4B5CA

Crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
DPLNDPNSPLAKRSVYFDFDSYSVQDQYQALLQQHAQYLKSHPQRHILIQGNTDERGTSEYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Burkholderia Pseudomallei Acute Phase Antigen Bpsl2765 for Structure-Based Epitope Discovery/Design in Structural Vaccinology.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lipid transport
molecule keywords PUTATIVE OMPA FAMILY LIPOPROTEIN
total genus 45
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b5cA00
4G4ZA 4G4YA 4PWTA 5EB1B 4B5CA 3CYQA 2MQEA 1R1MA 3CYPB 4G4WA 4ZHWA 3TD3A 4G88A 3S03A 2KGWA 3S0YA 4B62A 2N48A 4ERHA 2ZF8A 3WPXA 2ZOVA 3S0HA 3LDTA 4G4XA 2LBTA 2ZVYA 1OAPA 4RHAA 3S06A 5EB0A 3IMPA 3S0WA 5EAZA 2HQSC 3KHNA 2LCAA 3TD5A 2W8BC 4R40B 4ZHVA 3S02A 4G4VA 2AIZP 4ZHYB 3TD4A 3OONA 3WPWA 2ZVZA 2K1SA 2L26A
chains in the Genus database with same CATH superfamily
5EWRA 4C8IA 4BVSA 3OBWA 3JAMM 5CA0B 5EZYB 5LXTA 2ZAUA 3I7TA 3D54A 4X1IB 5CA1B 5KX5B 2HS0A 1KNJA 1U3LA 2VGMA 3E22A 3VO8A 2ZOVA 3V4DA 1YJWF 1XHOA 1KC8H 2DT4A 1VQ5F 5FNVA 5EAZA 2H8EA 1YHQF 3C9TA 3N4ZA 4O2AA 4R40B 4X1KA 3FPIA 5C8YA 3T80A 2OTMA 3O85A 2GVIA 3C8LA 2Z1EA 3KJKA 4PWTA 2VGNA 3E20B 1R1MA 3F0DA 5GINC 3N4YA 2I6DA 1GZ0A 1FSZA 1RQ7A 1H48A 5IJ0B 3S0HA 3WJQA 5J2UB 4IIJB 5BMVA 4TZZA 1VQVA 2BTQB 3GTZA 3HKDA 3KJJA 1J7HA 2RHOA 5EYPB 4ZHVA 3ZOPA 5A2QM 3RE3A 4G4YA 4B5CA 2KTVA 4BT6A 3K14A 3EORA 3S0YA 1IV4A 3LWVC 3RA6A 3LDTA 1TUBA 4NQ3A 4DRXA 5LYJB 2QTPA 4LNUA 5G4VC 5JQGA 1W59A 3JALA 3GHZA 1YIJF 3WGJA 3VIUA 3OONA 5GIPC 3IR9A 2IQQA 1VQOF 3ERNA 4TUYB 5GIOC 3CYQA 1DBFA 4YJ2A 3D00A 4ZHQA 5LXTB 1W5BA 1KQSF 3JARA 5HXZA 2DYYA 3HKEB 3LYBA 2EWCA 3JAKB 4ZI7B 1FNJA 4BT4A 3HKBA 3ZO8A 5IT9M 3LWOC 5GONA 4O4LB 3RYIB 1UFYA 1Q7YH 3CCEF 3ON1A 4I50A 2Q1XA 3WJPA 3IKEA 4G4ZA 4ZOLB 3NVIB 3JAWA 2LBXA 3DC2A 3UT5A 3VYUC 1VK3A 2HRUA 1M1KH 2HVYD 5EZYA 1U40A 3NK7A 5IJ0A 2OHWA 3B6NA 2CZWA 5LYJA 1SZQA 5IJ9B 5JCOC 3R0PA 4X20A 2F9ZC 2AMTA 3S06A 4O4IB 3FFMA 2UYJA 3ZP4A 5KMGA 1XV2A 3N2KA 1W55A 3WGNA 1E7KA 3K12A 3HKDB 3VYSC 5EB1B 3SIUA 1QU9A 3V7EA 1CN7A 3JCMM 3CYPB 3Q8HA 4ZHQB 2CW4A 