q48A 1JHUA 2CGNA 1XCOA 3CJHB 2VH5R 1GRCA 3H5NA 5IVPA 3BILA 2EHDA 3WOHA 1NYLA 4DSOA 2DU8A 1JQEA 2VP5A 2WMDA 3ISTA 2BF4A 4XQEA 3ZX5A 2PT5A 2ZW9A 4JP2A 3DV2A 2IXAA 4WCFA 1C1HA 3DBRB 2O7NA 5LOVF 1K9MH 2Z04A 4DSNA 2ECFA 2QZSA 2PZLA 3ELBA 4FOPA 4HVCA 1QV7A 3BXOA 1R73A 3DKVA 3LUCA 2AMVA 3QA9A 3D0RA 5KWEA 3VJMA 1L8DA 1U2PA 3EHBB 2BFNA 2V1DA 3TRJA 2IP1A 2D1TA 4J94A 1KERA 4F12A 4NI5A 4G0OA 3A04A 4F3KA 1FFBA 3EIUA 3WS7A 1ZIOA 1BEZA 5EWLA 5DOVA 2JFFA 1SBCA 3MIZA 3VR4D 4HAUA 1F1JA 5H3LA 3RS8A 4JH0A 2AN5A 5KNCD 2VZ9A 5H02A 2XAUA 2LFRA 1YQ9A 4DMGA 1DJQA 3KS9A 1YDFA 4L2IA 1W29A 4Q9DA 2DHDA 4HRYA 4KBFA 5T64A 5ETJA 2JKZA 4JLBA 2ZDQA 4BO2A 3VYTC 1LSUA 3E84A 2HREA 1SOWA 1L5GB 3FF1A 1PEAA 3G9UA 4BZPA 2O5EA 5AHWA 4URWR 4GOMD 3BB1A 2OO3A 2BR5A 1XEXB 1E79G 4HUQA 4HR7A 4JUCA 2OHHA 3SR0A 1JR3D 3G67A 4PLCA 3LHKA 2J3JA 3MZ0A 1U40A 1FRVA 4WADA 4M8IA 3AP2A 3D64A 1J0DA 1K5SA 2FVXA 3JQBC 4OHXA 1NLFA 3JYNA 1KHTA 2H4XA 2E37A 3MHHC 4IS2A 1LJLA 4KOEC 3TCNA 4JJ7A 2AS0A 1VMIA 4A92A 4Y1GA 4CI9A 1ZKMA 4KODA 1QIIA 2H57A 1GL3A 4Q16A 4HTAA 1FUUA 3OX2A 2B78A 2IIQA 5HZGA 5EJAA 4OQZA 5A2QN 1K8XB 2BBWA 3KVVA 4BEJA 1QTNA 2J7PA 3H6GA 5HGJA 2EFDB 1FSSA 4S3MA 5AKZA 5DNAA 4WKOA 2AW5A 5K3FA 3BZUA 4RX1A 4M0FA 3W2IA 4K40A 1T2EA 3RTDA 2NNLD 4BO8A 1WY5A 4FOLA 4KKXB 4G5HA 3RDPA 5JJEB 1ZVMA 4F84A 3UJ9A 1UPXA 2CCKA 3L7DA 5D5QA 3F6YA 2D2EA 4FMDB 5EIEA 2HF7A 2I22A 5K09A 1YK1A 2B3TA 3T1QA 3ABIA 2WHXA 2J45A 4EGAA 1I4WA 2WDZA 2J5QA 1DKLA 4E11A 5MGBA 3N76A 4OJQA 3BRSA 3FMVA 4PZPA 2P77A 1OZFA 4ZV7A 2TSYB 2O52A 3JD4A 4F4FA 1KR5A 2JI8A 2CHVA 1MIOA 1ADJA 5IYBO 1KAEA 3DZIA 4JC8A 3OP4A 5JWOA 3EA0A 1ECJA 3SZRA 2R4TA 4DUYO 1MGOA 4GOKA 1OX6A 2YS8A 5TR9A 4OU5A 4JI0B 3LKZA 4A6PA 1KOJA 4E5YA 1YIAA 5AWFC 2DQ0A 3RSCA 4EHLA 2EG9A 3VCZA 1E8DA 1CY7A 1MO5A 4LG1A 3WWZA 3HGTA 4K6GA 3HXQA 2V7QA 3CEJA 2C98A 5GW7A 4UHCA 4DCTA 3I6ZA 4N7RA 4ZC1A 5KSZA 3AHEA 3K0TA 4ZTBA 5HQJA 1HG1A 4FK5C 3QUSA 2BEKA 2WHPB 3BZBA 2HA4A 3ZZ0A 1SQSA 4RQEA 2Y27A 2V4UA 1K5PA 4W63A 3R66A 1TIPA 4RTLA 5IDVA 4V0RA 2RK3A 1NPDA 4IIJB 3ZOKA 5E95A 5KIAA 5K0LA 3K1AB 1GGHA 1GO0A 2RC6A 3QU9A 1KVQA 2ZIXB 2ZAUA 1BJTA 2ENWA 4FI3F 4M54A 1WF6A 4MW8A 2CFCA 5BSWA 4N5LA 3G7SA 1MC8A 1QANA 1KFEB 5CJPA 1XAIA 2NTJA 3I34X 4OKIA 2L35A 5KPDA 1HSOA 4TRMA 5IEJA 1SB9A 2QRMA 4OXXA 2FPPA 2XUMA 3A14A 3I2FA 4WFGA 5IN4A 4OHZA 1VPTA 1GGEA 1DEHA 4PZ9A 5KB3A 2ZJ8A 1TMYA 2JA2A 1KC8H 3WK8A 4QGHA 4JZGA 3ENKA 3ENZA 2DE0X 5FQOA 2CLEB 3CCUV 3QHQA 3R7WB 1W87A 3GGSA 2X8JB 3DQZA 3S2UA 3G4SV 3ED5A 3G2KA 4YJGB 1KDOA 3KEMA 1A2KC 1QS0B 4Z8XA 5ICSA 1OW3B 4YMUA 5CA0A 5FUMA 3KOWA 1FYVA 5BV2P 2WSLA 4IDDA 5K3AA 3SF8B 4GICA 3PRKE 4YA6A 1K9SA 4BLRA 1U4OA 2HEGA 3E9DA 2FZEA 2WJHA 3DV9A 3H16A 4GMFA 2HNBA 4WKCA 1CUHA 5FOQA 3MVEA 2LGWA 3GUZA 3I7TA 1KYXA 1DARA 1E2EA 2KPOA 1G5RA 3VMFA 2JBWA 3CCCA 1VQKV 3QXHA 1M73E 3NC1C 1US6A 3ADDA 3FPBA 1RACA 3GD5A 1Q83A 1VIMA 2FSSA 3ACBA 4MWEA 2C3YA 2BIFA 2GRJA 4P2ZA 3EOAI 2XEXA 2GCGA 3NLLA 4NY1A 5I5EA 5AVVA 4AT1A 3DBOB 5DWQA 1RPNA 2V0GA 1CYEA 3FNFA 5I01A 1CDEA 1IZ7A 1K8ZB 5HEKA 5AKHA 5ALXA 5B3JC 3OE7A 3FJYA 3AEKA 1GCGA 3DGEC 1FXSA 2UAGA 4I2VA 1EFRA 2BEWA 2XUIA 4OQEA 2Q8VA 1Z0FA 3KQYA 1Y7TA 4ICIA 4JDPA 4BQPA 2EWCA 4KNYA 4GZ6A 3R9WA 3O75A 1RM3A 2PFKA 3PAFA 1ZNWA 2ADFA 2FRDC 5JJCA 4CM8A 1GKUB 4LSMA 2R47A 4CYMA 5JQWA 2NV0A 1SBIA 2O9JA 2VJKA 5FO0A 1CB0A 2QA5A 4DR7B 3M3PA 3K14A 2PK3A 5IUNC 1M7GA 1M2GA 1TUIA 3TZKA 1R00A 2VCYA 3B6EA 5JJLA 3CSSA 3RASA 3AVYA 4V0OA 1TYAE 4GI1A 1H2XA 3JWPA 2FSIA 1U0TA 3EPJA 3QV1A 2X9VA 4MIKA 4HB4A 1IXKA 2P2ZA 1NATA 5JZ9A 4E4YA 2J41A 2V5VA 2BZGA 2O20A 1ZH8A 1R37A 2C7VA 2GEDA 4KBGA 4O02B 3I9V1 1VMGA 4ZC8A 1LZLA 5BURA 1K4DC 4PIMA 1NVDA 1GO2A 3GH1A 3E7XA 4JI4O 4DR2O 2PYZA 3A8TA 5EMHA 3G6EV 2X0EA 9LDBA 3S2GA 1VM6A 1SUDA 4LV5B 1WP9A 4MWCA 2D0PB 3R8CA 2HQOA 2ZYDA 2CE7A 4QQ8A 3QO8A 5JS7A 2V7QG 2G1KA 4D9FA 3M5WA 1T0BA 1Q15A 5JPCA 3NP9A 4NCXA 1ODEA 3ZDRA 2HYDA 1GRVA 3J7AR 4BCCA 3RVKA 3K70C 2Y1EA 2UUAB 3DBVO 3ZEIA 1SDSA 4AZVA 3PDHA 1PTKA 1DC4A 1FW6A 2NAFA 1NUSA 4DA0A 4DLLA 4NMHA 5KQSA 2JLVA 1KH3A 1VPEA 1U3DA 3VR5D 1Y3DE 4HVAA 3DMYA 1AVMA 2DH5A 1EJ6A 2IXGA 2PUAA 1F4PA 2KBFA 5THKA 4OSOA 1YDHA 4IS3A 3UY4A 4N4AA 5DSZA 1RWBA 1RLJA 5IT5A 1ADYA 4QOSA 1MN6A 2ZUTA 3UV6A 1XUQA 1E1MA 2D1RA 3TG2A 5CX1B 2KG7A 3CCVF 4KLZA 2ZAGA 4XZ3A 2CJPA 3QE0A 4QPZA 1QYXA 3FUCA 4X62O 2XQIA 1U1FA 4X1IB 5CEJA 3NHKA 5LBTA 3AFHA 3LSSA 5EMNA 4C06A 1UFIA 4M2LA 3B6KA 4J9UE 4BDTA 4PNPA 1QFXA 1MJGM 3TTTA 4HDOB 4Q1AA 2QR3A 4ZYWA 2IY7A 3HY6A 2FFBA 3M4ZA 3KSRA 2BMVA 1R9JA 4O4LF 4KQ6A 2PI4A 1RC1A 1PWYE 4KMOA 5P21A 1RLMA 2W0MA 2G17A 1M1UA 3T15A 3U3JA 4LXQA 1W1UA 5SZJA 2GYYA 3BCRA 