4B5CA

Crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
DPLNDPNSPLAKRSVYFDFDSYSVQDQYQALLQQHAQYLKSHPQRHILIQGNTDERGTSEYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploiting the Burkholderia Pseudomallei Acute Phase Antigen Bpsl2765 for Structure-Based Epitope Discovery/Design in Structural Vaccinology.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lipid transport
molecule keywords PUTATIVE OMPA FAMILY LIPOPROTEIN
total genus 45
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b5cA00
3TD4A 3S0YA 4B62A 3S0WA 3S03A 4RHAA 3CYPB 2ZVZA 2KGWA 3S0HA 4G4XA 5EAZA 4ERHA 3S02A 3TD5A 3LDTA 2N48A 3IMPA 2K1SA 4G4WA 4G4ZA 1R1MA 1OAPA 2L26A 4ZHVA 2AIZP 2ZF8A 2LCAA 2HQSC 5EB0A 5EB1B 2LBTA 4G4VA 2W8BC 2MQEA 3S06A 2ZVYA 3CYQA 3TD3A 4B5CA 4G4YA 3WPXA 4ZHYB 4PWTA 4R40B 3OONA 4G88A 3KHNA 2ZOVA 4ZHWA 3WPWA
chains in the Genus database with same CATH superfamily
5IYZA 2RHLA 4EI9A 4X20A 4EB6A 1T0AA 4BY9D 3M1XA 3VMFB 3N2KA 4KWEA 4TUYB 1VHAA 1K73H 3F0FA 3IR9A 5KMGA 3JALA 3MBMA 1K9MH 5LA6B 2AIZP 3HKDB 1CK2A 1RA4A 3UT5B 1VQ5F 5G4UC 4G4VA 5GONB 3N4YA 4I4TB 5HXZA 2UYNB 5JCOA 5J2TA 5MN5A 4I55A 1Q81H 3IEQA 1PXWA 1RQ2A 4O2AA 4ZHWA 3RYFA 4C8IA 4F6RA 5FNVA 3CCUF 3ZP4A 3CMEF 1XHOA 3VIUA 2DT4A 1VQLF 3FD5A 4F6RB 3RYCA 3R0PA 5HY0A 3JARA 1KNJA 3KJKA 2I6RA 2QTPA 3LWPC 1Z5VA 3RYIA 3K14A 1VQVA 3DDNA 4EI7A 4C81A 5ITZB 3RYIB 2BTOA 3JAKA 1W5BA 3JASB 4ZHQA 1X25A 4M8IA 3ZOPA 3CD6F 1DBFA 3N2KB 4TV9A 3WJRA 3D00A 2RHHA 1FNJA 4I50B 3WJPA 5J2UA 2VGNA 4X1IB 3LYBA 3BYQA 1QD9A 3P4EA 1QVGF 1Q7YH 3CXCF 1IV4A 4B45A 3LWQC 3JAMM 1VQ7F 1VQNF 2G9IA 4G4ZA 5DCVA 3I55F 4YJ3B 4X1KB 3NVKE 4X3MA 1IV3A 5CB4A 4ZOLB 2QEXF 2UYJA 4YJ2A 2HRYA 2OTJF 3CCLF 2KTUA 2CHTA 5GANK 1VQ8F 3CMAF 4BVTA 2KTVA 4IIJB 3ZP7A 4B62A 1QU9A 4ZI7A 4BVQA 4X1KA 4O4JA 3G71F 3P0ZA 4G4XA 2HS4A 1OFUA 1VQKF 1JD1A 1FFXB 4YJ2B 3EORA 3I56F 2K1SA 4BT3A 4X1IA 1YJ9F 4BT4A 3VYUC 5IYZB 2V9YA 2W8BC 5LP6A 5JCOC 3J81M 1GZ0A 3V7EA 1U3LA 1VK3A 3CCEF 4IIJA 5HY1A 3WPWA 5JVDA 3O85A 3GYQA 4RHAA 4ZOLA 4I50A 1VQOF 3HWUA 3K12A 3CCSF 3C9UA 2N48A 1QVFF 1XRGA 2PHNA 3OW2F 1H7MA 1TVKA 2F9ZC 