5ITZA 2OTJF 3MQWA 5HP8A 3CCMF 4U39A 5LP6A 4B62A 3CCQF 5J2UA 3HKCB 2RHHA 4X1YB 1TVKA 4X3LA 3NVKE 3S0WA 5GONB 3KHNA 2LCAA 3N2GB 2W8BC 4BT5A 3RYFB 4I55B 1VQ8F 4C82A 4ZHYB 3CC2F 4ZK7A 3GYQA 1QVFF 4EI9A 5J2TB 1X7OA 2CSLA 4KWEA 3WGMA 1M90H 2MQEA 2HS3A 5CB4A 1S72F 2YYEA 4TV9B 3RA5A 1KD1H 2CVLA 4E6EA 5HWEA 3G71F 1W5FA 2ZODA 5G4UC 1X25A 2CWJA 2PHNA 3HKCA 3I3FA 1QAHA 4X1YA 1VQ6F 3IEWA 1VQKF 2VAMA 3QUWA 5EIBD 1W40A 2VXYA 2ZVZA 3RYHA 1W2BF 3JVHA 1FFXB 2HP3A 4I55A 1GO1A 5LP6C 4YJ3B 3JARB 3CXCF 1W41A 5ITZB 3F6MA 2GLZA 3K0TA 1W581 2QEXF 3MDOA 1RA4A 2V9YA 1Q81H 3ESJA 3HKBB 1Z5VA 3JASA 2NMUA 2OTLF 4I4TA 4O2AB 2H6LA 4X1KB 1JN1A 3CD6F 3IMPA 3JALB 1NMUB 5HXUA 3G6EF 3QHDA 2WALA 3N2GA 3V7QA 1OFUA 4BY9D 4C81A 1U43A 3JAWB 5IYZA 1YJ9F 2R6R1 4X3MA 1JFFB 2K1SA 3MCAB 2UYNA 4TUYA 2KG4A 1W5EA 3M84A 5CB4B 2QI2A 4TV9A 5IJ9A 3CCSF 1YITF 4X20B 1H7MA 3M4SA 5GANK 3JAKA 2ALEA 4DRXB 3JATB 1OAPA 3AGKA 4NUTA 1VQNF 3RYHB 2QA4F 3CPQA 4ZOLA 3IKFA 1Q82H 5LP6B 5IYZB 2CHSA 4YJ2B 3UT5B 3S03A 1QVGF 3VMFB 4EB6B 5CA0A 2P6YA 3WPXA 4BT2A 4TV8A 5FJ4C 3CCVF 1CLIA 4ZI7A 2LBWA 5EB0A 4O4IA 2B33A 3S02A 2BTOA 3I56F 2FGYA 3ELCA 3N2KB 3P4EA 4FFBA 5JCOA 4O2BA 1YGYA 1JFFA 3LMEA 2UYNB 3G4SF 1SA0B 2BO1A 1FFXA 3VOBA 4DXDA 3CPWF 1Z5WA 1W5AA 1XRGA 1T0AA 4ZHWA 3VI6A 3I55F 2G9IA 1VQLF 1YQNA 3LFOA 1W3EX 3CB2A 3J81M 3CMAF 2UZHA 3U0OA 3JASB 1XBIA 3JATA 4O4LA 1U3PA 5JVDA 4IHJA 5LA6A 1YJNF 5KMGB 3CCJF 4YJ3A 3VOAA 3PLAC 2AIFA 3WPWA 3CCUF 5DCVA 4EI7A 5J2TA 1VQ4F 4WBNA 2FC3A 1RQ2A 3BYQA 3KIZA 4B46A 1VQ7F 4O2BB 1IPAA 5EYPA 3VTIC 2HP0A 4C8GA 4G88A 2KGWA 3J80M 5LOVB 1NJIH 2H8CA 5HY1A 1JD1A 1W42A 4U3JB 4ERHA 2ZF8A 4BW0B 4TV8B 1TVKB 2PMPA 5FLXM 5JH7A 3CMEF 4LCKA 2Z01A 1ONIA 2HS4A 3WGKA 1X7PA 1NQ3A 2IG8A 2AIZP 3TD4A 1SA0A 2VAWA 2Z1TA 3HJWC 2GZLA 4X1IA 3V3TA 4HNAB 2RHJA 4G4WA 1N8RH 3TD3A 1Q86H 3IEQA 3M1XA 3LWRC 1W57A 5HY4A 1JJ2F 1COMA 1CK2A 3MBMA 3ZP7A 4G4XA 2YXZA 5CA1A 3WJRA 1VQMF 1FNKA 4U3JA 1K8AH 2HX0A 3VYTC 4BT3A 1SDSA 1PXWA 2IAFA 3E1YA 3HWUA 4BVQA 1PF5A 4G4VA 1JY8A 4C4WC 3K2XA 4WBNB 1IV1A 1ODEA 1RLUA 4I50B 3VCZA 4EI8A 3NK6A 3CCLF 3P10A 3J7AR 2BTUA 5LOVA 1DT9A 