4B5CA

Crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
DPLNDPNSPLAKRSVYFDFDSYSVQDQYQALLQQHAQYLKSHPQRHILIQGNTDERGTSEYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Burkholderia Pseudomallei Acute Phase Antigen Bpsl2765 for Structure-Based Epitope Discovery/Design in Structural Vaccinology.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lipid transport
molecule keywords PUTATIVE OMPA FAMILY LIPOPROTEIN
total genus 45
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b5cA00
3CYPB 2ZVZA 1OAPA 4ERHA 3S03A 4G4WA 3CYQA 3TD3A 3WPWA 2W8BC 4B62A 3KHNA 2ZF8A 2AIZP 2ZVYA 3LDTA 2ZOVA 3S0WA 4ZHWA 3S02A 2N48A 3IMPA 2K1SA 3TD4A 4RHAA 4G88A 4G4XA 2MQEA 2LBTA 4G4ZA 3S06A 4B5CA 3S0YA 2KGWA 1R1MA 3TD5A 2L26A 5EB1B 4G4YA 3WPXA 4ZHYB 4R40B 4G4VA 2LCAA 4PWTA 4ZHVA 3OONA 2HQSC 5EB0A 3S0HA 5EAZA
chains in the Genus database with same CATH superfamily
4B45A 1JJ2F 2QI2A 5IJ0B 3VI6A 4TV8A 4X3MA 5EZYB 2UYPA 4X20A 4O4HA 5HP7A 4U3JB 3IR9A 5EYPB 2GZLA 2CWJA 4M8IA 3G71F 3G6EF 4EI7A 3LWRC 1Q82H 3E22B 2LBWA 2P6YA 2LBXA 3IEWA 2OTMA 1KNKA 1IV3A 1H47A 5EB0A 4TUYA 1GO0A 1Q81H 1VH8A 3HKDA 4WBNB 2I6RA 3RE3A 5GIPC 4NQ3A 3I7TA 4ZI7B 4F6RB 3ELCA 5LYJA 3V7QA 3PLAC 1CN7A 5HY4A 1UFYA 4G4XA 3SIUA 2RHOA 4U39A 2QEXF 4TV9A 3TD5A 4KWEA 3CC7F 4BVQA 3JCMM 3RYFB 5HY0A 3P4EA 3FFMA 4TV9B 3LYBA 4ZHVA 3I56F 2Q1YA 5HXUA 3V7EA 3VYUC 3F0EA 4XCQA 3WGMA 4BT3A 1W55A 4C82A 5IJ9A 3F0DA 3KE1A 3WGJA 3I3FA 5AVMA 5CB4A 2K1SA 3VYSC 2HRYA 2ZAUA 5HY1A 1XRGA 5EIBD 2MQEA 3S0YA 5GAPK 2BTQB 3RYCA 3LWOC 3N4YA 3CCVF 5LOVB 3WGLA 4O4LB 5KMGB 3F0GA 1X25A 1Q86H 3GTZA 1T0AA 5FNVA 5JH7B 1E7KA 1W3EX 2R751 3NK6A 3OBWA 5IT9M 2HX0A 2W8BC 2BTUA 5GANK 3CCMF 3CMEF 5JCOA 3PAFA 3HTNA 1VQPF 4ZHQA 1W59A 4C4WC 3K12A 4BY9D 5B8FA 4YJ2B 3K2XA 3CCLF 3HKEA 1SA0B 3WPXA 3LMEA 4ZHYB 5FLXM 1GO1A 1T0KB 2QA4F 1GX1A 1S72F 2CVLA 4BT6A 1JD1A 4BT5A 5LYJB 3RYHB 1RLUA 4X1YA 1X7PA 3JARA 1K9MH 3N2GB 1W5FA 3NK7A 4X1IA 2VAPA 3LDTA 3I55F 4BW0B 4X1YB 3TD4A 4I4TB 3C8LA 2Z01A 5JVDB 3VYTC 1GZ0A 1QVGF 1OFUA 3ZOPA 2WALA 4HNAB 5HWEA 3P0ZA 1Q8RA 1TUBA 3D00A 1RA4A 2ALEA 4DXDA 4DRXB 1YIJF 