4J6FA 1XF9A 3EIEA 4LOKA 3EPLA 5C46F 5HS6A 3Q8HA 3KL4A 4WNYA 2BFOA 1WQ4A 3HL4A 2C00A 2GAFA 4O5AA 4ZREA 2PXHA 3TOSA 3R0IA 3U4MA 1JEQA 5NULA 1E9AA 1PLLA 3WLIA 9MHTA 3P2YA 1Z8FA 1NOIA 1TNDA 1F2TA 5ICEA 1WZ2A 3M4XA 2AFHE 3EXFB 2R00A 1EAMA 1OFUA 4B35A 2HS0A 4FP9A 3PGVA 1ZYUA 4M6WB 4RABA 4TLMB 5GOTA 4QU8A 2YYZA 2VK4A 1UBLS 4G0NA 2M6RA 4URUR 5F1OA 5JRZA 1K7CA 3WBJA 1K3EA 3J81M 1O0BA 1US8A 2ZTUA 1XJ5A 3G6KA 3KHNA 3CTMA 3IB6A 2AOUB 1Z5GA 4P32A 4GPAA 4B0PA 1GTL1 3AWDA 3QIVA 3I9FA 4C7KA 1GYPA 3BE5A 1I08A 2P06A 1DU4A 5CLGA 3SQXA 2I33A 3WX0A 1ZXBA 5GONA 3OLXA 3CF0A 4ZIRA 2CD7A 2P8JA 1KEWA 1TI7A 5JSZB 5K3BA 2YVLA 3L8YA 2UVDA 3BGIA 2VGNA 5CXQA 4KFMA 2NZYA 4DV0O 3BL8A 1WLEA 2E6KA 5AUOB 1T4CB 2HTFA 3H4VA 4RS4A 2AA3A 3T7TA 3ZDBA 3AEUA 3G89A 4KVZA 3RCBA 2K2QB 1NX9A 1R66A 1F60A 3V7UA 4PD4F 1BHJA 1PT6A 1ZC4A 2PPVA 3BWDD 2TMYA 4MSWC 5HKKD 1T24A 3P0IA 4HTFB 4MVJA 1K73H 4Q18A 5T67A 4ZI7F 1RPAA 5KKAA 2JRLA 2M2IA 4PQGA 5AW2A 2QR4A 1MR3F 4QXAA 3SR4A 3QBEA 3MWYW 5FADA 1RSZA 5KA6A 1W34A 4Q7EA 2BFFA 1FXKB 4FFMA 3ORQA 4WK4B 3EQ7A 5EJ2A 3V4FA 3F73A 3RKRA 2VK8A 1JR4A 3MWEA 1UP7A 1QRAA 2EX1A 1N92A 2YJ6A 2E0IA 2JGRA 3E2MA 2FH5B 3C90A 4NATA 1N8KA 3DFKA 3PQCA 1Y1RA 4LJ5A 4KN8A 4G0XA 2R7LA 1U0GA 5LA6B 1VL5A 4EYQA 1YK0A 3QV2A 4JI6O 2E48A 1QVRA 2JFQA 4GCZA 3UK7A 1E2UA 5C35A 5CLJA 4N21A 4MS4B 2ZRDA 3W8FA 4GBMA 2HJRA 3SR3A 4MICA 4TZ6A 3PL1A 5EXDA 2AN1A 5DEIA 3DPIA 4W99A 4K9PA 5BNWA 3ZI4A 2N04A 1KTVA 1NJ8A 4AD8A 1XXHE 3Q11A 3I9V6 5KNBH 1Y4UA 2IRWA 1NBEA 4BCDA 2OGWA 5DM6V 3AF2A 4OYHA 4LDNA 1GRRA 5BY2A 4KL8S 3DVRX 4V1CA 1SXGA 1NNI1 2P6NA 4G86A 1E0KA 4FGJA 2D0DA 1M93A 4X84A 4EUKA 1VSVA 3S27A 2R9RB 2OCXA 4AI6A 3I92A 3W7XA 3FWYA 1WL8A 1U2QA 1JHYA 4RD4A 4O08A 1CS0A 2JIPA 1AZLA 2QROA 5E79Z 3HDYA 1CZKA 4J0KA 1KI2A 2VYND 3DAYA 2C4VA 3ZD6A 4LOJA 2LBPA 3TE7A 4ZHVA 4JGIA 1QLJA 3GVHA 2Q4PA 3FNBA 5JCOA 4P83A 2J0QA 1P2SA 1T2NA 2EQ5A 3IDQA 1JDNA 3T06B 1H23A 4RK0A 3L41A 1BXGB 3UTCA 1JAHA 2DPHA 1GPBA 1Q6ZA 1E2LA 3ZZNA 2KKWA 3FB5C 1HT1E 4PR3A 5KS2A 2VAMA 1K8AH 3U3XA 2XD9A 4KWIA 3IKJA 3EXAA 2XCRB 3RTBA 5IKOA 2OHOA 4ZAFA 4IHJA 1RZRA 2VDLB 2R1TA 3KQLA 1CP2A 4L9RA 3WLAA 4JP5A 3K71B 4A8TA 1J1ZA 1XYVA 1VQ7F 3NBMA 1X7PA 1EDZA 3HB4X 1G20B 3FYUB 5DNWA 3SYAA 3DE7X 1AGYA 1Q82H 1TU4A 4BHTA 1U0RA 4BN0A 1RQRA 1CWUA 3D6HA 2ASEA 5EE0A 2IEBA 4U2FA 3EXG1 1QXSA 2RHHA 1Z0ZA 4OHBA 1H2MA 1W581 2FK7A 1R27A 5ER9A 4RDCA 3AUYA 1RC8A 3Q8LA 2R1UA 4WCFC 3BCUA 3TQIA 3B13B 4FNGA 1SUSA 2GZ3A 1CUAA 2ZIGA 1Y76B 4OXIA 3FWHA 3D6MA 4WFFA 1G8KA 2RI0A 4UUMA 2Z4RA 2GTPA 1Z6PA 2Z5LA 1RXVA 2AZ0A 4KQFA 4C0LA 1E92A 2GAOA 1F8UA 3UOWA 3U9LA 4OY3A 3M8KA 1Y9AA 1Q1NA 3I23A 4J7KA 3RLFA 2W6MA 3EASA 2I4NA 3ROQA 3RFRA 3CA8A 1K33A 1Z6GA 2Q0HA 3CE6A 1WRBA 1GNLA 1YCIA 4JXKA 4EPWA 2QIPA 2YWRA 5HZHA 1NUAA 3TGPA 4NNOA 1YD7A 5C52B 1VA4A 4DM4A 4LYYA 5TQ2B 3OICA 4JZ2A 4MI9A 2O5RA 2IOFA 2W2QA 4L4XA 1Q0PA 3SPXA 4M76B 4TLLB 3FUVA 4MGHA 2OD2A 4L0DA 1FJGO 4MVJG 3ORRA 2GN1A 1JSLA 1Q7BA 4NFYA 3MCAB 3T9FA 3BHIA 3I2GA 4P81A 3NHJA 4U7TB 4TLAA 4XCXA 1V71A 3B51X 4B79A 2DQZA 4BTEA 1O77A 4GGOA 1SK9A 2B1RA 3ZQUA 4YRJA 3DB2A 3UICA 3C8HA 1RWOA 1YU9A 2YXHA 3N75A 1N1MA 1J07A 4L8WB 3T0FA 4JUDX 5EUMA 4DDMA 4NMXB 1JHOA 1GAQA 4LF9B 3I37X 4QKQA 3HR7A 3AM4A 4RIHA 5LJLA 4DW1A 3Q3JB 3T80A 2QKYA 4FMCF 3TXXA 3C1OA 2W6OA 1V47A 1V9CA 1OZGA 1C9NA 3CXCU 4RNDB 1P6UA 1C30A 1OVMA 2CHEA 1CRQA 3GWGA 4WKGA 2D62A 3K96A 3GV0A 3O8OA 4PQEA 3MW8A 1A50B 2WF8A 4E7PA 5A5FA 3C4JA 3WKCA 2D5CA 5GJCA 1GITA 4OP2A 2HWXA 4D7TA 4Y98A 3AVQA 3EGEA 3GB7C 2W4QA 1VP7A 2FWJA 5HCNA 4XGKA 4ZWNA 2WHQA 4U00A 3QGMA 3FZQA 4AICA 4Z7NB 2NZUG 2PL9A 1VFNA 1SUFA 3VU9A 4N9WA 4BWFB 3H7AA 3U7QB 3JQBA 3W7VA 1GZDA 4IQ8A 1PS9A 2N05A 3A0UA 3TQSA 1JBEA 3LE8A 3V8VA 4ZT4A 1CCWA 4A0RA 5DHQA 1ZIYA 3CJHA 2IZ7A 1J7KA 1B0PA 1Q7EA 1G59A 2AZTA 1WXFA 4CDRA 2JLXA 3CS3A 3LC7O 4HGPA 1XQYA 2Z5UA 3NYIA 1PWZA 3HWSA 2NVWA 3LDTA 3ZD7A 5FBWB 3U4DA 2D8AA 4BT4A 5A9RA 5LXTA 1GGMA 3UV7A 3VTFA 4HSGA 3PUVA 2PMBA 2HVKC 4RCYA 4O4IA 4WJKB 1XNQB 4LSZA 3UPTA 4FB4A 2H06A 2Q5OA 4NKRA 3M6UA 3THXB 2OKCA 1G8MA 1TJNA 1HT0A 2ZT6A 2HF9A 1JMKC 1PVVA 3E81A 1SZJG 1N1DA 4MKZA 3ZY4A 3FYSA 3JY6A 5DRTA 2QMQA 2X7RB 1OTYA 1OJLA 4KW7A 3CONA 4EPVA 3QO7A 1KMMA 3L7LA 1WKCA 2D74A 1OAPA 5DHRA 4H3KB 1NXVA 2JHFA 3WSWA 1K5HA 2VYFA 1GG5A 1UEJA 2ORIA 3UO8B 4U9HS 2VJPA 4F2GA 3LJKA 4MLPA 3E2IA 4DCNA 4YH1A 2WSSA 3EODA 4LK3A 4TSFA 4UVEA 4D0GA 3CCMF 4U9IS 3N59A 4DSUA 5LP6B 3TUJC 2C83A 1LH0A 1SKVA 1TM4E 7GPBA 4RDIA 4C4AA 3I8SA 1XEXA 3WI7A 1XLWA 4UOEA 1LNZA 5K0NA 4JYCA 2I6XA 1DI0A 1J2UA 2I03A 4RHXA 2QLLA 5ALGA 3D54A 3D1JA 4MMZB 4D0NA 2ZPTX 1PSZA 2IZOA 8ABPA 5DN6D 4UZEA 4G0UA 