1VQ6F 1W40A 5LP6B 1JY8A 3C9RA 1U43A 2AIFA 2VGMA 3CCQF 3RYHB 3DC2A 3D01A 3FFMA 3D54A 4WBNA 3J80M 3JARB 1FFXA 1Z5WA 5FLXM 4IHJB 4TZZA 1SDSA 3I3FA 2H8EA 5HY4A 1UI9A 3HKEB 1W2BF 4BT6A 2Q1YA 3LDTA 2Z1UA 1SZQA 3CPQA 4C8GA 2CZWA 3IKFA 5EB0A 3K2XA 4O4LB 1XBIA 3HKCB 2Q1XA 1GO0A 5EO3A 2BTUA 1U3PA 3HKBB 4BVSA 1CLIA 1Q86H 1ODEA 3MCQA 3WXMB 2IG8A 4X1YA 4E6EA 1KD1H 3LWVC 5LXTA 3GTZA 5EZYB 3P10A 1YJNF 2H6LA 1CN7A 3G4SF 1NQ3A 3WGMA 5GIPC 3CCVF 3JALB 5CB4B 3ESJA 2UYKA 4IHJA 2I6DA 4RQOA 1KQSF 5HXUA 3CG6A 5KX5B 1OAPA 1FSZA 3IKEA 4BVRA 1W59A 2Z01A 4X1YB 3NVIB 3LMEA 3C9SA 3MDOA 5JH7B 3HAXD 3E1YA 2NMUA 4X20B 2HP0B 2P6YA 4EB6B 4C82A 4ZI7B 3HKBA 2UYPA 4PWTA 5HY2A 4XCQA 3IEWA 5IJ0A 3K0TA 4NQ3A 3JVHA 3C9TA 3SIVA 5J2UB 3VO8A 4LCKA 5IJ9B 3HKCA 4O2BA 2R6R1 3TD5A 3CCMF 4O4LA 1IV1A 1X7OA 1M90H 2Z1EA 3E22A 5EYPB 2IAFA 5BMVB 3F0DA 2RHOA 5FNVB 3VOAA 5EB1B 2LBTA 3S06A 4C8EA 5BMVA 3CC7F 1NMUB 2ZAUA 3ZO8A 3NMUC 1VH8A 3LFOA 1JJ2F 2FC3A 5KMGB 5J2TB 3CC4F 1GX1A 1RLUA 3QTYA 2FGYA 3S0WA 2QI2A 2Z1FA 1JFFA 3S03A 2H8CA 2LBWA 5ITZA 5EAZA 5JQGA 3MQWA 1Q82H 2PMPA 3M84A 2HP0A 3L7QA 1SA0A 1VQMF 3IMPA 2CVLA 4G4WA 4TV8B 3MCAB 2UYNA 3ELCA 1W581 2MQEA 5LOVB 4O2BB 5HP8A 3VCZA 3CYQA 4NWOB 3RA5A 3RYFB 2OZBA 2RHJA 3NK7A 3HJWC 4G88A 3KHNA 4ERHA 3T80A 2IQQA 3S0YA 5IJ0B 4O4IB 3CYPB 3HKDA 1YITF 3S02A 3C8LA 3ON1A 2WALA 1IV2A 1JFFB 2GVIA 2L26A 1XV2A 3VI6A 2ZF8A 1U40A 1YQNA 1W5AA 1UFYA 3ERNA 3JATB 1E7KA 2ZVYA 1X7PA 3TD3A 4B5CA 5EZYA 1QAHA 3V7QA 2UZHA 4ZHYB 3JATA 1ZWZA 1DT9A 3CC2F 3VTIC 2CSLA 5G4VC 1VQ9F 1SA0B 2HS0A 3WJQA 3WGJA 5LOVA 2VAMA 2KGWA 4X3LA 5FJ4C 5LYJA 1W3EX 1VQPF 2QA4F 2OTMA 1ONIA 1N8RH 5LYJB 1YGYA 3WGLA 1COMA 4O4IA 3GHZA 4O2AB 1YIJF 5C8YB 4WBNB 4ZK7A 1TUBB 3N2GA 2BO1A 1M1KH 1W57A 3QUWA 3WGNA 5GIOC 4U39A 2OHWA 1RQ7A 2HP3A 2ALEA 1VQ4F 3VYSC 5B8FA 4U3JB 1K8AH 1TUBA 3N2GB 1Q8RA 2CW4A 1NJIH 3J7AR 2GLZA 1W5FA 4U3JA 3V3TA 5KX5A 2DYYA 5EIBC 3F0EA 3OBYA 4FFBB 1KC8H 3CCRF 1T0KB 4DXDA 3RYHA 4R40B 3PAFA 3RE3A 4O4HB 5CA1B 4YJ3A 3QHDA 4TUYA 1W5EA 2YXZA 4O4JB 2VAPA 4TV8A 2R751 3N4ZA 5GAPK 4DRXB 3KJJA 4HNAA 2ZODA 2VAWA 3CB2A 5GONA 5HP7A 2HX0A 4BT2A 2AMTA 