1K8AH 3KJKA 3S0HA 5EAZA 3WJPA 4E6EA 1IV4A 5GINC 4G4WA 3QHDA 4O4HB 2IQQA 4O4JA 1RQ2A 5HP8A 1M90H 4LNUB 3DC2A 1YQNA 1NMUB 4BT2A 5J2UA 2Z1FA 4ZHWA 3CD6F 4BVRA 4WBNA 1IV2A 4YJ2A 1X7OA 3WGNA 4O2BA 1QU9A 5EZYA 1J7HA 5MN6A 3LWQC 5LXTB 3JAKB 2OZBA 3HKBB 3CPQA 4PWTA 2R6R1 5EO3A 4BT4A 1U40A 3AGKA 3E22A 4X1KB 1VQMF 4IHJA 3S03A 3P10A 1VQ5F 5IYZB 3WJQA 1VQNF 5MN4A 2UZHA 4C81A 1CK2A 2HP0B 1YGYA 1YHQF 2DYYA 3S02A 3CCJF 5G4VC 2VAMA 2EWCA 3HKCA 4G4ZA 3GHZA 5GONA 1ODEA 2Z1TA 4ZI7A 1FFXB 1QD9A 1XV2A 1FNJA 4IHJB 5GIOC 2KG4A 2JNBA 5BMVA 2HS4A 1SZQA 3LWPC 3QTYA 5LXTA 4TZZA 3KIZA 1VQLF 1KNJA 3JAKA 3T80A 3CXCF 1JFFB 3E20B 1X52A 4YJ3B 3FBAA 4X1KA 3JVHA 3RYIA 2AIZP 1CLIA 1YI2F 4HNAA 2OTJF 2HP3A 3VOAA 5ITZB 4ZHQB 1W5EA 4X20B 3VCZA 5HY2A 3CCSF 2HQSC 1XBIA 3JARB 4RQOA 1TUBB 2RB9A 3ERNA 2HS0A 3ZP7A 2CW4A 3LWVC 3M1XA 3C9SA 1KD1H 5CA0A 2HVYD 1VK3A 3JALA 2H8CA 1IPAA 4RHAA 4YJ3A 4O2AA 3CC4F 1H7MA 2BO1A 5EB1B 4G4YA 3MQWA 3CB2A 2YXZA 3DDNA 3E1YA 3J80M 1ONIA 2RHLA 3IKFA 3JASA 2UYJA 5IJ9B 1UI9A 5KX5B 1IV1A 4EB6B 4NUTA 3B6NA 3CYPB 1COMA 1U3PA 3K14A 5CA1A 2RHHA 3TD3A 5EYPA 1W2BF 4TUYB 5LP6C 4B46A 5EIBC 5GONB 2ZOVA 4IIJA 1TVKB 2V9YA 2Z1EA 5JQGB 3RYCB 2UYKA 4I50B 4LNUA 3HJWC 3C9RA 3VTIC 3HKEB 3JASB 3JALB 1M1KH 5C8YB 3C9UA 2QTPA 3F0FA 5CB4B 3JATA 2G9IA 3F6MA 5C8YA 2CSLA 4ZK7A 3RYFA 1NJIH 5IJ0A 5CA0B 4O4LA 1TVKA 4O4IB 1U3LA 3C9TA 2UYNB 3KHNA 4C8GA 4O2BB 1VQ7F 4I4TA 2OTLF 2VXYA 3M4SA 1FNKA 3V4DA 2I6DA 3QUWA 3GYQA 1DBFA 3ZP4A 3OBYA 3ESJA 1VQ4F 3NMUC 5LOVA 2RHJA 2YYEA 2DT4A 4FFBA 5LA6A 1R1MA 1VQKF 3VOBA 4I55B 2NMUA 4F6RA 3NVKE 2OHWA 5JVDA 3FPIA 3RA5A 5EWRA 3EORA 3UT5A 3R0PA 1SDSA 2ZVZA 3HKDB 4X1IB 3HAXD 5BMVB 1OAPA 3JAMM 4C8IA 1QVFF 3M84A 3WGKA 3MDOA 3WXMB 5HXZA 1KC8H 4O4JB 5ITZA 3VMFB 4G88A 4BT7A 5LP6B 5JH7A 2IAFA 5DCVA 1Z5WA 1PXWA 2H6LA 3OONA 4ZOLA 3WJRA 3CMAF 4O4IA 3ZO8A 1SA0A 1VQVA 2HP0A 2H8EA 3NVIB 2CHSA 3N2KA 3O85A 1JY8A 3IKEA 1VQ9F 2ZODA 2AIFA 2HRUA 2ZF8A 4O2AB 3N2KB 3L7QA 3CG6A 3S0WA 2VAWA 3IMPA 2IG8A 3HKBA 2VGMA 3S06A 3CC2F 4B5CA 4X3LA 1W581 5KMGA 1YJWF 3FD5A 3SIVA 1W5AA 4IIJB 5FNVB 4NWOB 3N4ZA 1RLGA 2LCAA 5CA1B 5LP6A 