4B5CA

Crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
DPLNDPNSPLAKRSVYFDFDSYSVQDQYQALLQQHAQYLKSHPQRHILIQGNTDERGTSEYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords PUTATIVE OMPA FAMILY LIPOPROTEIN
publication title Exploiting the Burkholderia Pseudomallei Acute Phase Antigen Bpsl2765 for Structure-Based Epitope Discovery/Design in Structural Vaccinology.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 45
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b5cA00
3CYPB 4G88A 2ZVYA 3TD3A 5EB1B 4PWTA 4ERHA 3S03A 2MQEA 2ZVZA 1OAPA 2ZOVA 3KHNA 4G4ZA 3WPXA 2K1SA 4RHAA 4B5CA 3TD4A 2HQSC 3LDTA 4G4VA 3S0YA 2LBTA 2AIZP 3OONA 3S02A 4ZHYB 4G4YA 4ZHWA 4B62A 2LCAA 3CYQA 3IMPA 2L26A 4G4XA 4ZHVA 4R40B 5EB0A 2KGWA 5EAZA 3S0HA 2N48A 1R1MA 4G4WA 3S0WA 3S06A 2ZF8A 2W8BC 3TD5A 3WPWA
chains in the Genus database with same CATH superfamily
2ZVYA 3VYSC 3S03A 5JH7A 1OAPA 1W5EA 5GONA 3OW2F 3WJQA 3K12A 1SA0A 3JAKB 2RB9A 1JJ2F 1DBFA 3ZP7A 2LBWA 3LWPC 1VQ5F 4ZOLA 2HQSC 1VHAA 2GZLA 1VQLF 4F6RB 2AIFA 1H7MA 3RYFA 1JFFB 4WBNA 4ZHQA 5CB4A 4FFBA 3RYIB 1W5AA 4EI9A 3NMUC 1U3LA 5EB1B 1CLIA 3F0GA 3JALA 3CXCF 2VAPA 1U43A 3CCVF 2JNBA 2WALA 2VAMA 2KTVA 3P10A 1CN7A 2CW4A 2UYJA 3LWQC 3JASB 2UYNB 2Z1FA 3HKBA 4IIJA 3CCUF 3OONA 3RYHA 2QI2A 1YQNA 5GIOC 3V7QA 1XV2A 1W41A 2L26A 1VQVA 3VOAA 2QEXF 1GZ0A 3S06A 4X20A 3RA5A 4O4HA 3CPQA 1S72F 5CA0A 4YJ2B 5LP6B 3HKCB 3WJPA 5EZYA 5GIPC 2DT4A 3CC2F 5IYZA 2BTQB 2HRYA 1Q8RA 3F0EA 3VMFB 3ZO8A 3BYQA 2ZODA 3OBWA 5AVMA 3B6NA 3V4DA 5GONB 2RHHA 2YYEA 3M4SA 2I6RA 1SA0B 3F0DA 5JCOA 4G4WA 3TD5A 3VYUC 2HS3A 3M84A 1VQKF 5G4UC 1QD9A 1T0KB 2Z1EA 1Q86H 3QTYA 2H8EA 2G9IA 1X25A 1Q82H 1Z5WA 3WGNA 4FFBB 3NK7A 4C81A 3CPWF 4O4JB 1NQ3A 1W55A 1XRGA 2CSLA 4M8IA 4O2AA 1PF5A 1XBIA 1FNJA 3JARA 5BMVB 4ZHYB 2VAWA 4U3JB 1M90H 1UI9A 2VGMA 1H47A 2Z01A 4YJ3A 2OHWA 3HKBB 5EIBD 3RYHB 3WGJA 1QU9A 2QA4F 2Q1XA 4BT5A 3M1XA 3N4ZA 1VQ4F 3HKEA 4IHJA 2FC3A 4X20B 2CZWA 4DRXA 5CA0B 1YJNF 4NWOB 2H8CA 1JD1A 3HJWC 3V7EA 3WXMB 1KNKA 2IAFA 1VQNF 2Z1TA 3AGKA 4XCQA 3S0HA 2N48A 3KJJA 3VOBA 1X7PA 4BY9D 3CD6F 5LXTB 4G88A 