3F0FA 1X52A 1VHAA 4HNAA 4O4JB 3HKEA 4F6RB 4O4HB 3CG6A 1KNKA 1IV2A 2LBTA 4NWOB 2OZBA 5MN6A 3KE1A 5EIBC 4BVTA 4RQOA 5GAPK 3LWQC 5FNVB 4BT7A 5JVDB 2Z1FA 4IHJB 5LA6B 1K9MH 5C8YB 3RYCB 2KTUA 5B8FA 3CCRF 1ZWZA 3MCQA 2UYKA 3PAFA 3L7QA 4FFBB 5HP7A 5HY0A 5AVMA 3CC4F 4M8IA 2HP0B 3FD6A 4I4TB 2N48A 4LNUB 5JQGB 3D01A 3CC7F 1H47A 2Z1UA 3HAXD 2JNBA 2ZVYA 3DDNA 4O4JA 4F6RA 3FD5A 3SIVA 2VAPA 2HRYA 4IIJA 5EO3A 3WGLA 5BMVB 5HY2A 1VQPF 1VH8A 4BVRA 2RHLA 3C9SA 1IV3A 3RYCA 1YI2F 2CHTA 3C9UA 5KX5A 3E22B 1VQ9F 2RB9A 3NMUC 4EB6A 1Q8RA 3P0ZA 4O4HA 4XCQA 2I6RA 3QTYA 3F0EA 1UI9A 1TUBB 3F0GA 5MN4A 4RHAA 1K73H 1GO0A 3RYIA 5MN5A 3LWPC 2R751 2UYPA 3OBYA 3C9RA 3FBAA 3WXMB 4C8EA 2HQSC 3OW2F 3RYFA 1GX1A 3TD5A 4B45A 2Q1YA 5JH7B 1QD9A 1T0KB 3HTNA 1RLGA 2L26A
chains in the Genus database with same CATH topology
4G4ZA 4G4YA 4PWTA 5EB1B 4B5CA 3CYQA 2MQEA 1R1MA 3CYPB 4G4WA 4ZHWA 3TD3A 4G88A 3S03A 2KGWA 3S0YA 4B62A 2N48A 4ERHA 2ZF8A 3WPXA 2ZOVA 3S0HA 3LDTA 4G4XA 2LBTA 2ZVYA 1OAPA 4RHAA 3S06A 5EB0A 3IMPA 3S0WA 5EAZA 2HQSC 3KHNA 2LCAA 3TD5A 2W8BC 4R40B 4ZHVA 3S02A 4G4VA 2AIZP 4ZHYB 3TD4A 3OONA 3WPWA 2ZVZA 2K1SA 2L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4Z A;  4G4Y A;  4PWT A;  5EB1 B;  4B5C A;  3CYQ A;  2MQE A;  1R1M A;  3CYP B;  4G4W A;  4ZHW A;  3TD3 A;  4G88 A;  3S03 A;  2KGW A;  3S0Y A;  4B62 A;  2N48 A;  4ERH A;  2ZF8 A;  3WPX A;  2ZOV A;  3S0H A;  3LDT A;  4G4X A;  2LBT A;  2ZVY A;  1OAP A;  4RHA A;  3S06 A;  5EB0 A;  3IMP A;  3S0W A;  5EAZ A;  2HQS C;  3KHN A;  2LCA A;  3TD5 A;  2W8B C;  4R40 B;  4ZHV A;  3S02 A;  4G4V A;  2AIZ P;  4ZHY B;  3TD4 A;  3OON A;  3WPW A;  2ZVZ A;  2K1S A;  2L26 A; 
#chains in the Genus database with same CATH topology
 5EWR A;  4C8I A;  4BVS A;  3OBW A;  3JAM M;  5CA0 B;  5EZY B;  5LXT A;  2ZAU A;  3I7T A;  3D54 A;  4X1I B;  5CA1 B;  5KX5 B;  2HS0 A;  1KNJ A;  1U3L A;  2VGM A;  3E22 A;  3VO8 A;  2ZOV A;  3V4D A;  1YJW F;  1XHO A;  1KC8 H;  2DT4 A;  1VQ5 F;  5FNV A;  5EAZ A;  2H8E A;  1YHQ F;  3C9T A;  3N4Z A;  4O2A A;  4R40 B;  4X1K A;  3FPI A;  5C8Y A;  3T80 A;  2OTM A;  3O85 A;  