2PDAA 2JANA 3IKVA 4AG6A 1AKEA 1K4KA 1K98A 3FVTA 4OQPA 1AUXA 1EVLA 1IHYA 4R7ZA 2Y1WA 1D2EA 1LFAA 2H9IA 3E8GA 3LX6A 5FJIA 3RSZA 1Q3EA 4HGRA 1X70A 1WMDA 1NFRA 4U39A 2DMXA 3QMMA 1AP5A 3LO8A 4FSHA 1A76A 1HOXA 4IYRA 1PU2A 1ESEA 3KYCA 4TQFA 1PNVA 3CUSA 5JXJA 3OESA 2VAPA 2RB4A 2UU9O 4ZFNA 4HH4A 1ZINA 2PLRA 5ESWA 1MGPA 1IIRA 1GUAA 1G5FA 2Q8PA 1DO2A 1QVAA 4TKLA 3W2GA 4NLLA 1NJ5A 5EMMA 3CPJB 3I76A 5A5VA 2Q50A 4QA9A 1Z5WA 5JO9A 5KHIA 3OCCA 4BYMA 2YHBA 3J81N 3OC6A 3OQPA 3BXHA 3WJ1A 1Z68A 1WCIB 5TQVA 3K8ZA 3DO5A 4IDHA 3KB1A 4OSPA 2II6A 4BP1A 2ZWVA 4GZLA 1SXJD 4NIMA 3KV3O 2I4LA 5M3BA 2H8GA 2KM1A 5CHYA 1I3LA 3U26A 2ZIWB 2H8KA 1Q92A 3WWEA 3GOHA 1NZ6A 1VI5A 1E2GA 5IDJA 2Z01A 5HCIA 2VHCA 3P3PA 4TMVA 2WDPA 5T5QA 4FLVA 1R0CA 4KR6A 3WIVA 1JR6A 1QKIA 4YCBA 2DSTA 2UXCB 1QMGA 1RSOA 3Q1LA 1U9ZA 1IQUA 2I34A 1N3BA 5HXUA 4UOQA 4RZSA 3IAYA 2IZ0A 3T9AA 1ZNXA 2BSKA 4LZPA 1ESNA 3OEHG 2G72A 3EAFA 5DSTA 4JOSA 3D3KA 1NR1A 3NPMA 4XWKA 4QTXA 3NHFA 1K4CC 4HEJA 2CL7X 3F49S 3UJHA 3LUBA 4QWWA 2YMPA 2WPDA 2JEYA 2I62A 4P5PA 2VJLA 4H6VA 3ICQB 3GEBA 2X9GA 3LHFA 2YV1A 3LVQE 1SH7A 4R0NA 4GQBA 1MW8X 4GP6A 3B2EE 1SXQA 1QM5A 2A3QA 1GR1A 1I2MA 4JAUA 5CA3A 2PZFA 3HYLA 3PC8A 1JFTA 1F48A 4CS2A 1X1SA 4RUFA 5FA8A 4BFZA 3BFRA 1FU8A 4M99A 4LE0A 1QHHB 1P7BA 3BEDA 1ZMOA 3IUNA 2A0LA 2PHNA 1T6ZA 1A32A 4N48A 5B3JA 4FN4A 3OZCA 4IG9A 1YVWA 4MTXA 1PQPA 2ZIXA 3RG2A 3DGEA 2O2EA 1ZJ5A 1JYFA 2PZEA 3JQFA 5FFNA 2LKCA 1XV5A 1NS1A 4DLWA 4OO3A 1OWNA 2XSZA 5A2QM 4J42A 2YZ7A 3PFIA 2FRDA 1LVGA 4W8HA 3VR3D 3HJGA 5JHGB 4CR7A 4P3KA 1E3TA 1R6VA 4QBFA 4UC0A 5EP2A 3QOFA 1TMKA 5CA1B 3N0XA 1WAMA 2WSSG 4MRRA 3W8RA 2WVHA 1HE2A 4YLGA 5D01A 2QI9F 3BIJA 5KTPA 2H3OA 4TV9A 4LQDA 3ZJVA 1XTIA 4XM1A 4LYGA 4HWRA 1UFVA 2IHJA 1S9DA 3UHFA 2WVAA 1C1XA 3I56V 1M90H 4U2CA 4KQKA 1PZFA 4C30A 3VV3A 1F2DA 3WWYA 3INRA 3H3JA 2QTOA 1II8A 1MC4A 2P3OA 4JF3A 1YWGO 2WOJA 4FYJA 2FFQA 1SUEA 1R18A 2X6RA 1WVIA 2Z95A 1L5ZA 4N41A 3RBZA 4Q93A 1CRWG 2J85A 1JIXA 3OURA 3RYFB 1CP3A 5EIBC 2XT0A 3WYDA 4FMBB 4PYLA 2ZM6B 5BQ3A 5IHXA 3QLUC 4V0ME 1RE1A 4KLAA 5L3FA 1E1LA 2E18A 2X3UA 3AMVA 4QFBA 2O5VA 1VQLF 2ZB4A 4MWTA 2W6ZA 2HCTA 1RHQA 4GC9A 3ZE0B 4UVGA 4JI7B 4GZRB 4BW9A 2WFMA 4AJEA 1V7CA 5DDIP 2CEKA 3SSOA 3ILYA 5JVDA 2AZ2A 4DCOA 1N0HA 1KYQA 4J49A 2L26A 4TQUS 4JDUA 1D4OA 3TLBA 4KAXA 2HYIC 3LSYA 3OZEA 4MYDA 4I9QA 5JSHA 3V8BA 2OGUA 4W82A 3SM9A 5KNBD 3RG8A 3D6UA 2JNWA 2FMFA 2A59A 1RYMA 3UT5A 1MA1A 3K9BA 4EZIA 1HKUA 4I9GA 4YMHA 4XVUA 2IIBA 4UM5A 5K8LA 4AHCA 4IM7A 3KZ1E 5LBUA 2VFAA 1NMUB 4LPKA 3GTZA 3RFVA 3FVVA 3Q8MA 3IQWA 5T4EA 2FWMX 1Z8HA 2C9YA 4X3CA 3AP1A 2O1XA 4I1YA 1IWBB 3DDUA 3GNSA 2A58A 5ED0A 5SICE 4HGOA 1KIAA 4MQFA 2OFWA 4Q3OA 1AO3A 4RV4A 3N53A 4G5XA 5DK6A 1YZUA 1U9YA 5AW5A 2PX8A 2HLPA 4CM1A 4RDXA 5KCZA 2IHZA 4UCRA 3I72A 1R6AA 4POOA 2EBHX 4K8RB 3HP7A 2HF8A 4D9IA 3CLUD 5IP5A 2BY4A 3NEAA 2UYOA 4NJOA 1EFHA 3AVTA 5K1XA 1XL6A 1OCCB 1JLHA 4QICA 3K12A 1X77A 3VNRA 5KHAA 1N9KA 2ARHA 4BFWA 3SHOA 2ERCA 4N6GA 2HV8A 1U99A 2WPDG 3DC5A 1J00A 1ANKA 3FZEA 1QNFA 1FQWA 2Y4OA 5IVKA 3BPSA 3F6EX 3B1VA 3AI7A 2WJPA 1L5OA 3G1UA 3ZDEA 2ZE6A 1P72A 3IPXA 1VMKA 1N34O 1BCRB 1H8HD 4IRMA 3HZRA 1E5XA 1Y5RA 5KQRA 1JSXA 1K3FA 5AKYA 5J63A 1OC2A 1KKUA 1ZLYA 2DJVA 1GKIA 5C1PA 4YJFB 3IKMB 1BDHA 3KAPA 3DV0B 5DX0A 4JD5A 5FLYA 1XD2B 1ODLA 5JASA 4KQMA 5IZ4A 1TAHA 1BGYH 5L6MB 4EG4A 2XRFA 4GHWA 3MJFA 4ZI3A 2RGGA 4J03A 1HLPA 2ZRHA 1HNZO 1GGNA 2C2KA 5J9PC 5B58C 3IURA 4P4LA 4ZICA 5FORA 3HJFA 1XZGA 3LYBA 3LOUA 1E1YA 3OLWA 1R88A 4PPFA 1EFLA 3ZWYA 2PCJA 3K8YA 3OJWA 2VWHA 1OU0A 3NBFA 5ADVA 2ODQA 2FP3A 1DBQA 2BPOA 5BY1A 2CKDA 5JAIA 3EXHC 2QJFA 4PNZA 2IOQA 5T3YA 2ZRLA 1HXHA 3FVRA 4FJCC 2YV3A 3EOZA 5KNLA 1DUIA 2RAUA 4X64O 2JIDA 1DZIA 3WWPA 1AI6A 5C81A 1XEWY 1WSAA 1E79A 2PUSA 3T0GA 1T9CA 3ESZA 2YUAA 2KS6A 1AUOA 3ELWA 2BGRA 1TZBA 1B8VA 4J7AA 2R11A 2LW1A 4XGIA 5DIZA 1V16A 3IMEA 2J46A 4OLJA 1AGPA 4Z5XA 3GLGE 1JIQA 2LE0A 3CKYA 3ZWMA 3AFMA 2BI8A 1ZSVA 4WGGA 3L7OA 2PQ6A 1Z39A 2HHAA 1OA0A 4UAVA 3H6KA 1Z3CA 2GH1A 2ZNJA 2REBA 4DTIA 3S5JA 3DE3X 3UJNA 3BPZA 5KYGA 4GZ5A 3IEIA 2JAXA 5ILOA 1QQBA 4BT3A 2AQHA 5K0ZA 3WFJA 3EC2A 4C4YA 1DQYA 4CCWA 5H80A 4JQSA 4P3OA 2JFGA 2NO4A 1HEIA 1D5NA 2GJSA 2B9VA 5JQGF 4J07A 1FLNA 2APJA 2IXTA 5JSZA 1OWLA 3C3MA 3W5SA 1YQTA 3R3WA 2C9MA 4FGLA 1FEZA 2VUTA 3UWPA 3BMNA 2RBEA 3ZIDA 2D2IA 3ZWWA 2Q4OA 4HXGA 4W4KA 1T4CA 3ANLA 4LF5O 1PX2A 3DBLA 3AZPA 3WB1A 5KOHB 1ONNA 5LN1A 4FEEA 1Z0IA 1NG9A 1BFUA 1RD4A 4M3NA 1EVEA 1UKBA 3EXEA 2DVMA 5IM4F 1NMEA 2XWQA 3Q7QA 4HTFA 4DBLE 2BTOA 2XV1A 3FHJA 5DZSA 3F0DA 4ZKIA 2HCBA 1Z2PX 4OBXA 4D4HA 4C87A 2DTXA 5AP9A 3TEFA 2X8BA 2JGLA 4BNWA 1OWMA 3KSDO 3JAMN 