2HX0A 3VTIC 1RLGA 5KMGB 3IR9A 2Q1YA 1GO1A 3QUWA 3CCQF 4TV9B 4B5CA 3OBYA 5MN5A 1K9MH 5FNVB 3NVIB 5HXUA 4NQ3A 4BVRA 3S0YA 3JCMM 5J2TA 5MN4A 4I50B 5JVDB 5G4VC 1GO0A 3WGKA 3J7AR 1JY8A 5GANK 5KX5A 2LCAA 1QVGF 5HXZA 3FBAA 4G4XA 1VQ8F 4O2AB 3ERNA 3WPWA 5LOVA 3ZP4A 2CVLA 1W40A 4ERHA 5JQGA 4X1KA 1QAHA 4C82A 3J80M 4C8EA 1SDSA 3JARB 3P4EA 3PLAC 1IPAA 5C8YA 5ITZB 3ELCA 4TUYA 1VQOF 3WJRA 4ZI7A 1KNJA 4C8IA 3N2KA 4KWEA 4TV8A 3I56F 4DXDA 2Z1UA 5IJ9A 5LYJB 5HWEA 1FFXB 3GHZA 1X7OA 3KIZA 3N4YA 2HP3A 4BVTA 3CYQA 3ON1A 3U0OA 5LA6A 2HS0A 3FD6A 3HKEB 3UT5B 2RHJA 4I55A 2ZF8A 1UFYA 4U39A 1PXWA 5CA1B 2BTUA 3TD3A 1FNKA 3CCLF 5FLXM 3RYCB 4O4IA 3MQWA 4EI8A 4X1YB 2HP0A 2UYPA 3QHDA 3CMEF 1W57A 3VO8A 1IV1A 4HNAB 3T80A 5HP8A 4E6EA 5IT9M 3MCAB 5EYPA 4BT4A 1Q7YH 5IJ0A 3NVKE 2FGYA 4O4LA 5JH7B 3FD5A 4B45A 3C9RA 3LWRC 3E20B 2QTPA 1TUBA 5EAZA 2R6R1 3IKFA 3KJKA 5HY2A 1H48A 4ZOLB 1ONIA 3CB2A 5J2TB 3K14A 4C4WC 2B33A 2PMPA 3IKEA 3J81M 3JVHA 2ZAUA 2RHLA 4O2BA 3RYFB 3LFOA 2BTOA 4WBNB 4ZHQB 5CB4B 1J7HA 3I7TA 3EORA 3JAWA 3HKDA 3TD4A 2CHSA 2ALEA 2CWJA 4LNUA 4X1KB 2CHTA 2UYKA 3I55F 5C8YB 1W5FA 2KG4A 3P0ZA 2AIZP 3JALB 4RQOA 4ZK7A 1YIJF 3JAKA 1VQMF 3MBMA 3VIUA 3I3FA 2F9ZC 1RA4A 2P6YA 2R751 5IJ9B 2BO1A 2OTJF 4F6RA 3VCZA 2HS4A 1JFFA 3JAMM 4IIJB 5A2QM 3WPXA 3IEWA 3RYIA 2I6DA 1YHQF 3LYBA 4I55B 1W5BA 2YXZA 3D01A 1KD1H 4G4VA 4O4HB 2H6LA 4BW0B 4EI7A 2HP0B 4B62A 5EZYB 3HAXD 2KGWA 5IYZB 1K8AH 3NK6A 3CCSF 3C9SA 3JASA 1W581 2UYNA 4PWTA 5HY0A 3V3TA 5IJ0B 2MQEA 2RHOA 1SZQA 2NMUA 4G4ZA 4BT3A 4RHAA 3IEQA 1W59A 1TUBB 5LP6C 3D00A 3GYQA 3F6MA 2LBXA 3ESJA 1TVKA 1W3EX 1Q81H 3L7QA 2GLZA 4BT2A 3E22A 4TZZA 4NUTA 3HKCA 4I4TA 3KE1A 5J2UA 4G4YA 3IMPA 1IV2A 5EB0A 4EB6A 5FJ4C 1IV3A 2IQQA 1FSZA 3F0FA 4LNUB 3SIVA 1IV4A 1YI2F 1ODEA 1M1KH 4X1IA 1VQ9F 3Q8HA 1VQ6F 3VI6A 3C9TA 3DC2A 3R0PA 4YJ3B 1W42A 3N2GA 3C9UA 4ZHWA 3CMAF 3JATA 1YGYA 3O85A 4R40B 2VXYA 3S0WA 4IHJB 4O4JA 1JN1A 3CCEF 1NJIH 4DRXB 2OTLF 3K0TA 1X52A 2ZVZA 2PHNA 1DT9A 2ZOVA 5BMVA 2DYYA 4B46A 2K1SA 5GINC 1VQ7F 4U3JA 3G4SF 1OFUA 4BT6A 3G71F 5DCVA 5EWRA 3SIUA 3LDTA 1NMUB 3LWOC 1U40A 3LWVC 3DDNA 2UZHA 4BVSA 