5MN4A 4ZHVA 1IPAA 1KNKA 3JAKB 3JASA 4ZHQB 3SIUA 2KG4A 1J7HA 4DRXA 3B6NA 5GINC 3OONA 3KIZA 3NK6A 3G6EF 5JH7A 3TD4A 3JCMM 3OBWA 3F6MA 1H47A 2JNBA 5AVMA 5EYPA 3FD6A 3Q8HA 3PLAC 4FFBA 4O4HA 5CA1A 5IT9M 3V4DA 3VYTC 3FPIA 2HRUA 1YHQF 2CHSA 5LXTB 4TV9B 5C8YA 3JAWA 2LCAA 2HVYD 1X52A 4BW0B 2B33A 5A2QM 4G4YA 1W55A 4BT5A 3AGKA 4BT7A 1TVKB 1PF5A 2OTLF 2ZVZA 3M4SA 3LWOC 5JVDB 5CA0A 2CWJA 3RYCB 1W41A 2BTQB 4EI8A 3LWRC 4C4WC 1JN1A 3E20B 4NUTA 5CA0B 1W42A 3UT5A 5MN6A 1YJWF 4I4TA 1S72F 3HTNA 3CPWF 5JQGB 2EWCA 5IJ9A 5LP6C 4I55B 3VOBA 1GO1A 4B46A 3E22B 3FBAA 3WPXA 5EWRA 5EIBD 3WGKA 3JAWB 2HS3A 5LA6A 2VXYA 4LNUA 3S0HA 4HNAB 4LNUB 1H48A 1YI2F 3HKEA 1RLGA 3U0OA 3RA6A 1R1MA 1FNKA 3F0GA 2Z1TA 2LBXA 2GZLA 2RB9A 2YYEA 5HWEA 3I7TA 3CCJF 2HQSC 2ZOVA 3KE1A
chains in the Genus database with same CATH topology
3TD4A 3S0YA 4B62A 3S0WA 3S03A 4RHAA 3CYPB 2ZVZA 2KGWA 3S0HA 4G4XA 5EAZA 4ERHA 3S02A 3TD5A 3LDTA 2N48A 3IMPA 2K1SA 4G4WA 4G4ZA 1R1MA 1OAPA 2L26A 4ZHVA 2AIZP 2ZF8A 2LCAA 2HQSC 5EB0A 5EB1B 2LBTA 4G4VA 2W8BC 2MQEA 3S06A 2ZVYA 3CYQA 3TD3A 4B5CA 4G4YA 3WPXA 4ZHYB 4PWTA 4R40B 3OONA 4G88A 3KHNA 2ZOVA 4ZHWA 3WPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TD4 A;  3S0Y A;  4B62 A;  3S0W A;  3S03 A;  4RHA A;  3CYP B;  2ZVZ A;  2KGW A;  3S0H A;  4G4X A;  5EAZ A;  4ERH A;  3S02 A;  3TD5 A;  3LDT A;  2N48 A;  3IMP A;  2K1S A;  4G4W A;  4G4Z A;  1R1M A;  1OAP A;  2L26 A;  4ZHV A;  2AIZ P;  2ZF8 A;  2LCA A;  2HQS C;  5EB0 A;  5EB1 B;  2LBT A;  4G4V A;  2W8B C;  2MQE A;  3S06 A;  2ZVY A;  3CYQ A;  3TD3 A;  4B5C A;  4G4Y A;  3WPX A;  4ZHY B;  4PWT A;  4R40 B;  3OON A;  4G88 A;  3KHN A;  2ZOV A;  4ZHW A;  3WPW A; 
#chains in the Genus database with same CATH topology
 5IYZ A;  2RHL A;  4EI9 A;  4X20 A;  4EB6 A;  1T0A A;  4BY9 D;  3M1X A;  3VMF B;  3N2K A;  4KWE A;  4TUY B;  1VHA A;  1K73 H;  3F0F A;  3IR9 A;  5KMG A;  3JAL A;  3MBM A;  1K9M H;  5LA6 B;  2AIZ P;  3HKD B;  1CK2 A;  1RA4 A;  3UT5 B;  1VQ5 F;  5G4U C;  4G4V A;  5GON B;  3N4Y A;  4I4T B;  5HXZ A;  2UYN B;  5JCO A;  5J2T A;  5MN5 A;  4I55 A;  1Q81 H;  3IEQ A;  