1N8RH 2PHNA 3J81M 3D54A 3JAWA 3CYQA 5MN5A 4B62A 3WPWA 4EI9A 4BVSA 2Z1UA 1RQ7A 4EI8A 4I50A 1W40A 1VHAA 2FC3A 4I55A 1VQ8F 3U0OA 1PF5A 2GLZA 3RYIB 4C8EA 1ZWZA 5J2UB 2L26A 3CCQF 1K73H 2HS3A 2BTOA 5J2TA 5A2QM 1NQ3A 1VQOF 1KQSF 2AMTA 3CCUF 4FFBB 5LA6B 1Q7YH 3HWUA 5FJ4C 1DT9A 3MCQA 3N2GA 4ERHA 3V3TA 3FD6A 4DRXA 3LFOA 4LCKA 3IEQA 3RA6A 4U3JA 5JCOC 1YJNF 3ON1A 3HKCB 1JN1A 1H48A 1QAHA 2B33A 5J2TB 2VGNA 1YITF 2GVIA 2KGWA 1Z5VA 3MCAB 3VO8A 5JQGA 1FSZA 3UT5B 4R40B 4G4VA 1U43A 3CPWF 1W42A 4BVTA 3RYHA 1W5BA 3OW2F 1JFFA 1YJ9F 3CCRF 4TV8B 3MBMA 2CZWA 2PMPA 3J7AR 5KX5A 3K0TA 4ZOLB 2CHTA 3CCEF 3JAWB 3VIUA 2KTVA 2Q1XA 2ZVYA 3Q8HA 2N48A 3KJJA 2UYNA 1W41A 2KTUA 3BYQA 3JATB 1VQ6F 2LBTA 2F9ZC 1XHOA 3D01A 4EB6A 1W57A 5G4UC 3G4SF 5IYZA 2FGYA 1FFXA
chains in the Genus database with same CATH topology
3CYPB 2ZVZA 1OAPA 4ERHA 3S03A 4G4WA 3CYQA 3TD3A 3WPWA 2W8BC 4B62A 3KHNA 2ZF8A 2AIZP 2ZVYA 3LDTA 2ZOVA 3S0WA 4ZHWA 3S02A 2N48A 3IMPA 2K1SA 3TD4A 4RHAA 4G88A 4G4XA 2MQEA 2LBTA 4G4ZA 3S06A 4B5CA 3S0YA 2KGWA 1R1MA 3TD5A 2L26A 5EB1B 4G4YA 3WPXA 4ZHYB 4R40B 4G4VA 2LCAA 4PWTA 4ZHVA 3OONA 2HQSC 5EB0A 3S0HA 5EAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYP B;  2ZVZ A;  1OAP A;  4ERH A;  3S03 A;  4G4W A;  3CYQ A;  3TD3 A;  3WPW A;  2W8B C;  4B62 A;  3KHN A;  2ZF8 A;  2AIZ P;  2ZVY A;  3LDT A;  2ZOV A;  3S0W A;  4ZHW A;  3S02 A;  2N48 A;  3IMP A;  2K1S A;  3TD4 A;  4RHA A;  4G88 A;  4G4X A;  2MQE A;  2LBT A;  4G4Z A;  3S06 A;  4B5C A;  3S0Y A;  2KGW A;  1R1M A;  3TD5 A;  2L26 A;  5EB1 B;  4G4Y A;  3WPX A;  4ZHY B;  4R40 B;  4G4V A;  2LCA A;  4PWT A;  4ZHV A;  3OON A;  2HQS C;  5EB0 A;  3S0H A;  5EAZ A; 
#chains in the Genus database with same CATH topology
 4B45 A;  1JJ2 F;  2QI2 A;  5IJ0 B;  3VI6 A;  4TV8 A;  4X3M A;  5EZY B;  2UYP A;  4X20 A;  4O4H A;  5HP7 A;  4U3J B;  3IR9 A;  5EYP B;  2GZL A;  2CWJ A;  4M8I A;  3G71 F;  3G6E F;  4EI7 A;  3LWR C;  1Q82 H;  3E22 B;  2LBW A;  2P6Y A;  2LBX A;  3IEW A;  2OTM A;  1KNK A;  1IV3 A;  1H47 A;  5EB0 A;  4TUY A;  1GO0 A;  1Q81 H;  1VH8 A;  3HKD A;  4WBN B;  2I6R A;  3RE3 A;  