1RQ7A 1VK3A 2W8BC 4C8GA 1TVKB 1KC8H 3MDOA 3GTZA 1YJWF 3E22B 4I4TB 3CG6A 5J2UB 5EIBC 3HWUA 5KX5B 3CCRF 4EB6B 2HRUA 5MN6A 1N8RH 3RA6A 5LXTA 2V9YA 5LOVB 3E1YA 3G6EF 5JCOC 5JQGB 1GX1A 5KMGA 3CCMF 1E7KA 3S02A 4TUYB 4TV9A 4X1IB 4ZHVA 4ZI7B 1QVFF 4LCKA 1R1MA 5FNVA 3N2KB 3WGMA 1YITF 2IG8A 4TV8B 3HTNA 3CCJF 4I50A 5JVDA 1W2BF 3N2GB 3FFMA 4BT7A 3C8LA 3KHNA 5GAPK 5HY4A 4X3MA 3JATB 1T0AA 5LA6B 2EWCA 3RE3A 5HP7A 1XHOA 2AMTA 3LMEA 2OZBA 1CK2A 5ITZA 2KTUA 5EO3A 2OTMA 4O4IB 3WGLA 1U3PA 3PAFA 1K73H 1VH8A 3MCQA 3CC7F 5HY1A 5LYJA 3CYPB 5EYPB 1FFXA 4X3LA 4BVQA 4O4LB 1COMA 1RLUA 3ZOPA 2VGNA 1ZWZA 3UT5A 5CA1A 3CC4F 1KQSF 2HVYD 2GVIA 2LBTA 1Z5VA 3RYCA 4YJ2A 1VQPF 4O2BB 1YJ9F 3D54A 5LP6A 4X1YA 3FPIA 3K2XA 3VYTC 4HNAA 5B8FA 3JAWB 3HKDB 1RQ2A
chains in the Genus database with same CATH topology
3CYPB 4G88A 2ZVYA 3TD3A 5EB1B 4PWTA 4ERHA 3S03A 2MQEA 2ZVZA 1OAPA 2ZOVA 3KHNA 4G4ZA 3WPXA 2K1SA 4RHAA 4B5CA 3TD4A 2HQSC 3LDTA 4G4VA 3S0YA 2LBTA 2AIZP 3OONA 3S02A 4ZHYB 4G4YA 4ZHWA 4B62A 2LCAA 3CYQA 3IMPA 2L26A 4G4XA 4ZHVA 4R40B 5EB0A 2KGWA 5EAZA 3S0HA 2N48A 1R1MA 4G4WA 3S0WA 3S06A 2ZF8A 2W8BC 3TD5A 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYP B;  4G88 A;  2ZVY A;  3TD3 A;  5EB1 B;  4PWT A;  4ERH A;  3S03 A;  2MQE A;  2ZVZ A;  1OAP A;  2ZOV A;  3KHN A;  4G4Z A;  3WPX A;  2K1S A;  4RHA A;  4B5C A;  3TD4 A;  2HQS C;  3LDT A;  4G4V A;  3S0Y A;  2LBT A;  2AIZ P;  3OON A;  3S02 A;  4ZHY B;  4G4Y A;  4ZHW A;  4B62 A;  2LCA A;  3CYQ A;  3IMP A;  2L26 A;  4G4X A;  4ZHV A;  4R40 B;  5EB0 A;  2KGW A;  5EAZ A;  3S0H A;  2N48 A;  1R1M A;  4G4W A;  3S0W A;  3S06 A;  2ZF8 A;  2W8B C;  3TD5 A;  3WPW A; 
#chains in the Genus database with same CATH topology
 2ZVY A;  3VYS C;  3S03 A;  5JH7 A;  1OAP A;  1W5E A;  5GON A;  3OW2 F;  3WJQ A;  3K12 A;  1SA0 A;  3JAK B;  2RB9 A;  1JJ2 F;  1DBF A;  3ZP7 A;  2LBW A;  3LWP C;  1VQ5 F;  4ZOL A;  2HQS C;  1VHA A;  2GZL A;  1VQL F;  4F6R B;  2AIF A;  1H7M A;  3RYF A;  1JFF B;  4WBN A;  4ZHQ A;  5CB4 A;  4FFB A;  3RYI B;  1W5A A;  4EI9 A;  3NMU C;  1U3L A;  5EB1 B;  1CLI A;  3F0G A;  