1PXW A;  1RQ2 A;  4O2A A;  4ZHW A;  3RYF A;  4C8I A;  4F6R A;  5FNV A;  3CCU F;  3ZP4 A;  3CME F;  1XHO A;  3VIU A;  2DT4 A;  1VQL F;  3FD5 A;  4F6R B;  3RYC A;  3R0P A;  5HY0 A;  3JAR A;  1KNJ A;  3KJK A;  2I6R A;  2QTP A;  3LWP C;  1Z5V A;  3RYI A;  3K14 A;  1VQV A;  3DDN A;  4EI7 A;  4C81 A;  5ITZ B;  3RYI B;  2BTO A;  3JAK A;  1W5B A;  3JAS B;  4ZHQ A;  1X25 A;  4M8I A;  3ZOP A;  3CD6 F;  1DBF A;  3N2K B;  4TV9 A;  3WJR A;  3D00 A;  2RHH A;  1FNJ A;  4I50 B;  3WJP A;  5J2U A;  2VGN A;  4X1I B;  3LYB A;  3BYQ A;  1QD9 A;  3P4E A;  1QVG F;  1Q7Y H;  3CXC F;  1IV4 A;  4B45 A;  3LWQ C;  3JAM M;  1VQ7 F;  1VQN F;  2G9I A;  4G4Z A;  5DCV A;  3I55 F;  4YJ3 B;  4X1K B;  3NVK E;  4X3M A;  1IV3 A;  5CB4 A;  4ZOL B;  2QEX F;  2UYJ A;  4YJ2 A;  2HRY A;  2OTJ F;  3CCL F;  2KTU A;  2CHT A;  5GAN K;  1VQ8 F;  3CMA F;  4BVT A;  2KTV A;  4IIJ B;  3ZP7 A;  4B62 A;  1QU9 A;  4ZI7 A;  4BVQ A;  4X1K A;  4O4J A;  3G71 F;  3P0Z A;  4G4X A;  2HS4 A;  1OFU A;  1VQK F;  1JD1 A;  1FFX B;  4YJ2 B;  3EOR A;  3I56 F;  2K1S A;  4BT3 A;  4X1I A;  1YJ9 F;  4BT4 A;  3VYU C;  5IYZ B;  2V9Y A;  2W8B C;  5LP6 A;  5JCO C;  3J81 M;  1GZ0 A;  3V7E A;  1U3L A;  1VK3 A;  3CCE F;  4IIJ A;  5HY1 A;  3WPW A;  5JVD A;  3O85 A;  3GYQ A;  4RHA A;  4ZOL A;  4I50 A;  1VQO F;  3HWU A;  3K12 A;  3CCS F;  3C9U A;  2N48 A;  1QVF F;  1XRG A;  2PHN A;  3OW2 F;  1H7M A;  1TVK A;  2F9Z C;  1VQ6 F;  1W40 A;  5LP6 B;  1JY8 A;  3C9R A;  1U43 A;  2AIF A;  2VGM A;  3CCQ F;  3RYH B;  3DC2 A;  3D01 A;  3FFM A;  3D54 A;  4WBN A;  3J80 M;  3JAR B;  1FFX A;  1Z5W A;  5FLX M;  4IHJ B;  4TZZ A;  1SDS A;  3I3F A;  2H8E A;  5HY4 A;  1UI9 A;  3HKE B;  1W2B F;  4BT6 A;  2Q1Y A;  3LDT A;  2Z1U A;  1SZQ A;  3CPQ A;  4C8G A;  2CZW A;  3IKF A;  5EB0 A;  3K2X A;  4O4L B;  1XBI A;  3HKC B;  2Q1X A;  1GO0 A;  5EO3 A;  2BTU A;  1U3P A;  3HKB B;  4BVS A;  1CLI A;  1Q86 H;  1ODE A;  3MCQ A;  3WXM B;  2IG8 A;  4X1Y A;  4E6E A;  1KD1 H;  3LWV C;  5LXT A;  3GTZ A;  5EZY B;  3P10 A;  1YJN F;  2H6L A;  1CN7 A;  3G4S F;  1NQ3 A;  3WGM A;  5GIP C;  3CCV F;  3JAL B;  5CB4 