1GGKA 4KNWA 5DBOA 3HQ4O 4FHCA 1KKDA 2OCGA 3U4IA 4JP3A 2XDWA 4E6PA 1YVPA 4GZ3A 5J2TF 1RNLA 4XVHA 3SEFA 5EXSA 4OHRA 1EBBA 3RT7A 3RWRD 1GXSA 1W0JA 2ZS7A 2P65A 4PQRA 4RO2A 3UHPA 3H3XA 1CDZA 3QMVA 4FOSA 3PPYA 3R9IA 3TLXA 4PTYA 5KAMA 1YMQA 3GLSA 1EWYA 3ZV3A 4F4JA 2CDAA 4HAVA 4K9RA 2A1TR 4BIMA 1T0PA 1M2OB 2A7WA 4AB1A 4TWKA 3AXTA 2JAOA 4Z4GA 3PU6A 3H2BA 4MUEA 3Q8WA 2VUUA 3ZG6A 3EIFA 1DNPA 1IN8A 3GFRA 2HIGA 4CUZA 3AKYA 2GHTA 2PUVA 5J1SB 3HA5A 1J2YA 1FFXB 3S55A 3V2IA 1A9QA 4IIFA 1UM9B 5TMBA 4YRRA 1F9AA 3DJFA 5CNMA 4BMZA 1BMFD 1YQXA 4QNMA 4DMHA 3L49A 5JBNA 2YYYA 2G1UA 4ZU6X 1CBUA 2BW0A 4PELA 3ZDCA 1VBNA 2HXYA 2J8ZA 3GOQA 3DE6X 4Y7DA 2UUOA 5KYYB 4PANA 5EKTA 4CODB 1QTQA 1E3WA 1P0FA 4OM8A 1R5BA 3BREA 4FHEA 2PRYA 3HZZA 4EFLA 4P30A 2POCA 2YBDA 1NJIW 3GP8A 2EGUA 2NNWB 1QH1B 1MOQA 1R0SA 3LUGA 3VYUC 1LPMA 4QBTA 3SSMA 1T8PA 4DSAA 3UMGA 3AB8A 2C9ZA 2NOAA 1GH6A 3GHZA 2F9MA 1YKSA 1RFLA 1X7ZA 5A3JA 3IV6A 3JQPA 4U9UA 4M7OA 1A7KA 3T99A 4P4SA 1R0WA 1VKJA 4PO9A 3ESXA 1D2CA 2IKQA 4QDXA 1I24A 2W6IA 3NPAA 2R72A 2XMRA 3QWIA 4CMAA 4BJ3A 1QQAA 4B5KA 3FI0A 1S2DA 4M0KA 1NYQA 4I9FA 3HBLA 2BFDA 2HIAA 3LUFA 1QTIA 5TDHA 1VLQA 2D3TA 3EWNA 1ZGAA 1F4LA 2WI8A 1H6CA 3GFGA 4CCSA 4MV0A 2EP7A 4A2WA 4RAOA 2NXCA 4B7EA 2AD5A 3MG9A 5EMKA 3IAFA 3KFLA 2ODEA 4AF8A 2GSMB 1A2BA 2FB5A 3ND9A 3SHQA 3QFRA 2DHCA 3EUAA 1Z5PA 1SGWA 1EWKA 3QSYA 2QXYA 3CS5A 5EXXA 4QULA 4KB5A 1AB6A 1A2QA 4BN4A 1YQQA 1ZI6A 2B1GA 2HLHA 4KXXA 4II3A 3M4SA 3LWPC 3RHZA 3ZLTA 1B00A 1MXHA 2V58A 3OIWA 2OK8A 3P32A 1JD1A 3WP0A 4D8VA 3GJ7A 1JHZA 1LJUA 2Y0EA 1ZR4A 1Z5ZA 2N0SA 5AH0A 4H44B 1HNXO 4MKGA 1S7CA 1IHOA 1G8FA 1KRHA 5AVMA 2BAGA 1P7GA 3OLCX 2XCUA 4QHSA 3UAVA 1KJJA 1EFVB 3H6HA 2G5TA 3PWSA 3CZMA 3DO8A 4X8AA 1E4EA 1YI2F 3LHIA 1IBMO 4HQ0A 4RUKA 1K08A 2IXDA 1B06A 1AKNA 4RLHA 1E89A 4NZMA 1D2HA 3ZHYA 1BXKA 3B7GA 1YIJF 2JGNA 2ZE5A 5D51S 3MDSA 1VLJA 2JLSA 2ZAMA 4NF2A 3C3AA 4B9EA 4LZJA 2PUDA 2J9FB 1DDGA 3GIWA 3TLCA 5LQUA 7MHTA 5A3QA 2GEUA 1QKJA 3BIWA 1R4NA 4HS4A 4F8YA 4I4TB 4B83A 5F2NA 3RQSA 4J0HA 1W0JG 3H9UA 5FPKA 1CUJA 1YA4A 3O1HB 1NGSA 2GPYA 1NNEA 5MN6A 2Q8QA 4X66O 4G1CA 3UK6A 2QAIA 2Z2ZA 3IMFA 4PCAA 3NVAA 1D7AA 2V7BA 2BISA 2HD4A 3JR7A 3RW9A 1PJBA 4Z0HO 5IKMA 3ORHA 1N4CA 4UCQA 4PG7A 5FWXA 5FT9A 2MSWA 3WDLA 5FF9A 4YRZA 2VDMB 1OBOA 4JKOA 4XX0A 2HRZA 4J1NA 1JKIA 3KVNA 4CC6A 1Z73A 4YP6A 3B1FA 3CW2A 4H33A 3GRRA 4UD2A 2ZWPA 4W1PA 5EWMB 3TFQA 2V6JA 2IBTA 4K6KA 5A9TA 1H5UA 2FPGB 3KQKA 4KL1A 2MT9A 1Z12A 3MLAA 1XDCA 4D3ZA 3CX6A 1YDEA 2DQYA 3RIMA 3HPLC 2BEUA 2GN8A 2VYVD 1M83A 4RZHA 5LYJF 4PC7A 4D3SA 3SK0A 4OHYA 1G66A 4EMBA 3P0FA 4ZVLA 2IV7A 2QN2A 1KJWA 3ZYZA 4DYVA 1NKVA 3LUPA 4DV7O 2ZDGA 2QKCA 1E5DA 2O7SA 3CPHA 4HEHA 4R1TA 4X61A 4QUDA 4I0XB 1L5YA 1VFPA 5JZMA 4TT8A 3W79A 3FRJA 1RQ7A 2H29A 2IS2A 1A72A 2V7XA 5FLEX 5AW7A 4HWTA 2IV2X 3PRYA 3O3MB 1R3DA 2CNOA 3A25A 4A03A 3PQFA 1W4LA 3FPSA 3HEAA 3TLAA 2W6IG 1G9TA 5D00A 1FDUA 2JFXA 3JYHA 2EBFX 2J1LA 3DDCA 3R6LA 4GDMA 1SIBE 3I12A 1ZJWA 2AG1A 4BO0A 1GCAA 1UPBA 4ASUA 4F45A 4OATA 4DIUA 2J5BA 2AJLI 3NWPA 4MR8B 4DRXB 3GHHA 2WKQA 3FYTA 2FPIB 2WE7A 4CTMA 4R84A 2W58A 4BMSA 1D07A 2DUJA 3VZDA 1E0JA 1JG4A 3EW9A 2H63A 1Q0TA 3RS0A 1NXQA 2C84A 3EZ2A 3C3JA 4ZO7A 1JY8A 1MOPA 4YXWA 4QXQA 3V48A 5HY0A 4HYOA 3ZJYA 1RHKA 4Q1VA 3SEQA 5BSVA 1WUHS 3PC8C 4U2DA 2BM1A 3S2FA 5LHGA 1ABBA 4Q20A 4RHCA 1P1IA 3STXA 1IBSA 1O95D 2GTHA 3DPSA 2H1WA 2XNJA 4YGYA 2PYJA 4UDYX 4PU0A 4EM6A 4QL3A 4QIWF 2PT6A 3JQFC 1DDIA 4BP3A 1KEEA 4UHKA 3CRNA 2ILVA 4DUGA 1E1DA 4LMBA 1K7FB 3GZJA 4PHZA 4PLGA 3RC2A 2FF7A 1CX9B 5G2OA 3AR9A 4AILC 3WYBA 4KQWA 1ZK4A 4FHZA 3MS7A 2PJDA 3BDAA 3VSBA 1NQ3A 4BO7A 3LM8A 3UG6A 1XU7A 1M57B 3QU2A 1C4XA 4PRZA 4RV5A 5BOVA 3LWZA 1A69A 2ONYA 4GS5A 2QUIA 1EK0A 4GPIB 2IEAA 4GKKB 1VSQA 4EUHA 1KE1A 5CB8A 4K8OA 1H2HA 1RLOA 1J8MF 3UATA 2VRWA 3A2FA 2OT3B 3WGNA 1YB7A 3ZN1A 3A28A 4JVOA 2QU7A 3LW7A 2BMEA 3S5UA 2GZDA 3NAGA 4LGVA 1J99A 2OMEA 4A1OA 3GC6A 2I80A 1MB9A 3ICWA 1R0YA 2C5FA 1L5LA 3ENVA 2BVNA 1TO6A 5ED4A 4ACAA 4IDQA 5EC2C 4E1AA 1X0XA 4CM5A 2RH9B 2X0NA 4I55A 2JJ2D 3RBVA 1OLOA 3WGVA 1CVLA 3QPAA 1PK8A 5LHIA 2NZWA 4YN3A 5KYXB 2W8BB 4E5NA 2UUBB 1A9YA 3H4TA 3VKVA 2PT9A 2IHKA 5BNFA 1OHHA 2QJTA 2QVZX 3GMSA 4TRNA 2WA4A 4JJ6A 4OK6A 3RJTA 4E2WA 4DJFC 1C4WA 2AN3A 3DTTA 3M2TA 2IXBA 4D9GA 1LRJA 1J5EO 3UENA 2A14A 3LRPA 2C59A 3HJNA 2QM0A 4WUVA 2ZXUA 4EGJA 1YQWA 3RYTC 3PR1A 4D41A 4CIYA 2R48A 5C5IA 1DWQA 1TOAA 5FAXA 1YVDA 1Q1GA 5LZ7A 3LNNA 1O9HA 1LDEA 4BY9D 4JX8A 1Z5UA 3ZHUA 1TTPB 4XLLA 3OTOB 3QLUA 3BAFA 4BFYA 1QIGA 3SEAA 5C37A 3AJRA 1ONSA 5IUJC 4XB2A 3MYYA 4CLDA 2J3DA 2OGZA 3D81A 3NNDA 3DTUB 3PTAA 4JK3A 1VJCA 4ARAA 1NVVR 