3JAL A;  3CXC F;  2VAP A;  1U43 A;  3CCV F;  2JNB A;  2WAL A;  2VAM A;  2KTV A;  3P10 A;  1CN7 A;  2CW4 A;  2UYJ A;  3LWQ C;  3JAS B;  2UYN B;  2Z1F A;  3HKB A;  4IIJ A;  3CCU F;  3OON A;  3RYH A;  2QI2 A;  1YQN A;  5GIO C;  3V7Q A;  1XV2 A;  1W41 A;  2L26 A;  1VQV A;  3VOA A;  2QEX F;  1GZ0 A;  3S06 A;  4X20 A;  3RA5 A;  4O4H A;  3CPQ A;  1S72 F;  5CA0 A;  4YJ2 B;  5LP6 B;  3HKC B;  3WJP A;  5EZY A;  5GIP C;  2DT4 A;  3CC2 F;  5IYZ A;  2BTQ B;  2HRY A;  1Q8R A;  3F0E A;  3VMF B;  3ZO8 A;  3BYQ A;  2ZOD A;  3OBW A;  5AVM A;  3B6N A;  3V4D A;  5GON B;  2RHH A;  2YYE A;  3M4S A;  2I6R A;  1SA0 B;  3F0D A;  5JCO A;  4G4W A;  3TD5 A;  3VYU C;  2HS3 A;  3M84 A;  1VQK F;  5G4U C;  1QD9 A;  1T0K B;  2Z1E A;  1Q86 H;  3QTY A;  2H8E A;  2G9I A;  1X25 A;  1Q82 H;  1Z5W A;  3WGN A;  4FFB B;  3NK7 A;  4C81 A;  3CPW F;  4O4J B;  1NQ3 A;  1W55 A;  1XRG A;  2CSL A;  4M8I A;  4O2A A;  1PF5 A;  1XBI A;  1FNJ A;  3JAR A;  5BMV B;  4ZHY B;  2VAW A;  4U3J B;  1M90 H;  1UI9 A;  2VGM A;  1H47 A;  2Z01 A;  4YJ3 A;  2OHW A;  3HKB B;  5EIB D;  3RYH B;  3WGJ A;  1QU9 A;  2QA4 F;  2Q1X A;  4BT5 A;  3M1X A;  3N4Z A;  1VQ4 F;  3HKE A;  4IHJ A;  2FC3 A;  4X20 B;  2CZW A;  4DRX A;  5CA0 B;  1YJN F;  4NWO B;  2H8C A;  1JD1 A;  3HJW C;  3V7E A;  3WXM B;  1KNK A;  2IAF A;  1VQN F;  2Z1T A;  3AGK A;  4XCQ A;  3S0H A;  2N48 A;  3KJJ A;  3VOB A;  1X7P A;  4BY9 D;  3CD6 F;  5LXT B;  4G88 A;  2HX0 A;  3VTI C;  1RLG A;  5KMG B;  3IR9 A;  2Q1Y A;  1GO1 A;  3QUW A;  3CCQ F;  4TV9 B;  4B5C A;  3OBY A;  5MN5 A;  1K9M H;  5FNV B;  3NVI B;  5HXU A;  4NQ3 A;  4BVR A;  3S0Y A;  3JCM M;  5J2T A;  5MN4 A;  4I50 B;  5JVD B;  5G4V C;  1GO0 A;  3WGK A;  3J7A R;  1JY8 A;  5GAN K;  5KX5 A;  2LCA A;  1QVG F;  5HXZ A;  3FBA A;  4G4X A;  1VQ8 F;  4O2A B;  3ERN A;  3WPW A;  5LOV A;  3ZP4 A;  2CVL A;  1W40 A;  4ERH A;  5JQG A;  4X1K A;  1QAH A;  4C82 A;  3J80 M;  4C8E A;  1SDS A;  3JAR B;  3P4E A;  3PLA C;  1IPA A;  5C8Y A;  5ITZ B;  3ELC A;  4TUY A;  1VQO F;  3WJR A;  4ZI7 A;  1KNJ A;  4C8I A;  3N2K A;  4KWE A;  4TV8 A;  3I56 F;  4DXD A;  