B;  3ESJ A;  2UYK A;  4IHJ A;  2I6D A;  4RQO A;  1KQS F;  5HXU A;  3CG6 A;  5KX5 B;  1OAP A;  1FSZ A;  3IKE A;  4BVR A;  1W59 A;  2Z01 A;  4X1Y B;  3NVI B;  3LME A;  3C9S A;  3MDO A;  5JH7 B;  3HAX D;  3E1Y A;  2NMU A;  4X20 B;  2HP0 B;  2P6Y A;  4EB6 B;  4C82 A;  4ZI7 B;  3HKB A;  2UYP A;  4PWT A;  5HY2 A;  4XCQ A;  3IEW A;  5IJ0 A;  3K0T A;  4NQ3 A;  3JVH A;  3C9T A;  3SIV A;  5J2U B;  3VO8 A;  4LCK A;  5IJ9 B;  3HKC A;  4O2B A;  2R6R 1;  3TD5 A;  3CCM F;  4O4L A;  1IV1 A;  1X7O A;  1M90 H;  2Z1E A;  3E22 A;  5EYP B;  2IAF A;  5BMV B;  3F0D A;  2RHO A;  5FNV B;  3VOA A;  5EB1 B;  2LBT A;  3S06 A;  4C8E A;  5BMV A;  3CC7 F;  1NMU B;  2ZAU A;  3ZO8 A;  3NMU C;  1VH8 A;  3LFO A;  1JJ2 F;  2FC3 A;  5KMG B;  5J2T B;  3CC4 F;  1GX1 A;  1RLU A;  3QTY A;  2FGY A;  3S0W A;  2QI2 A;  2Z1F A;  1JFF A;  3S03 A;  2H8C A;  2LBW A;  5ITZ A;  5EAZ A;  5JQG A;  3MQW A;  1Q82 H;  2PMP A;  3M84 A;  2HP0 A;  3L7Q A;  1SA0 A;  1VQM F;  3IMP A;  2CVL A;  4G4W A;  4TV8 B;  3MCA B;  2UYN A;  3ELC A;  1W58 1;  2MQE A;  5LOV B;  4O2B B;  5HP8 A;  3VCZ A;  3CYQ A;  4NWO B;  3RA5 A;  3RYF B;  2OZB A;  2RHJ A;  3NK7 A;  3HJW C;  4G88 A;  3KHN A;  4ERH A;  3T80 A;  2IQQ A;  3S0Y A;  5IJ0 B;  4O4I B;  3CYP B;  3HKD A;  1YIT F;  3S02 A;  3C8L A;  3ON1 A;  2WAL A;  1IV2 A;  1JFF B;  2GVI A;  2L26 A;  1XV2 A;  3VI6 A;  2ZF8 A;  1U40 A;  1YQN A;  1W5A A;  1UFY A;  3ERN A;  3JAT B;  1E7K A;  2ZVY A;  1X7P A;  3TD3 A;  4B5C A;  5EZY A;  1QAH A;  3V7Q A;  2UZH A;  4ZHY B;  3JAT A;  1ZWZ A;  1DT9 A;  3CC2 F;  3VTI C;  2CSL A;  5G4V C;  1VQ9 F;  1SA0 B;  2HS0 A;  3WJQ A;  3WGJ A;  5LOV A;  2VAM A;  2KGW A;  4X3L A;  5FJ4 C;  5LYJ A;  1W3E X;  1VQP F;  2QA4 F;  2OTM A;  1ONI A;  1N8R H;  5LYJ B;  1YGY A;  3WGL A;  1COM A;  4O4I A;  3GHZ A;  4O2A B;  1YIJ F;  5C8Y B;  4WBN B;  4ZK7 A;  1TUB B;  3N2G A;  2BO1 A;  1M1K H;  1W57 A;  3QUW A;  3WGN A;  5GIO C;  4U39 A;  2OHW A;  1RQ7 A;  2HP3 A;  2ALE A;  1VQ4 F;  3VYS C;  5B8F A;  4U3J B;  1K8A H;  1TUB A;  3N2G B;  1Q8R A;  2CW4 A;  1NJI H;  3J7A R;  2GLZ A;  1W5F A;  4U3J A;  