4BOYA 2Q4TA 5BQFA 2P9GA 2LGJA 4HK4A 1H48A 1M56B 2YX1A 1S01A 3NHAA 2P40A 2GZMA 3CG6A 3FETA 4FEYA 1SBHA 4WY5A 1JR3E 4JI3B 2FEAA 2ACVA 4UBNA 3N2EA 3K0KA 1DC8A 3A1DA 5FULA 4HXEB 2Q6LA 4H3SA 1QHGA 1VQMF 2C2ZA 4KR7A 2IXEA 1XTRA 1H9BA 2C1EA 1UPCA 5G3ZA 1YJAA 4BIIA 4LHEA 4BNKA 1M6EX 5BO5A 4HLCA 4ASUG 3D3WA 1CYDA 4G9EA 2Y4TA 3SZ3A 4D80A 1AE1A 2Q3LA 3EXG2 1HGXA 2ANBA 3K04A 2XAJA 4LECA 5BXZA 2PCLA 5DYTA 3COVA 4Y1RB 4NBKA 1YB4A 3ETLA 3EZGA 3DLBA 1KO7A 2MYUA 2JAPA 1N1GA 3AY0A 1FPOA 5I7HA 3L0YA 4XA8A 2WQ6A 1KMHB 4GMGA 4WY8A 1L4BA 1PL7A 3WADA 2GFQA 4LRSB 4YXWG 3OKCA 3IE0A 3GZ4A 2W8BC 4UPEA 5JLJA 1G16A 4HCJA 1JB9A 4C2AA 3AUJB 1DJNA 4JELA 1U6JA 4I08A 2QQFA 3W9YA 1TT5B 3Q7TA 2A8YA 4QQFA 3CJTA 4XARA 1LC3A 1P5JA 3RVJA 3EC7A 2XNDA 1A4XA 2R6ZA 1QDUA 5CM8B 1TU3A 4RF4A 2B99A 4G0PA 5IX8A 2R2GA 1V8PA 5HJ5A 3NDIA 1BJKA 5GAJA 1NZFA 4P80A 2PWBA 5JS1A 1E3DA 1BKSB 5CTJA 1GADO 2I7VA 2RGUA 3L6CA 4YNBA 3UB4A 4EG6A 3B9RA 4IGGA 4FFSA 2CV2A 5COQA 4N12A 3P9NA 4N49A 1Z4KA 3MTAA 3P2IA 4FKZA 3VSEA 3WLRA 1NONA 5FPOA 3OSZA 2HZBA 1ULHA 2QG4A 3PEEA 5J40A 2YICA 4LYDA 3NMUC 5G53C 3AYZB 3V1YA 1RCTE 1G17A 2XPCA 4PC3A 1E4VA 1CRZA 3NHBA 4M53A 4ZVOA 1NSTA 1YNSA 2O48X 3PDIA 3M0EA 2GZHA 1G55A 2ZJ7A 4BO3A 4J80A 4LK2A 4YAEA 1EUZA 1YJ5A 5MDHA 3NBAA 4L3OA 3GPDG 4FC7A 4KVGA 3HXMA 2FPUA 3LY5A 2JK1A 4GFDA 4Q37A 3A26A 3M84A 3W1VA 1H65A 4UJ5A 2ZI6A 4ZAYA 2NU7B 1VHTA 4Z7QB 4EJ0A 4AC9A 3HACA 1L4NA 3HN2A 4UE3S 3D1VA 3K0AA 4BBAA 3DJYA 1JPUA 2VZEA 5FTMA 5CLIA 4WOJA 1W4CA 5CB4F 1TIKA 2UYNA 3PGA1 3OE4A 1J1UA 3SJAC 1JFLA 1NJ2A 2XQVA 3MFQA 3FHTA 4UM7A 4RJJA 3UTDA 5CYPA 3Q5GA 4YPOA 1KQNA 4EB8A 1HQYE 1Q0QA 3DGFC 1OHHG 3PVZA 4UVDA 3JSNA 4ZVVA 3EXHA 3G82C 3I55F 2FYUH 1KZGB 2HWKA 4X1YA 2VS1A 1YQDA 1JILA 2GD0A 1V95A 2LW7A 1TGYA 3J7AU 3ETCA 3RT9A 3BMQB 1C7EA 2I3DA 2XAQA 1AN0A 1Y9JA 2QVGA 2YXDA 3O3CA 4HYQA 1JQAA 1JT9A 2R85A 2EULA 3W5IA 2PGNA 1NRIA 1IAQA 3O4GA 1VPDA 5DASA 4MUJA 2C07A 2OBFA 1H4TA 5HQ3A 3ZCPA 5EB1B 4HFJA 1WV0A 5L45A 1IONA 4H0FA 1NN0A 3TTUA 4LAFA 1YASA 4JBGA 1VQ6V 1UBTS 2IELA 3HJBA 1PD1A 2GPSA 4F5DA 1XBIA 3AVOA 2J6HA 2ZB2A 5HM8A 4L4ZA 3QOWA 2FWIA 4TUYA 3HB5X 3P5BA 1PQWA 2A0YA 2NV2B 3LDAA 1MBZA 1A4IA 1G5QA 3HCOA 4FD2A 3CC7V 3KXIA 2H18A 1ZMRA 3ORSA 2V7PA 1BG6A 1P9RA 4EX7A 1TUEB 5ELMA 1SBNE 2WMYA 3H18A 1FXKC 4DV5O 1QIHA 1B0UA 2R68A 1GKYA 5HWSA 1D2AA 5I7EA 2P3QA 4B87A 4OX9B 5JECA 4KDCA 3FX2A 3TNFA 3OBYA 3B1JA 3EMKA 3DLAA 1EX7A 1SQGA 3Q3EA 4PTZA 2R8ZA 4FB5A 4Q9HA 2QRKA 1U7DA 2FZKA 1ZJYA 1NPYA 1LTHR 3JSAA 3N4YA 1NZDA 5EJIA 2R6JA 3IMKA 1QNMA 2GZ2A 2QSAA 3OAAD 4ENWA 1BGXT 5IAOA 1EFUA 4QJBA 2EYUA 1R0BA 3FWZA 2G80A 4AS3A 2PGDA 1OLXB 1T8RA 3L93A 2VYCA 4YRAA 1F23A 2OYRA 1XV2A 5AJXA 4N82A 5ALWA 2XNDG 4CLXA 2I6GA 3JZDA 4CEIA 3ZV6A 4ZZIA 3U5TA 3MRXA 2OHFA 1KBQA 1FMJA 2NSYA 2YXNA 3GJXC 5HR5A 3DMTC 3GVPA 3T4XA 3X1XA 3CNBA 4L5BA 1N7JA 3BGVA 4PM4A 1RAHA 3VUEA 1XHFA 1Y6QA 1FU7A 3IDFA 2R5FA 1W36B 3LPLA 2QLFA 1FS0G 2GF2A 1JFRA 2QXUA 1OKKD 5JROA 3KUDA 2ZSBA 3WMWA 2CNLA 1FTGA 5AK4A 3TLGB 4EG3A 1Q17A 3ZE9A 4D26A 3TRKA 3IEUA 3BWCA 2EBWA 4RKFA 1U8EA 4IFEA 4NDAA 3HY3A 1MHPA 4BLPA 2R3SA 3SMQA 1HNWO 2PH5A 2CFOA 3AW8A 1SESA 1X86B 4FVTA 4ES6A 3QBVA 5BNTA 2D5IA 1U81A 3M1YA 2IAFA 3NBXX 4C6HA 2CH7B 3U7HB 4LFCO 3AFOA 2QWRB 3E22B 4UJ3A 5LR6A 1S6YA 2WJ4A 3NM6B 2DBZA 3NI2A 4CLHA 4JI1B 3EBLA 4QYWA 3OEEA 4DZTA 2YDXA 3G5TA 4TMWA 3H04A 3M7MX 1XZLA 3FYUC 2H6LA 2VHEA 1X2BA 3AEIA 4G4WA 4W9MC 4NZZA 4YX9A 1WOYA 1VYVA 1NR7A 3CW8X 4P4GA 5L3QA 1DT9A 1Z2DA 5BWLA 1QCDA 1GG8A 3LP8A 4PS0A 4DRYA 3PITA 5K8UA 5IWAB 2CVOA 3Q41A 2QYSA 4X8HA 2VLIA 3K5OA 4BV9A 3IELA 4GR9A 4Q6BA 4YRTA 3RU9A 3OY2A 2Q5HA 3VTAA 1UWKA 2XIJA 3ZHQA 3F7YC 2QTVA 5CLHA 3CUVA 4XDYA 1R6BX 1TFRA 3DDNA 3CUEF 3F0EA 1GSAA 1FYXA 4LF7O 5LBIA 3JARA 3OEHA 3PE3A 4BPRA 2H16A 2IOHA 1SVLA 4TROA 4MVXA 3WMFA 3H1PA 5BPHA 3L0PA 4NTZA 4RA6B 4TL8A 4XLZA 3QK7A 3V6MA 5H6QA 4LWSB 4S24A 4BO6A 2Z3WA 4BASA 4CM4B 4LJKA 3BJZA 2L42A 3G8AA 3OZIA 3UCXA 1TU0A 3LYLA 3LPDA 3DBRA 4H0NA 2A57A 2C04A 1Y9DA 2RBGA 1Z2AA 3LGSA 4U3FH 4P0QB 3JU3A 1KEUA 4OH1A 1IDOA 1X1BA 2Y1KA 4AJOA 3OHSX 3W9UA 1E3EA 1XTVA 4KLRA 2OVFA 1GSIA 1G4HA 4L9SA 1GPYA 1X52A 1PFYA 4DJTA 3RYHB 4BLSA 1RRVA 1EK1A 3GPLA 2VRCA 1XPJA 3ZU3A 4C08A 5B1YA 2QMEA 4G3XA 4KXMA 2NO0A 3IOBA 1I10A 1DIGA 4IXDA 4O4JB 1E2NA 3G0DA 4OYRA 3VJKA 3Q7EA 4YRGA 3QUTA 1I7LA 4ZMRA 4WBXC 4B32A 3KQUA 5H7XA 4Z2AA 4ZVSA 3O8CA 4NUTA 3CEHA 5CH3A 3QLVC 4JSRA 3RSQA 4OG2A 4QTZA 1NW6A 1CRLA 1Y33E 3AR4A 1NMXA 4OIFA 1O94C 2GB4A 2VF5X 3FPHA 1UMDB 2ZIVB 4CPDA 1YIOA 1TAEA 5H8WA 4XWWA 1KDVA 1AZTA 1I1OA 4PX3A 1DJPA 1VKZA 4C2UA 3L5KA 4L08A 2YCBA 2I3GA 1QPZA 4EKIA 2XE7A 3PFNA 5L7YA 