2Z1U A;  5IJ9 A;  5LYJ B;  5HWE A;  1FFX B;  3GHZ A;  1X7O A;  3KIZ A;  3N4Y A;  2HP3 A;  4BVT A;  3CYQ A;  3ON1 A;  3U0O A;  5LA6 A;  2HS0 A;  3FD6 A;  3HKE B;  3UT5 B;  2RHJ A;  4I55 A;  2ZF8 A;  1UFY A;  4U39 A;  1PXW A;  5CA1 B;  2BTU A;  3TD3 A;  1FNK A;  3CCL F;  5FLX M;  3RYC B;  4O4I A;  3MQW A;  4EI8 A;  4X1Y B;  2HP0 A;  2UYP A;  3QHD A;  3CME F;  1W57 A;  3VO8 A;  1IV1 A;  4HNA B;  3T80 A;  5HP8 A;  4E6E A;  5IT9 M;  3MCA B;  5EYP A;  4BT4 A;  1Q7Y H;  5IJ0 A;  3NVK E;  2FGY A;  4O4L A;  5JH7 B;  3FD5 A;  4B45 A;  3C9R A;  3LWR C;  3E20 B;  2QTP A;  1TUB A;  5EAZ A;  2R6R 1;  3IKF A;  3KJK A;  5HY2 A;  1H48 A;  4ZOL B;  1ONI A;  3CB2 A;  5J2T B;  3K14 A;  4C4W C;  2B33 A;  2PMP A;  3IKE A;  3J81 M;  3JVH A;  2ZAU A;  2RHL A;  4O2B A;  3RYF B;  3LFO A;  2BTO A;  4WBN B;  4ZHQ B;  5CB4 B;  1J7H A;  3I7T A;  3EOR A;  3JAW A;  3HKD A;  3TD4 A;  2CHS A;  2ALE A;  2CWJ A;  4LNU A;  4X1K B;  2CHT A;  2UYK A;  3I55 F;  5C8Y B;  1W5F A;  2KG4 A;  3P0Z A;  2AIZ P;  3JAL B;  4RQO A;  4ZK7 A;  1YIJ F;  3JAK A;  1VQM F;  3MBM A;  3VIU A;  3I3F A;  2F9Z C;  1RA4 A;  2P6Y A;  2R75 1;  5IJ9 B;  2BO1 A;  2OTJ F;  4F6R A;  3VCZ A;  2HS4 A;  1JFF A;  3JAM M;  4IIJ B;  5A2Q M;  3WPX A;  3IEW A;  3RYI A;  2I6D A;  1YHQ F;  3LYB A;  4I55 B;  1W5B A;  2YXZ A;  3D01 A;  1KD1 H;  4G4V A;  4O4H B;  2H6L A;  4BW0 B;  4EI7 A;  2HP0 B;  4B62 A;  5EZY B;  3HAX D;  2KGW A;  5IYZ B;  1K8A H;  3NK6 A;  3CCS F;  3C9S A;  3JAS A;  1W58 1;  2UYN A;  4PWT A;  5HY0 A;  3V3T A;  5IJ0 B;  2MQE A;  2RHO A;  1SZQ A;  2NMU A;  4G4Z A;  4BT3 A;  4RHA A;  3IEQ A;  1W59 A;  1TUB B;  5LP6 C;  3D00 A;  3GYQ A;  3F6M A;  2LBX A;  3ESJ A;  1TVK A;  1W3E X;  1Q81 H;  3L7Q A;  2GLZ A;  4BT2 A;  3E22 A;  4TZZ A;  4NUT A;  3HKC A;  4I4T A;  3KE1 A;  5J2U A;  4G4Y A;  3IMP A;  1IV2 A;  5EB0 A;  4EB6 A;  5FJ4 C;  1IV3 A;  2IQQ A;  1FSZ A;  3F0F A;  4LNU B;  3SIV A;  1IV4 A;  1YI2 F;  1ODE A;  1M1K H;  4X1I A;  1VQ9 F;  3Q8H A;  1VQ6 F;  3VI6 A;  3C9T A;  3DC2 A;  3R0P A;  4YJ3 B;  1W42 A;  3N2G A;  3C9U A;  4ZHW A;  3CMA F;  