2GVI A;  3C8L A;  2Z1E A;  3KJK A;  4PWT A;  2VGN A;  3E20 B;  1R1M A;  3F0D A;  5GIN C;  3N4Y A;  2I6D A;  1GZ0 A;  1FSZ A;  1RQ7 A;  1H48 A;  5IJ0 B;  3S0H A;  3WJQ A;  5J2U B;  4IIJ B;  5BMV A;  4TZZ A;  1VQV A;  2BTQ B;  3GTZ A;  3HKD A;  3KJJ A;  1J7H A;  2RHO A;  5EYP B;  4ZHV A;  3ZOP A;  5A2Q M;  3RE3 A;  4G4Y A;  4B5C A;  2KTV A;  4BT6 A;  3K14 A;  3EOR A;  3S0Y A;  1IV4 A;  3LWV C;  3RA6 A;  3LDT A;  1TUB A;  4NQ3 A;  4DRX A;  5LYJ B;  2QTP A;  4LNU A;  5G4V C;  5JQG A;  1W59 A;  3JAL A;  3GHZ A;  1YIJ F;  3WGJ A;  3VIU A;  3OON A;  5GIP C;  3IR9 A;  2IQQ A;  1VQO F;  3ERN A;  4TUY B;  5GIO C;  3CYQ A;  1DBF A;  4YJ2 A;  3D00 A;  4ZHQ A;  5LXT B;  1W5B A;  1KQS F;  3JAR A;  5HXZ A;  2DYY A;  3HKE B;  3LYB A;  2EWC A;  3JAK B;  4ZI7 B;  1FNJ A;  4BT4 A;  3HKB A;  3ZO8 A;  5IT9 M;  3LWO C;  5GON A;  4O4L B;  3RYI B;  1UFY A;  1Q7Y H;  3CCE F;  3ON1 A;  4I50 A;  2Q1X A;  3WJP A;  3IKE A;  4G4Z A;  4ZOL B;  3NVI B;  3JAW A;  2LBX A;  3DC2 A;  3UT5 A;  3VYU C;  1VK3 A;  2HRU A;  1M1K H;  2HVY D;  5EZY A;  1U40 A;  3NK7 A;  5IJ0 A;  2OHW A;  3B6N A;  2CZW A;  5LYJ A;  1SZQ A;  5IJ9 B;  5JCO C;  3R0P A;  4X20 A;  2F9Z C;  2AMT A;  3S06 A;  4O4I B;  3FFM A;  2UYJ A;  3ZP4 A;  5KMG A;  1XV2 A;  3N2K A;  1W55 A;  3WGN A;  1E7K A;  3K12 A;  3HKD B;  3VYS C;  5EB1 B;  3SIU A;  1QU9 A;  3V7E A;  1CN7 A;  3JCM M;  3CYP B;  3Q8H A;  4ZHQ B;  2CW4 A;  5ITZ A;  2OTJ F;  3MQW A;  5HP8 A;  3CCM F;  4U39 A;  5LP6 A;  4B62 A;  3CCQ F;  5J2U A;  3HKC B;  2RHH A;  4X1Y B;  1TVK A;  4X3L A;  3NVK E;  3S0W A;  5GON B;  3KHN A;  2LCA A;  3N2G B;  2W8B C;  4BT5 A;  3RYF B;  4I55 B;  1VQ8 F;  4C82 A;  4ZHY B;  3CC2 F;  4ZK7 A;  3GYQ A;  1QVF F;  4EI9 A;  5J2T B;  1X7O A;  2CSL A;  4KWE A;  3WGM A;  1M90 H;  2MQE A;  2HS3 A;  5CB4 A;  1S72 F;  2YYE A;  4TV9 B;  3RA5 A;  1KD1 H;  2CVL A;  4E6E A;  5HWE A;  3G71 F;  1W5F A;  2ZOD A;  5G4U C;  1X25 A;  2CWJ A;  2PHN A;  3HKC A;  3I3F A;  1QAH A;  4X1Y A;  1VQ6 F;  3IEW A;  1VQK F;  2VAM A;  3QUW A;  5EIB D;  1W40 A;  2VXY A;  2ZVZ A;  3RYH A;  1W2B F;  