1REQB 3D7NA 5E2BA 4XJXA 2Q68A 3EGCA 1K5DA 1DFHA 3JAMM 1YC2A 1C9EA 3MEQA 4ON9A 3T7JA 2B4AA 3VYSB 3CWQA 4NS4A 1UJ5A 2RG1A 4N47A 2DOKA 2XWPA 3PIDA 3FD6A 1H42A 3NETA 4J0GA 3MBOA 1P1FA 1YI8A 1QONA 1NH2D 3T2MA 2VOEA 2UV8A 2F93B 3A9VA 2EF1A 4X95A 3R0JA 5T4BA 3PX7A 4I4CA 3RABA 5DT9A 4C7BA 3NG1A 3MAQA 2ZYRA 4WXEA 4GKBA 1FTQA 1BW9B 2FY8A 1ICEA 1FVHA 4CI0B 1EZ1A 2XHEA 4RY9A 3ZH2A 4C01A 4HGYA 3ABRB 4KFRA 4KVAA 4D4MA 3RBXA 4ZO6A 1I9GA 4X92A 3WLHA 1DK1A 3W5HA 3OEEG 1J0CA 4BMPB 2AHRA 5ALIA 1HRDA 3WDSA 4IOJA 1SAYA 1NASA 4HAZA 5KDLA 1ULAA 3P4UA 5AQEA 1NUPA 1I4OA 3D4BA 2CYCA 4R2IA 4G84A 4EG7A 3MRVA 1DGQA 3SYCA 3I4CA 4L5AA 4QGPA 1DPGA 3OM3B 1DB3A 2DWPA 3N58A 5JZOA 4EFDA 1YULA 4HDAA 3BUSA 2A1UB 2RGAA 1J97A 3M4NA 4MT8A 2O8FB 4INOA 2FMTA 9GPBA 1TZCA 1YH3A 1N5KA 2HA0A 1HK7A 1RZVA 2QT1A 5LP6C 3GXBA 3UV3A 4ALIA 4QO7A 2I6RA 4Q1EA 4Z8YA 3IEWA 4B71A 1LV8A 5KTMA 5L3DA 3GT3A 4PICA 2QNRA 1HQDA 3KT6A 4WI1A 5EPEA 1X8JA 1K7XB 3LFUA 1R9MA 1OASA 4UCOA 4IY1A 3VVBA 1A8QA 5AVQA 4XOIA 4GPD1 2VF7A 4DEXA 2DQKA 4BFSA 1COMA 2GAJA 4ZN6A 4R50A 4J8PA 1VE1A 1SXPA 2B7CA 3ZNPA 2XASA 2WHPA 3I1YA 3R1IA 2SBTA 5EI5A 2OTLF 5BW4A 5DCWA 5AJUA 4HEA1 4C78A 2QN7A 4QLOA 3LBIA 1Y3IA 4IIJA 4N40A 3KLBA 4G0MA 3OJLA 4CQNA 2FPGA 3K1AA 5IZCC 1LSSA 3LNMB 3T1CA 2P9YA 2QY6A 2YXZA 4LQCA 4AMYA 2OO5C 3FCEA 4PZUA 3ZZUA 1ORDA 1ODSA 4BT2A 2QR5A 1EXWA 5AVSA 3OX1A 1IRXA 1J8YF 5HRAA 4JJ4A 1DMRA 1D0IA 4X6XA 1CJSA 1P2GA 1C7QA 2VZ0A 3TVYA 2V98A 4HWSA 4YJ3F 2BI4A 4PI2A 1ZVQA 2P35A 1CJKC 3JWEA 4IJ5A 4JGSA 4GMHA 3CPWU 1H38A 1N8TA 1NL3A 1D1SA 4NE7A 1SEVA 3VVLA 1Q81H 1YZTA 5CDTA 3P96A 4QGBA 4F72A 2PKQO 3R7WA 3AV0B 1QHIA 2YC0A 4JLVA 2X8JA 3G8DA 1HFKA 3W34A 2I91A 4YJGA 3LSQA 5E3HA 5F98A 1E6WA 1Q84A 2Z56A 1QS0A 1WB8A 4DIKA 2W11A 4MVJH 1GUYA 4A2QA 3S29A 3SF8A 3V1KA 3W5DA 3KJKA 3ZYCA 1T0IA 4B31A 4TLDA 5AVOA 4UXJA 4ZAWA 3COPA 3LLVA 2C2HA 3PC2A 4DHWA 4C7XA 4PF1A 3SVLA 4OTZA 2Q1SA 1Y63A 2OVBA 3OCZA 5C1OA 1LCIA 4MUFA 1J90A 3VZCA 2G83A 2IF0A 1F4MA 4EF5A 4A82A 1JJFA 4QT0A 4UM9B 2I7CA 2ADPA 4Q6WA 4N7BA 2OZBA 1QCYA 2IX3A 2Y1XA 4S0ZA 1MQ9A 3N07A 2HMTA 2X5XA 1H85A 3BXGA 2C92A 2YUIA 4PBTA 4FUQA 3TEJA 1RI2A 4CQJA 1TKCA 1GDTA 5DIFA 3URKA 3JASB 3VU8A 3TGWA 2XOEA 2JIMA 1PRYA 5A6VA 3RC8A 3IVGA 4RF3A 4HNAB 3L9WA 3RFXA 2Z9DA 3AVPA 4G0WA 4K9DA 4GOLD 1HYBA 1CSEE 2AFRA 1OTXA 2DQ4A 4LEIA 1JRLA 3RC9A 1P60A 5A4AA 3ZVMA 3IP7A 4KQ1A 2CSLA 3ND8A 5L8VA 5IARA 1X8XA 4ZARA 1ZCZA 1TGOA 5ALEA 1UC9A 1DBVO 1P7CA 2I9PA 1IPHA 4REQB 1U97A 2W7TA 1ZRHA 5ICMA 1VKNA 3IJRA 4LVOA 4PZDA 4F06A 4LZAA 1P9WA 4Q3NA 5KOIA 4EI2A 3A1WA 4L9WA 1ORTA 3JR3A 5B37A 1JVMA 4YV7A 4C0QC 2HU5A 2P75A 1SELA 5TJ9A 1PR3A 2OZPA 4LC9A 3L6UA 1OFTA 4NZYA 5IAJA 3ANXA 1RVV1 2A4MA 3TAUA 1TCVA 2JARA 2FUKA 4G67A 4Q9LA 1FXWA 2D5BA 3RJ5A 3B1ZA 2J7PD 3M6IA 4BZWA 2W8BA 3TDKA 1U3CA 1A9PA 3H97A 3T3EA 3HA7A 4HG2A 4C0JA 3C97A 4L50A 1RM5A 4FCTA 1UOEA 4OGFA 4G09A 1XC7A 4C3ZA 4EBBA 4GXNA 1YQEA 5KSYA 1UBHS 3GLFE 4E5UA 2UXDB 3L6RA 5ENDA 3GEDA 3GEIA 2XNSA 1ISFA 2F48A 4MQUA 4KR3A 1GQRA 2P9CA 2I7TA 4PLYA 1T4GA 4OA5A 4BWGA 3M6XA 1W96A 3TM4A 4LHVA 2TMKA 4TTQA 4RPLA 2NUPB 4E3ZA 2YN2A 3Q0TA 1SWVA 2ZVZA 2ACWA 2ZDIC 3L43A 4DG5A 3OZFA 2LV8A 3DXZA 5CX1A 1ZSYA 4LOIA 2ZWAA 2VWQA 2QZZA 2JGDB 3K0FB 4X1IA 2IDJA 4HEA6 3WJQA 1EVZA 3O1LA 4KRFA 2CBZA 4ZAGA 4R1UA 4XX1A 2PUFA 3AK1A 2Q46A 1WA5A 2WWFA 1KI4A 3RNOA 3DZHA 3RE3A 1J8VA 5DYWA 1NTZH 3DXXA 4OMCA 3UMRA 3NKLA 3JW8A 3AV3A 3GUUA 4BQRA 5FUXA 3EBPA 1J7JA 2ERXA 3ZGNA 2EJCA 3RT3C 3IQFA 3C3EA 4U6NA 4RTPA 2V7QD 2HHLA 1NW3A 2QJRA 2WFLB 4WOCA 2CNBA 3BB3A 3GJZA 2NT3A 1OCCC 2FE1A 2FN3A 2EZUA 1N6KA 3A9UA 4OLFA 2IJIA 4OQDA 3SJAA 1M34E 2GBLC 2OWEA 1ILWA 3HWUA 3HLYA 3FOBA 4ZQFA 1FDWA 3EXFA 4ER5A 3F7OA 4GKJB 2W6JA 3FFQA 3HVUA 1IY9A 1KMHA 1Z82A 4M6WA 3RARA 3O90A 1ST3A 2RHOA 4B3FX 2CXPA 5FOXA 3UYLA 4DL9A 5LMNO 3MMPA 5IC6A 1DAOA 1NU8A 4MV1A 4FHGA 1XK7A 3MN1A 1HTTA 4TL6A 4JKYA 4JT9A 1WU8A 2AOUA 3BTVA 1YU6A 3NH6A 1XZPA 5A3VA 6REQB 1L5HB 4CDGA 2ZUFA 2F4VB 3CZ4A 1RLTA 1FDOA 3MJ4A 2ZB3A 4UMEA 3K9HA 1SC1A 2ZBEA 1Q1BA 2VTEA 1P33A 4L8LA 4PX5A 2PSEA 3QHAA 1Y3AA 1SXJE 3DKPA 4I3FA 2P27A 4A16A 1JX6A 2P2CA 4ND1A 4PG6A 4NEHB 5IYZF 4YDRA 2GK3A 5C8DA 3U1BA 5EC1C 3JQQA 4LP8A 1ODFA 5LDDC 1U80A 4ZDJA 1TEHA 3CCRF 3N6VA 1SKYE 2BL4A 2B2CA 2V7TA 3DNFA 1YJBA 2UYYA 1QGOA 2P9QA 1W4RA 3QXGA 3PGLA 1YZKA 3GROA 2IYVA 4FBGA 5J1TB 1H47A 1NQ5A 1IK4A 2C7RA 5BV1A 3GG2A 2R79A 2HBQA 3QYJA 5K3EA 3KOYA 1FXKA 4F8EA 4Z4IA 1XMPA 3FUWA 3FPIA 4EA6A 4IXMA 3HEBA 3IX7A 5TARA 1B8NA 4C4SA 4YB8A 3OZDA 2DP4E 2PUGA 2OC9A 2I1VB 5LA6A 1C41A 3PJRA 3W77A 5H81A 1G8JA 3H8WA 4BRWA 1FTWA 3JTMA 4MS4A 3WGZA 1ZL2A 1IIBA 2C20A 2TECE 4AUMA 