5GIP C;  4NQ3 A;  3I7T A;  4ZI7 B;  4F6R B;  3ELC A;  5LYJ A;  3V7Q A;  3PLA C;  1CN7 A;  5HY4 A;  1UFY A;  4G4X A;  3SIU A;  2RHO A;  4U39 A;  2QEX F;  4TV9 A;  3TD5 A;  4KWE A;  3CC7 F;  4BVQ A;  3JCM M;  3RYF B;  5HY0 A;  3P4E A;  3FFM A;  4TV9 B;  3LYB A;  4ZHV A;  3I56 F;  2Q1Y A;  5HXU A;  3V7E A;  3VYU C;  3F0E A;  4XCQ A;  3WGM A;  4BT3 A;  1W55 A;  4C82 A;  5IJ9 A;  3F0D A;  3KE1 A;  3WGJ A;  3I3F A;  5AVM A;  5CB4 A;  2K1S A;  3VYS C;  2HRY A;  2ZAU A;  5HY1 A;  1XRG A;  5EIB D;  2MQE A;  3S0Y A;  5GAP K;  2BTQ B;  3RYC A;  3LWO C;  3N4Y A;  3CCV F;  5LOV B;  3WGL A;  4O4L B;  5KMG B;  3F0G A;  1X25 A;  1Q86 H;  3GTZ A;  1T0A A;  5FNV A;  5JH7 B;  1E7K A;  1W3E X;  2R75 1;  3NK6 A;  3OBW A;  5IT9 M;  2HX0 A;  2W8B C;  2BTU A;  5GAN K;  3CCM F;  3CME F;  5JCO A;  3PAF A;  3HTN A;  1VQP F;  4ZHQ A;  1W59 A;  4C4W C;  3K12 A;  4BY9 D;  5B8F A;  4YJ2 B;  3K2X A;  3CCL F;  3HKE A;  1SA0 B;  3WPX A;  3LME A;  4ZHY B;  5FLX M;  1GO1 A;  1T0K B;  2QA4 F;  1GX1 A;  1S72 F;  2CVL A;  4BT6 A;  1JD1 A;  4BT5 A;  5LYJ B;  3RYH B;  1RLU A;  4X1Y A;  1X7P A;  3JAR A;  1K9M H;  3N2G B;  1W5F A;  3NK7 A;  4X1I A;  2VAP A;  3LDT A;  3I55 F;  4BW0 B;  4X1Y B;  3TD4 A;  4I4T B;  3C8L A;  2Z01 A;  5JVD B;  3VYT C;  1GZ0 A;  1QVG F;  1OFU A;  3ZOP A;  2WAL A;  4HNA B;  5HWE A;  3P0Z A;  1Q8R A;  1TUB A;  3D00 A;  1RA4 A;  2ALE A;  4DXD A;  4DRX B;  1YIJ F;  1K8A H;  3KJK A;  3S0H A;  5EAZ A;  3WJP A;  4E6E A;  1IV4 A;  5GIN C;  4G4W A;  3QHD A;  4O4H B;  2IQQ A;  4O4J A;  1RQ2 A;  5HP8 A;  1M90 H;  4LNU B;  3DC2 A;  1YQN A;  1NMU B;  4BT2 A;  5J2U A;  2Z1F A;  4ZHW A;  3CD6 F;  4BVR A;  4WBN A;  1IV2 A;  4YJ2 A;  1X7O A;  3WGN A;  4O2B A;  1QU9 A;  5EZY A;  1J7H A;  5MN6 A;  3LWQ C;  5LXT B;  3JAK B;  2OZB A;  3HKB B;  3CPQ A;  4PWT A;  2R6R 1;  5EO3 A;  4BT4 A;  1U40 A;  3AGK A;  3E22 A;  4X1K B;  1VQM F;  4IHJ A;  3S03 A;  3P10 A;  1VQ5 F;  5IYZ B;  3WJQ A;  1VQN F;  5MN4 A;  2UZH A;  4C81 A;  1CK2 A;  2HP0 B;  1YGY A;  1YHQ F;  2DYY A;  3S02 A;  3CCJ F;  5G4V C;  2VAM A;  2EWC A;  3HKC A;  