3JVH A;  1FFX B;  2HP3 A;  4I55 A;  1GO1 A;  5LP6 C;  4YJ3 B;  3JAR B;  3CXC F;  1W41 A;  5ITZ B;  3F6M A;  2GLZ A;  3K0T A;  1W58 1;  2QEX F;  3MDO A;  1RA4 A;  2V9Y A;  1Q81 H;  3ESJ A;  3HKB B;  1Z5V A;  3JAS A;  2NMU A;  2OTL F;  4I4T A;  4O2A B;  2H6L A;  4X1K B;  1JN1 A;  3CD6 F;  3IMP A;  3JAL B;  1NMU B;  5HXU A;  3G6E F;  3QHD A;  2WAL A;  3N2G A;  3V7Q A;  1OFU A;  4BY9 D;  4C81 A;  1U43 A;  3JAW B;  5IYZ A;  1YJ9 F;  2R6R 1;  4X3M A;  1JFF B;  2K1S A;  3MCA B;  2UYN A;  4TUY A;  2KG4 A;  1W5E A;  3M84 A;  5CB4 B;  2QI2 A;  4TV9 A;  5IJ9 A;  3CCS F;  1YIT F;  4X20 B;  1H7M A;  3M4S A;  5GAN K;  3JAK A;  2ALE A;  4DRX B;  3JAT B;  1OAP A;  3AGK A;  4NUT A;  1VQN F;  3RYH B;  2QA4 F;  3CPQ A;  4ZOL A;  3IKF A;  1Q82 H;  5LP6 B;  5IYZ B;  2CHS A;  4YJ2 B;  3UT5 B;  3S03 A;  1QVG F;  3VMF B;  4EB6 B;  5CA0 A;  2P6Y A;  3WPX A;  4BT2 A;  4TV8 A;  5FJ4 C;  3CCV F;  1CLI A;  4ZI7 A;  2LBW A;  5EB0 A;  4O4I A;  2B33 A;  3S02 A;  2BTO A;  3I56 F;  2FGY A;  3ELC A;  3N2K B;  3P4E A;  4FFB A;  5JCO A;  4O2B A;  1YGY A;  1JFF A;  3LME A;  2UYN B;  3G4S F;  1SA0 B;  2BO1 A;  1FFX A;  3VOB A;  4DXD A;  3CPW F;  1Z5W A;  1W5A A;  1XRG A;  1T0A A;  4ZHW A;  3VI6 A;  3I55 F;  2G9I A;  1VQL F;  1YQN A;  3LFO A;  1W3E X;  3CB2 A;  3J81 M;  3CMA F;  2UZH A;  3U0O A;  3JAS B;  1XBI A;  3JAT A;  4O4L A;  1U3P A;  5JVD A;  4IHJ A;  5LA6 A;  1YJN F;  5KMG B;  3CCJ F;  4YJ3 A;  3VOA A;  3PLA C;  2AIF A;  3WPW A;  3CCU F;  5DCV A;  4EI7 A;  5J2T A;  1VQ4 F;  4WBN A;  2FC3 A;  1RQ2 A;  3BYQ A;  3KIZ A;  4B46 A;  1VQ7 F;  4O2B B;  1IPA A;  5EYP A;  3VTI C;  2HP0 A;  4C8G A;  4G88 A;  2KGW A;  3J80 M;  5LOV B;  1NJI H;  2H8C A;  5HY1 A;  1JD1 A;  1W42 A;  4U3J B;  4ERH A;  2ZF8 A;  4BW0 B;  4TV8 B;  1TVK B;  2PMP A;  5FLX M;  5JH7 A;  3CME F;  4LCK A;  2Z01 A;  1ONI A;  2HS4 A;  3WGK A;  1X7P A;  1NQ3 A;  2IG8 A;  2AIZ P;  3TD4 A;  1SA0 A;  2VAW A;  2Z1T A;  3HJW C;  2GZL A;  4X1I A;  3V3T A;  4HNA B;  2RHJ A;  4G4W A;  1N8R H;  3TD3 A;  1Q86 H;  3IEQ A;  3M1X A;  3LWR C;  1W57 A;  5HY4 A;  1JJ2 F;  1COM