5BSUA 4YC7A 3NNSA 1TQ8A 3OE7D 1AI5A 3LLUA 1LTQA 1N2SA 4WXYB 2HJDA 2AZMA 1SU6A 3KSAC 3UAGA 1EFRD 3DLPX 2KLBA 2EERA 2ZSKA 4FYKA 1T0UA 3E18A 3Q4GA 3LDHA 1X92A 3RRFA 1WPXA 2IU6A 1S5LZ 3RFCA 4ZDKA 4FLYA 4LCBA 1XMQO 3BMQA 2AIRA 3F5QA 4RTKA 1KJYA 1IV1A 2WM9B 4FFLA 3DMTA 4GDFA 2YVQA 1R8JA 1SKQA 1YDXA 2C2OA 1P4SA 3OEYA 3FPGA 2IYEA 2D1YA 4V0LA 1HORA 3GVIA 1O2DA 2WABA 1BSVA 4CHGA 4M0LA 1HE1C 5FFMA 3WB0A 1JDZA 2H85A 3F8SA 1HR0B 2BGTA 3GLKA 1MFPA 2W5UA 4YONB 3LLSA 3T3HA 4QELA 3NANA 3FYCA 4DR4B 2QVYX 1SMKA 5DOZA 3K9NA 2ODPA 3B6ZA 3W4IA 5JNRA 2H94A 3T5BA 1IY1A 4D82A 2QSYA 4ENTA 3ZI0A 5D3ZA 1BXGA 2I1QA 1NJGA 3BN3A 2QW0X 4KIGA 5K2MA 5LZ4A 4RW0A 4AJIA 4CDMA 4CU5A 4Y2QA 1NN3A 2IHUA 4BU1A 4L5CA 3F4KA 4B4UA 3D43A 1Q8RA 3STLC 4AFNA 5EKUA 3UMFA 3F8WA 5G4VC 1YCHA 3CCSF 1G20A 3FYUA 4FCVA 1Z5NA 4DNPA 2GXUA 4D42A 3KUUA 3AIIA 4X88A 4LF8O 4DMKA 2R8PA 4LSWA 2W6JG 3F97A 5DNVA 3FZYA 5IF9A 5IAGA 1OV9A 1OLSB 1KF0A 3W2EA 3X1YA 1CERA 1E66A 4AKSA 3E9EA 3VO2A 2D2VA 5HXAA 3AG5A 4A15A 4OBWA 4MPRA 1CJUC 1U1IA 4RMNA 1SG6A 2FWPA 3OJFA 1Y76A 3U37A 2HQ1A 1YQUA 1T34A 1IWOA 4LPSA 2OHJA 1PIWA 3CX5F 1C7ZA 4C0SA 1X25A 1P39A 3MDOA 2JIZA 1ZSPA 3UCSC 1FY2A 3TRIA 2HJSA 2C2WA 3QITA 2YMQA 3JQRA 2A5JA 4IV0A 3E86A 3H5IA 2W2XA 4E5KA 1EWVA 3ASZA 2FG7C 2C61A 3DXRB 1I94O 1YZ3A 2IS6A 5EE3A 1U1GA 4P93A 4DT1B 1P5HA 5TQ2A 1K4MA 3QKIA 4E1BA 1PQ4A 3RUAA 1GZ3A 2GFIA 1EFDN 4M9RA 4R5HA 4ZHWA 3O2JA 1XYYA 4XM2A 3MCAA 3VNBA 3QIAA 5I9MA 4GR5A 4II2A 4CUKA 3DVLA 2YNMC 1NV9A 4XYBA 3WMRA 4N3CA 3FKJA 1E3JA 1XYGA 2HR1A 5FUYA 3IVAA 3B5IA 3C3XA 1W6UA 2Q29A 3WL3A 3NNNA 1K6JA 2RHWA 4MV7A 4MI3A 3SDBA 5J23A 1S5JA 3AR3A 4JXXA 1ZMBA 3E22A 4FQ5A 1T8YA 1C8BA 2B9ZA 2FOXA 4B81A 5LVAA 1A96A 3ML1A 2OFOA 3KLNA 4Z6KA 4INJA 1ZUD1 1D04A 4YCDA 1EGHA 3AY3A 3F0GA 3ILHA 1QAHA 3GJ6A 2R87A 1PWHA 3RJ9A 4N9QA 3OTWA 3TG8A 4PHFA 4L8VA 3IS3A 1MC1A 3W5UA 1XP8A 2QLMA 4K0KB 5F77A 4YCCA 1FSGA 3QLVA 1GRJA 3DYVA 4LDZA 4JOBA 4NCNA 3A06A 1QG6A 2GEJA 5FTJA 3QENA 3IDOA 2CMKA 3ROEA 4OF4A 3OOHA 4DLAA 3VKUA 1O94A 2IYSA 1QP7A 4DADA 2H5IA 3SOPA 1PGPA 5AUNB 3A9SA 4WJZA 1AK1A 5TGTA 4C7JA 4UULA 4UAJA 3OBWA 4JR0A 3C8UA 1X7OA 5B55A 1N2EA 2FW1A 1QQCA 3IR6A 2JLBA 1UT6A 3R23A 4E4EA 3BL6A 2CEAA 4KRGA 3U7QA 4MVJD 3ZCUA 5C2JB 4YRMA 3A6JA 2HSDA 1H2GA 4DILA 1DELA 4RJTA 3CTPA 4IIUA 1QLHA 5A04A 4L6AA 4IO0A 4DYDA 1RPRA 4N6NA 3VR1A 4QOHA 3QTYA 3SYOA 1LPNA 4XW2A 4BVQA 4DWVA 4ALLA 1RAGA 5JWRA 3U80A 1BMDA 4TTAA 4OHUA 5KTRA 1QO9A 3OQIB 3ZPXA 3U3OA 1PJTA 2Z08A 3PCXA 3THXA 2BDUA 2ZR9A 4C82A 1JT2A 1K8RA 2B6HA 3LY7A 1Z45A 4YJ2B 3R0ZA 4AUEA 3ABTA 1HTWA 1KY2A 4GAEA 3EUFA 2GTAA 2IU3A 3E9CA 1T5BA 1YJ9V 1DX4A 2YASA 4GVXA 2GK6A 3WL4A 3V7QA 3TTWA 1VDMA 1QZZA 1YHNA 1QVGF 3KBBA 1YMVA 3B85A 3FMIA 1H05A 4LHWA 4WTOA 5F78A 3ORYA 2QR2A 4XPZA 4OQ4A 1GNVA 3L8GA 4GEGA 2PS0A 2ZYSA 3QG1A 5CR9A 1SOUA 1HBJA 4Q19A 3TZBA 2NLJC 3A6KA 3FTEA 1LUVA 2YWGA 2PYIA 4LYFA 4AP9A 1MH1A 3WMEA 2EAUA 1G6UA 1U3VA 4UMFA 1PI3A 3A4NA 5AKKA 1KHHA 2C4TA 4P38A 4U3JB 2XE4A 3D4NA 5ALZA 5LP6A 5F21A 4OLBA 1IG3A 4Z86A 3SHFA 3C6KA 2JIZG 4Z53A 4WLNA 1NC3A 4L28A 3TLMA 3UANA 3AYXB 1KVUA 2R5WA 1EP9A 2WG2A 4W5OA 3IERA 3H1EA 4JEMA 1YITV 4PLPA 4Z1MA 1Z0DA 4LY3A 4U8HA 5EIFA 3TSCA 1SVKA 4KAAA 4MINA 2CD9A 3CNOA 4LFAO 1OIXA 1ZLXA 2PZJA 4YPFA 1TDJA 5ECGC 4AZSA 4ZRDA 1RCUA 2G71A 3VR6A 3V8EA 2JFUA 4OMUA 4RTNA 3VH2A 4JYAB 3ZWQA 2UYGA 1Z34A 1HT2E 1UBOS 3A70A 3FCUB 1QU9A 4HKTA 5IZCA 1X1AA 4TV8F 3DFMA 3QX8A 1NVTA 5A4JA 3LVRE 2CGOA 2CTRA 2P6PA 2OO5A 4MKRA 5IW8A 4QHTA 4CM9A 1V1RB 1N5MA 1CNFA 2RGXA 3NWEA 4EMTA 1K0UA 3BM5A 4ZYZA 1DTWB 4AJ1A 5HGXA 1YNOA 2LP4Y 2YKGA 2ZBGA 2P9FA 3N0TA 4JVSB 2YIAA 2CLFB 2PA3A 4NPAA 4QZVA 4O3FA 2P9TA 1WCIA 3QPBA 4QLBA 3E8MA 2PG3A 5K1PA 3B89A 3DHVA 4C8GA 4Y6LA 2MWMA 4L16A 1JJVA 2QJWA 2R6CA 3WICA 4YT4A 2A1UA 3LUJA 4RKRA 2GPAA 3U39A 1ROPA 1RI5A 4JI8O 2PBZA 2GUWA 3LRTA 2VBCA 3ZGOA 1WN7A 5TSDA 4N18A 3U4QB 2IEYA 2CFTA 2DETA 1ZBDA 1ZAUA 1GPH1 3ZMVA 4PSVA 4OP1A 4JNKA 1I32A 1L4UA 3HMKA 2ZS8A 4ZQHA 3JCMM 1P7YA 2WRZA 1BE6A 1ODIA 4TX1A 2Y93A 3V5NA 1X7DA 4EMUA 3WL8A 1ZP6A 4LZLA 1PW7A 3A1UA 2G63A 5SYAA 2X9LA 4Z4CA 4ER0A 2I8LA 2SHKA 4J7CA 2VH2A 1WCWA 1V9LA 2WU0A 4EHIA 1AR4A 3O21A 3VNVA 1YL6A 4P53A 5I4KA 1NR5A 2KLHA 4NMWA 1YR6A 4RSMA 1PV1A 2LZ0A 3LH5A 1DS6A 1KJQA 2IS1A 3E3LA 2AHYA 4NULA 5DXJA 3B8EA 1WR8A 3NYRA 2J9YB 1PLJA 1M57C 4EY7A 2Y0PA 4BUJA 1VKOA 1ZUNB 2C3MA 8GPBA 2R751 1C7JA 3SPHA 1QHHA 1OCRB 2FWBA 1RJWA 4E88A 1PGJA 4DLUA 1QRDA 5HBGA 4NH4A 3TKAA 1QV9A 1SQBH 3EFEA 1TKBA 2X2OA 2NADA 1B3QA 4ZOAA 4HBZA 4RELA 3CLTC 3G1TA 3X1WA 2EWMA 4ENSA 4MUIA 3AF0A 2XWBF 3C9SA 1J24A 4GM0A 3C6QA 3WLPA 1XMOB 3CMEF 1Z08A 5EJEA 2WLMA 