3JAT A;  1YGY A;  3O85 A;  4R40 B;  2VXY A;  3S0W A;  4IHJ B;  4O4J A;  1JN1 A;  3CCE F;  1NJI H;  4DRX B;  2OTL F;  3K0T A;  1X52 A;  2ZVZ A;  2PHN A;  1DT9 A;  2ZOV A;  5BMV A;  2DYY A;  4B46 A;  2K1S A;  5GIN C;  1VQ7 F;  4U3J A;  3G4S F;  1OFU A;  4BT6 A;  3G71 F;  5DCV A;  5EWR A;  3SIU A;  3LDT A;  1NMU B;  3LWO C;  1U40 A;  3LWV C;  3DDN A;  2UZH A;  4BVS A;  1RQ7 A;  1VK3 A;  2W8B C;  4C8G A;  1TVK B;  1KC8 H;  3MDO A;  3GTZ A;  1YJW F;  3E22 B;  4I4T B;  3CG6 A;  5J2U B;  5EIB C;  3HWU A;  5KX5 B;  3CCR F;  4EB6 B;  2HRU A;  5MN6 A;  1N8R H;  3RA6 A;  5LXT A;  2V9Y A;  5LOV B;  3E1Y A;  3G6E F;  5JCO C;  5JQG B;  1GX1 A;  5KMG A;  3CCM F;  1E7K A;  3S02 A;  4TUY B;  4TV9 A;  4X1I B;  4ZHV A;  4ZI7 B;  1QVF F;  4LCK A;  1R1M A;  5FNV A;  3N2K B;  3WGM A;  1YIT F;  2IG8 A;  4TV8 B;  3HTN A;  3CCJ F;  4I50 A;  5JVD A;  1W2B F;  3N2G B;  3FFM A;  4BT7 A;  3C8L A;  3KHN A;  5GAP K;  5HY4 A;  4X3M A;  3JAT B;  1T0A A;  5LA6 B;  2EWC A;  3RE3 A;  5HP7 A;  1XHO A;  2AMT A;  3LME A;  2OZB A;  1CK2 A;  5ITZ A;  2KTU A;  5EO3 A;  2OTM A;  4O4I B;  3WGL A;  1U3P A;  3PAF A;  1K73 H;  1VH8 A;  3MCQ A;  3CC7 F;  5HY1 A;  5LYJ A;  3CYP B;  5EYP B;  1FFX A;  4X3L A;  4BVQ A;  4O4L B;  1COM A;  1RLU A;  3ZOP A;  2VGN A;  1ZWZ A;  3UT5 A;  5CA1 A;  3CC4 F;  1KQS F;  2HVY D;  2GVI A;  2LBT A;  1Z5V A;  3RYC A;  4YJ2 A;  1VQP F;  4O2B B;  1YJ9 F;  3D54 A;  5LP6 A;  4X1Y A;  3FPI A;  3K2X A;  3VYT C;  4HNA A;  5B8F A;  3JAW B;  3HKD B;  1RQ2 A; 
#chains in the Genus database with same CATH homology
 3CYP B;  4G88 A;  2ZVY A;  3TD3 A;  5EB1 B;  4PWT A;  4ERH A;  3S03 A;  2MQE A;  2ZVZ A;  1OAP A;  2ZOV A;  3KHN A;  4G4Z A;  3WPX A;  2K1S A;  4RHA A;  4B5C A;  3TD4 A;  2HQS C;  3LDT A;  4G4V A;  3S0Y A;  2LBT A;  2AIZ P;  3OON A;  3S02 A;  4ZHY B;  4G4Y A;  4ZHW A;  4B62 A;  2LCA A;  3CYQ A;  3IMP A;  2L26 A;  4G4X A;  4ZHV A;  4R40 B;  5EB0 A;  2KGW A;  5EAZ A;  3S0H A;  2N48 A;  1R1M A;  4G4W A;  3S0W A;  3S06 A;  2ZF8 A;  2W8B C;  3TD5 A;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...