A;  1CK2 A;  3MBM A;  3ZP7 A;  4G4X A;  2YXZ A;  5CA1 A;  3WJR A;  1VQM F;  1FNK A;  4U3J A;  1K8A H;  2HX0 A;  3VYT C;  4BT3 A;  1SDS A;  1PXW A;  2IAF A;  3E1Y A;  3HWU A;  4BVQ A;  1PF5 A;  4G4V A;  1JY8 A;  4C4W C;  3K2X A;  4WBN B;  1IV1 A;  1ODE A;  1RLU A;  4I50 B;  3VCZ A;  4EI8 A;  3NK6 A;  3CCL F;  3P10 A;  3J7A R;  2BTU A;  5LOV A;  1DT9 A;  3F0F A;  1X52 A;  1VHA A;  4HNA A;  4O4J B;  3HKE A;  4F6R B;  4O4H B;  3CG6 A;  1KNK A;  1IV2 A;  2LBT A;  4NWO B;  2OZB A;  5MN6 A;  3KE1 A;  5EIB C;  4BVT A;  4RQO A;  5GAP K;  3LWQ C;  5FNV B;  4BT7 A;  5JVD B;  2Z1F A;  4IHJ B;  5LA6 B;  1K9M H;  5C8Y B;  3RYC B;  2KTU A;  5B8F A;  3CCR F;  1ZWZ A;  3MCQ A;  2UYK A;  3PAF A;  3L7Q A;  4FFB B;  5HP7 A;  5HY0 A;  5AVM A;  3CC4 F;  4M8I A;  2HP0 B;  3FD6 A;  4I4T B;  2N48 A;  4LNU B;  5JQG B;  3D01 A;  3CC7 F;  1H47 A;  2Z1U A;  3HAX D;  2JNB A;  2ZVY A;  3DDN A;  4O4J A;  4F6R A;  3FD5 A;  3SIV A;  2VAP A;  2HRY A;  4IIJ A;  5EO3 A;  3WGL A;  5BMV B;  5HY2 A;  1VQP F;  1VH8 A;  4BVR A;  2RHL A;  3C9S A;  1IV3 A;  3RYC A;  1YI2 F;  2CHT A;  3C9U A;  5KX5 A;  3E22 B;  1VQ9 F;  2RB9 A;  3NMU C;  4EB6 A;  1Q8R A;  3P0Z A;  4O4H A;  4XCQ A;  2I6R A;  3QTY A;  3F0E A;  1UI9 A;  1TUB B;  3F0G A;  5MN4 A;  4RHA A;  1K73 H;  1GO0 A;  3RYI A;  5MN5 A;  3LWP C;  2R75 1;  2UYP A;  3OBY A;  3C9R A;  3FBA A;  3WXM B;  4C8E A;  2HQS C;  3OW2 F;  3RYF A;  1GX1 A;  3TD5 A;  4B45 A;  2Q1Y A;  5JH7 B;  1QD9 A;  1T0K B;  3HTN A;  1RLG A;  2L26 A; 
#chains in the Genus database with same CATH homology
 4G4Z A;  4G4Y A;  4PWT A;  5EB1 B;  4B5C A;  3CYQ A;  2MQE A;  1R1M A;  3CYP B;  4G4W A;  4ZHW A;  3TD3 A;  4G88 A;  3S03 A;  2KGW A;  3S0Y A;  4B62 A;  2N48 A;  4ERH A;  2ZF8 A;  3WPX A;  2ZOV A;  3S0H A;  3LDT A;  4G4X A;  2LBT A;  2ZVY A;  1OAP A;  4RHA A;  3S06 A;  5EB0 A;  3IMP A;  3S0W A;  5EAZ A;  2HQS C;  3KHN A;  2LCA A;  3TD5 A;  2W8B C;  4R40 B;  4ZHV A;  3S02 A;  4G4V A;  2AIZ P;  4ZHY B;  3TD4 A;  3OON A;  3WPW A;  2ZVZ A;  2K1S A;  2L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...