3ZU6A 2GDJA 3H1LH 2O2DA 3C7AA 5F1PA 1ZD9A 2FFHA 1S8FA 5CA1A 2RKWA 2ZRAA 1VQPV 1QDEA 2F8TA 3AIMA 7YASA 4P7GA 1FFYA 4DXDA 3LT0A 3SYKA 1OFGA 2PV7A 2IHYA 4Y2XA 1Q7YH 1RTKA 1AUVA 4PG4A 4RWZA 3GFQA 3ZCXA 3ASOB 2WD8A 1PQUA 2ZI9A 2PS3A 5IULC 3GJ5A 3KR9A 4D57A 1S77D 5KO2A 1XDZA 1RJ9B 5SZIA 1L0LH 3IJPA 4LTMA 3Q3CA 3OF5A 4MQ5A 4QPDA 4NDZA 2R9IA 1E5TA 4Z1MG 1EXVA 3RYFA 3D8SA 1Y4ZA 1GGJA 3HJRA 1YFZA 2RJ3A 4R1QA 4DQKA 1CV2A 5ER6A 5GJVC 2QT0A 2W2VA 1RQNA 2E5FA 2JASA 3EXIB 5IDXA 4EFEA 4D4JA 1YUBA 3NOXA 3K4HA 2WG0A 3H5TA 4GYKA 5BR8O 2QTBA 2EW8A 2H2HA 1MB4A 1M56C 1B6GA 2QPOA 3EGIA 4YT5A 2IOFK 3ILSA 3A36A 2OGSA 1C3OB 2P11A 3ZEDA 2X6BA 1PSWA 2XMZA 2GNOA 1KIMA 5AW8A 2Z8XA 1PEDA 3TL3A 1XZQA 4NP6A 4U2GA 2XJ9A 3D3JA 5PNTA 3KLOA 2AL7A 3MQWA 4B2IA 3CC4V 3APOA 1YI0A 1G5TA 121PA 2IV3A 2PUBA 5T7BA 4JJ8A 1R6TA 5AHRA 2ZDIA 1PNOA 2DQSA 1BE1A 2PL3A 4TSFD 4DSTA 4M9QA 1GOTA 4QBKA 2ZXWB 1X0VA 2UUCB 1K3TA 1OY1A 2V5UA 3O74A 3SJ7A 1UDBA 3UJAA 2BGJA 2HMSA 3NP7A 2XHBA 3ERNA 4RV9A 3OKAA 3M6AA 2BELA 3PC4A 3R9KA 1P3Y1 1XI2A 4IDCA 2L19A 3HUFA 3T8YA 3NT4A 1XMVA 3FI9A 1M6YA 4DC9A 1H9AA 1UFRA 4QPJC 3UM9A 5KVVA 2FOLA 4WK0B 1S8OA 5EAIA 2ICAA 3R8FA 3AETB 4HQNA 3S8MA 4Z3DA 1W55A 2Y0DA 4O2AF 2ZUEA 5E4TA 1XEWX 5FD8A 2EV9A 5FWYB 4QEDA 4ZCTA 3U7JA 4I1SA 1U0FA 2RGCA 5A4DA 3H2SA 1VLHA 2GBLA 2VRNA 3ZQ6A 3ANMA 1RDFA 2ZRIA 3TMKA 3RTCA 3HJTA 1P49A 2BMFA 4NV1A 2AWOA 3HPQA 1ECPA 2XXJA 2YFKA 1I7FA 2H1CA 3M1AA 3IUPA 3LC2O 1IN4A 2LBXA 2B2XA 4ERHA 1TX4B 4ZYLA 3ZX6A 1BCRA 3CN9A 4LXUA 3G0HA 4F9TA 2ZKLA 4D8TA 3D0OA 4QGGA 4QJ5A 4LQ4A 2C9DA 5H3HA 5DP1A 1SBQA 1IOLA 2BUCA 1TPYA 2ZWMA 4ZIBA 4A6EA 2VNKA 5T57A 2GA8A 1Z56C 3CNNA 3I58A 3ZK8A 3PX3A 4DGSA 3INNA 4IQFA 4QOEA 4YJFA 3AHIA 4Y6SA 3DV0A 1EUDB 4K35A 1NHWA 4RJLA 3IP5A 1XD2A 4HB2A 1IUPA 3FFAA 1KVTA 3LUHA 2JRCA 3NVKI 2V6FA 4NNJA 4Q02A 2DZDA 3VNSA 5H5JA 1U04A 1WZEA 4Z0TA 2G9NA 1DXQA 1U8UA 2BBOA 3LQYA 3MF4A 2IY9A 4HMOA 2ZXWC 3CLKA 1T9BA 1TQ2A 3HWX1 5JH7F 5LHHA 1MTZA 3A9TA 3ZDFA 2LIPA 2OXCA 2O5CA 4OH7A 5KTYA 1YJCA 3D36C 1IBLB 4Q7MB 1T2UA 5LU8A 3KO8A 3VKWA 3S2EA 3FCCA 3QUQA 2QYOA 2Y05A 3ZHRA 3UJ8A 3FR8A 3G2JA 2UZHA 1C8LA 1Z0AA 5KMGB 3HKEB 1DAGA 2WWXA 1WEHA 4PPQA 5KUTA 1X13A 2WZBA 2A5LA 1FDVA 3P0JA 2JAWA 4EO4A 4B75A 3M5CA 3FBWA 3GLHB 3ZBPA 4Y6PA 1GUZA 5EIWA 1QPBA 4B3TB 3LX5A 4EB6B 1XR3A 5GM2A 1K34A 2YOGA 1VQNV 3T1HB 3DEYX 3FVQA 4X3PA 3PFCA 4FD3A 3WLFA 1WSWA 3FUTA 1VQ8F 4MR7B 1FQOA 3HA3A 4R01A 2ZBUA 3AF1A 2BE9A 1JECA 2G88A 5FBHA 2HM7A 2JRIA 4PZCA 2FWRA 2FZVA 4QYSA 1B4DA 3RS9A 3UW3A 2YXBA 3ZBQA 2JFNA 3BCHA 3O0DA 1WPQA 2HZ7A 4NV3A 2UYCA 4ED9A 2BMDA 3ML0A 1Q6YA 2ZVDA 2UYQA 2DGDA 5C1DA 3QVUA 1YJWV 3LY8A 5HIAA 2ZVJA 5LZ2A 1WZUA 2WAXA 2X0FA 3Q7PA 1SC5B 4PYJA 5DWDA 3AM5A 4ALNA 4RQAA 1XEQA 3PQ6A 5FCDA 3ZTYA 2FXIA 5AJHA 3DC7A 2VTBB 3U4HA 4BFUA 3CSDA 1N57A 4TOIA 1G38A 5KOHA 3OMAB 4CU2A 2XMCA 2QG6A 3B7WA 4LTDA 1NSFA 3GAMA 1PJCA 4Z2YA 4J76A 1U7ZA 1CUVA 3VYWA 1Q22A 4JHXA 1ORWA 2CHSA 1GNSA 1LLQA 4UHEA 3T95A 5FLXM 3S0YA 3DHWC 2POQX 4DCJA 2K9PA 1YFLA 1KECA 4MKHA 1W25A 5ALJA 4BY9E 3L7KA 2ON6A 1I3OA 4L6CA 3O7MA 3CU5A 4BMOB 1KSFX 1W46A 4IXNA 2Q41A 2IS4A 3QVGB 1J33A 1JDPA 1F14A 1OX4B 3USZA 4JYPA 3DE5X 1MG1A 2VXBA 4F1JA 1SU7A 1FIUA 4F85A 4E0BA 5H2FZ 1TYZA 4HUJA 2PVCA 5DBIA 2Z1UA 3SR2C 4EZBA 3ZHXA 3BE4A 1JCHA 1W36C 2Y1GA 4BT7A 4ALKA 1Y8RB 4ARBA 1T3GA 1ECGA 2CJXA 2OXIA 5EJ8A 5CT4A 1FLDA 4AJLA 2PH7A 1M2OA 4KI7A 1OLUB 3EY9A 2Z3YA 2VHWA 1AT1A 4BVTA 1NUUA 3GEMA 4FYMA 1Z6ZA 3KXKA 2ZAIA 1J0AA 1H2SB 2E2WA 2FMLA 4RC9A 2QF7A 1LBTA 2I3AA 2B5WA 4NFHA 3HKBB 2PE5A 4EW2A 2WT4A 1FFXA 2NSDA 5KBYA 4WLEA 1L5VA 1UM9A 3WRYC 1KD1H 1MB2A 2E87A 2I78A 5CVCA 1NI5A 2XDYA 5D5HA 3FFXA 4B7ZA 2ZTHA 4MI1A 4DE5A 2F6RA 3C7DB 1B16A 2A6PA 1GTOA 4RE5A 4D6PA 3T3IA 3AB7A 4L5JA 4HL6A 5FTKA 3S4YA 5KYYA 3UT6A 1NVPD 3CLHA 4M60A 4NU0A 1GK9A 1S2NA 2Q6VA 3EW7A 2G5PA 3IP8A 3UN1A 1NC1A 2QD2A 2D00A 2XY4A 4MV3A 3OGIB 5A71A 1F5NA 1XCMA 7REQB 4PSAA 4MAAA 4J3FA 4BNVA 3KHKA 1QH1A 3VHQA 1QVVA 3HHPA 2QE7G 3DR3A 3DXFA 2YNMA 1NX6A 1RTTA 3P0EA 1FUIA 3RD5A 3U09A 5J4LA 3ME5A 3QE2A 5KINB 4QE9A 4JBYA 4GMDA 4EYOA 3U56A 2GD1O 3UWSA 4B33A 3MD0A 2FGKA 4R2WA 1Q0RA 3CC2F 2J5KA 2KTVA 2BD0A 2FHSA 2FKNA 3KQPA 4Y6RA 1P29A 3CG0A 4DA6A 3D00A 1I7QB 1QU7A 2WWGA 3K1YA 3NRJA 3B53X 4DNXA 4K9QA 2JFYA 1II0A 4FOTA 3ZNNA 1X2EA 2G0NA 2AB0A 2PTGA 2H31A 4EPTA 2P6RA 1BWRA 1TQ6A 3HY4A 1F7VA 4KSBA 3IO3A 1YTFB 2B4YA 2C2YA 2DHEA 1FYEA 4E3WA 1PHRA 1RYFA 3JCZA 4AN0A 4G28B 4YREA 1OI4A 1M1KW 3J80A 4QVKA 3D59A 5M7EA 3S06A 4OHFA 1OCZB 1FJXA 5FOUA 2Q7EA 1QHSA 3CZAA 4I8XA 5AKLA 2EGHA 3KXPA 4ROSA 5J9FA 4G1FA 5EHQA 3OR6C 3G2LA 4X89A 2AEJA 3CYFA 5BWNA 1N0IA 2BE7