4G4Z A;  3GHZ A;  5GON A;  1ODE A;  2Z1T A;  4ZI7 A;  1FFX B;  1QD9 A;  1XV2 A;  1FNJ A;  4IHJ B;  5GIO C;  2KG4 A;  2JNB A;  5BMV A;  2HS4 A;  1SZQ A;  3LWP C;  3QTY A;  5LXT A;  4TZZ A;  3KIZ A;  1VQL F;  1KNJ A;  3JAK A;  3T80 A;  3CXC F;  1JFF B;  3E20 B;  1X52 A;  4YJ3 B;  3FBA A;  4X1K A;  3JVH A;  3RYI A;  2AIZ P;  1CLI A;  1YI2 F;  4HNA A;  2OTJ F;  2HP3 A;  3VOA A;  5ITZ B;  4ZHQ B;  1W5E A;  4X20 B;  3VCZ A;  5HY2 A;  3CCS F;  2HQS C;  1XBI A;  3JAR B;  4RQO A;  1TUB B;  2RB9 A;  3ERN A;  2HS0 A;  3ZP7 A;  2CW4 A;  3LWV C;  3M1X A;  3C9S A;  1KD1 H;  5CA0 A;  2HVY D;  1VK3 A;  3JAL A;  2H8C A;  1IPA A;  4RHA A;  4YJ3 A;  4O2A A;  3CC4 F;  1H7M A;  2BO1 A;  5EB1 B;  4G4Y A;  3MQW A;  3CB2 A;  2YXZ A;  3DDN A;  3E1Y A;  3J80 M;  1ONI A;  2RHL A;  3IKF A;  3JAS A;  2UYJ A;  5IJ9 B;  1UI9 A;  5KX5 B;  1IV1 A;  4EB6 B;  4NUT A;  3B6N A;  3CYP B;  1COM A;  1U3P A;  3K14 A;  5CA1 A;  2RHH A;  3TD3 A;  5EYP A;  1W2B F;  4TUY B;  5LP6 C;  4B46 A;  5EIB C;  5GON B;  2ZOV A;  4IIJ A;  1TVK B;  2V9Y A;  2Z1E A;  5JQG B;  3RYC B;  2UYK A;  4I50 B;  4LNU A;  3HJW C;  3C9R A;  3VTI C;  3HKE B;  3JAS B;  3JAL B;  1M1K H;  5C8Y B;  3C9U A;  2QTP A;  3F0F A;  5CB4 B;  3JAT A;  2G9I A;  3F6M A;  5C8Y A;  2CSL A;  4ZK7 A;  3RYF A;  1NJI H;  5IJ0 A;  5CA0 B;  4O4L A;  1TVK A;  4O4I B;  1U3L A;  3C9T A;  2UYN B;  3KHN A;  4C8G A;  4O2B B;  1VQ7 F;  4I4T A;  2OTL F;  2VXY A;  3M4S A;  1FNK A;  3V4D A;  2I6D A;  3QUW A;  3GYQ A;  1DBF A;  3ZP4 A;  3OBY A;  3ESJ A;  1VQ4 F;  3NMU C;  5LOV A;  2RHJ A;  2YYE A;  2DT4 A;  4FFB A;  5LA6 A;  1R1M A;  1VQK F;  3VOB A;  4I55 B;  2NMU A;  4F6R A;  3NVK E;  2OHW A;  5JVD A;  3FPI A;  3RA5 A;  5EWR A;  3EOR A;  3UT5 A;  3R0P A;  1SDS A;  2ZVZ A;  3HKD B;  4X1I B;  3HAX D;  5BMV B;  1OAP A;  3JAM M;  4C8I A;  1QVF F;  3M84 A;  3WGK A;  3MDO A;  3WXM B;  5HXZ A;  1KC8 H;  4O4J B;  5ITZ A;  3VMF B;  4G88 A;  4BT7 A;  5LP6 B;  5JH7 A;  2IAF A;  5DCV A;  1Z5W A;  1PXW A;  2H6L A;  3OON A;  4ZOL A;  3WJR A;  3CMA F;  4O4I A;  3ZO8 A;  1SA0 A;  1VQV A;  2HP0 A;  2H8E