3V3T A;  5KX5 A;  2DYY A;  5EIB C;  3F0E A;  3OBY A;  4FFB B;  1KC8 H;  3CCR F;  1T0K B;  4DXD A;  3RYH A;  4R40 B;  3PAF A;  3RE3 A;  4O4H B;  5CA1 B;  4YJ3 A;  3QHD A;  4TUY A;  1W5E A;  2YXZ A;  4O4J B;  2VAP A;  4TV8 A;  2R75 1;  3N4Z A;  5GAP K;  4DRX B;  3KJJ A;  4HNA A;  2ZOD A;  2VAW A;  3CB2 A;  5GON A;  5HP7 A;  2HX0 A;  4BT2 A;  2AMT A;  5MN4 A;  4ZHV A;  1IPA A;  1KNK A;  3JAK B;  3JAS A;  4ZHQ B;  3SIU A;  2KG4 A;  1J7H A;  4DRX A;  3B6N A;  5GIN C;  3OON A;  3KIZ A;  3NK6 A;  3G6E F;  5JH7 A;  3TD4 A;  3JCM M;  3OBW A;  3F6M A;  1H47 A;  2JNB A;  5AVM A;  5EYP A;  3FD6 A;  3Q8H A;  3PLA C;  4FFB A;  4O4H A;  5CA1 A;  5IT9 M;  3V4D A;  3VYT C;  3FPI A;  2HRU A;  1YHQ F;  2CHS A;  5LXT B;  4TV9 B;  5C8Y A;  3JAW A;  2LCA A;  2HVY D;  1X52 A;  4BW0 B;  2B33 A;  5A2Q M;  4G4Y A;  1W55 A;  4BT5 A;  3AGK A;  4BT7 A;  1TVK B;  1PF5 A;  2OTL F;  2ZVZ A;  3M4S A;  3LWO C;  5JVD B;  5CA0 A;  2CWJ A;  3RYC B;  1W41 A;  2BTQ B;  4EI8 A;  3LWR C;  4C4W C;  1JN1 A;  3E20 B;  4NUT A;  5CA0 B;  1W42 A;  3UT5 A;  5MN6 A;  1YJW F;  4I4T A;  1S72 F;  3HTN A;  3CPW F;  5JQG B;  2EWC A;  5IJ9 A;  5LP6 C;  4I55 B;  3VOB A;  1GO1 A;  4B46 A;  3E22 B;  3FBA A;  3WPX A;  5EWR A;  5EIB D;  3WGK A;  3JAW B;  2HS3 A;  5LA6 A;  2VXY A;  4LNU A;  3S0H A;  4HNA B;  4LNU B;  1H48 A;  1YI2 F;  3HKE A;  1RLG A;  3U0O A;  3RA6 A;  1R1M A;  1FNK A;  3F0G A;  2Z1T A;  2LBX A;  2GZL A;  2RB9 A;  2YYE A;  5HWE A;  3I7T A;  3CCJ F;  2HQS C;  2ZOV A;  3KE1 A; 
#chains in the Genus database with same CATH homology
 3TD4 A;  3S0Y A;  4B62 A;  3S0W A;  3S03 A;  4RHA A;  3CYP B;  2ZVZ A;  2KGW A;  3S0H A;  4G4X A;  5EAZ A;  4ERH A;  3S02 A;  3TD5 A;  3LDT A;  2N48 A;  3IMP A;  2K1S A;  4G4W A;  4G4Z A;  1R1M A;  1OAP A;  2L26 A;  4ZHV A;  2AIZ P;  2ZF8 A;  2LCA A;  2HQS C;  5EB0 A;  5EB1 B;  2LBT A;  4G4V A;  2W8B C;  2MQE A;  3S06 A;  2ZVY A;  3CYQ A;  3TD3 A;  4B5C A;  4G4Y A;  3WPX A;  4ZHY B;  4PWT A;  4R40 B;  3OON A;  4G88 A;  3KHN A;  2ZOV A;  4ZHW A;  3WPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...