A;  3NVI B;  2CHS A;  3N2K A;  3O85 A;  1JY8 A;  3IKE A;  1VQ9 F;  2ZOD A;  2AIF A;  2HRU A;  2ZF8 A;  4O2A B;  3N2K B;  3L7Q A;  3CG6 A;  3S0W A;  2VAW A;  3IMP A;  2IG8 A;  3HKB A;  2VGM A;  3S06 A;  3CC2 F;  4B5C A;  4X3L A;  1W58 1;  5KMG A;  1YJW F;  3FD5 A;  3SIV A;  1W5A A;  4IIJ B;  5FNV B;  4NWO B;  3N4Z A;  1RLG A;  2LCA A;  5CA1 B;  5LP6 A;  1N8R H;  2PHN A;  3J81 M;  3D54 A;  3JAW A;  3CYQ A;  5MN5 A;  4B62 A;  3WPW A;  4EI9 A;  4BVS A;  2Z1U A;  1RQ7 A;  4EI8 A;  4I50 A;  1W40 A;  1VHA A;  2FC3 A;  4I55 A;  1VQ8 F;  3U0O A;  1PF5 A;  2GLZ A;  3RYI B;  4C8E A;  1ZWZ A;  5J2U B;  2L26 A;  3CCQ F;  1K73 H;  2HS3 A;  2BTO A;  5J2T A;  5A2Q M;  1NQ3 A;  1VQO F;  1KQS F;  2AMT A;  3CCU F;  4FFB B;  5LA6 B;  1Q7Y H;  3HWU A;  5FJ4 C;  1DT9 A;  3MCQ A;  3N2G A;  4ERH A;  3V3T A;  3FD6 A;  4DRX A;  3LFO A;  4LCK A;  3IEQ A;  3RA6 A;  4U3J A;  5JCO C;  1YJN F;  3ON1 A;  3HKC B;  1JN1 A;  1H48 A;  1QAH A;  2B33 A;  5J2T B;  2VGN A;  1YIT F;  2GVI A;  2KGW A;  1Z5V A;  3MCA B;  3VO8 A;  5JQG A;  1FSZ A;  3UT5 B;  4R40 B;  4G4V A;  1U43 A;  3CPW F;  1W42 A;  4BVT A;  3RYH A;  1W5B A;  3OW2 F;  1JFF A;  1YJ9 F;  3CCR F;  4TV8 B;  3MBM A;  2CZW A;  2PMP A;  3J7A R;  5KX5 A;  3K0T A;  4ZOL B;  2CHT A;  3CCE F;  3JAW B;  3VIU A;  2KTV A;  2Q1X A;  2ZVY A;  3Q8H A;  2N48 A;  3KJJ A;  2UYN A;  1W41 A;  2KTU A;  3BYQ A;  3JAT B;  1VQ6 F;  2LBT A;  2F9Z C;  1XHO A;  3D01 A;  4EB6 A;  1W57 A;  5G4U C;  3G4S F;  5IYZ A;  2FGY A;  1FFX A; 
#chains in the Genus database with same CATH homology
 3CYP B;  2ZVZ A;  1OAP A;  4ERH A;  3S03 A;  4G4W A;  3CYQ A;  3TD3 A;  3WPW A;  2W8B C;  4B62 A;  3KHN A;  2ZF8 A;  2AIZ P;  2ZVY A;  3LDT A;  2ZOV A;  3S0W A;  4ZHW A;  3S02 A;  2N48 A;  3IMP A;  2K1S A;  3TD4 A;  4RHA A;  4G88 A;  4G4X A;  2MQE A;  2LBT A;  4G4Z A;  3S06 A;  4B5C A;  3S0Y A;  2KGW A;  1R1M A;  3TD5 A;  2L26 A;  5EB1 B;  4G4Y A;  3WPX A;  4ZHY B;  4R40 B;  4G4V A;  2LCA A;  4PWT A;  4ZHV A;  3OON A;  2HQS C;  5EB0 A;  3S0H A;  5EAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...