4B5CA

Crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
119
structure length
119
Chain Sequence
b'DPLNDPNSPLAKRSVYFDFDSYSVQDQYQALLQQHAQYLKSHPQRHILIQGNTDERGTSEYNLALGQKRAEAVRRALSLLGVGDAQMEAVSLGKEKPVALGHDEASWAQNRRADLVYQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OMPA FAMILY LIPOPROTEIN
publication title Exploiting the Burkholderia Pseudomallei Acute Phase Antigen Bpsl2765 for Structure-Based Epitope Discovery/Design in Structural Vaccinology.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lipid transport
total genus 45
structure length 119
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 4b5cA00
2ZVYA 3OONA 5EB1B 4ZHYB 3S03A 3CYQA 2ZOVA 4ZHVA 2ZVZA 4G4ZA 2K1SA 2MQEA 2N48A 4PWTA 2HQSC 4ZHWA 3WPXA 3TD3A 1R1MA 4G4XA 4ERHA 2LCAA 3CYPB 4R40B 3IMPA 4G4WA 4G4VA 3S0WA 5EAZA 3KHNA 3S0YA 2AIZP 3S02A 3TD4A 4B62A 4RHAA 3S06A 2L26A 4G4YA 5EB0A 4B5CA 3S0HA 2ZF8A 3WPWA 1OAPA 2KGWA 2W8BC 4G88A 3TD5A 3LDTA 2LBTA
chains in the Genus database with same CATH superfamily
3ELCA 2HX0A 3E1YA 2F9ZC 2H8CA 2N48A 4LCKA 3HWUA 4DRXB 3JCMM 1YJWF 5GIPC 3CYPB 3VO8A 1U40A 5HXZA 3JATB 1VQMF 1U43A 4BT3A 1JFFB 1GX1A 3J81M 3CC4F 1K9MH 2AMTA 1KC8H 1W3EX 2UYJA 4O2BA 5LYJA 3JARB 1OAPA 4O2AB 1GO1A 1Q86H 4I55A 4YJ3A 3Q8HA 1KNKA 2HRYA 3CCRF 3SIVA 3CC7F 1UFYA 5CA0B 5HP7A 3E20B 5G4VC 1GO0A 5J2UB 3ZOPA 1VQPF 1NQ3A 1R1MA 4XCQA 2OTJF 4C8GA 5B8FA 1UI9A 1IV2A 2HRUA 1FFXB 5IT9M 2Q1YA 1T0AA 4WBNA 1X52A 1W2BF 2ALEA 1VQLF 3J80M 5EB0A 3C8LA 4TV8A 2QA4F 2RB9A 5LXTB 5IJ0B 3WJRA 3I55F 4BY9D 5LP6B 3BYQA 1XRGA 4IHJB 2PHNA 2GLZA 2CZWA 3G6EF 2JNBA 4YJ2A 5DCVA 3CCLF 3HJWC 1Q7YH 5EZYA 3I3FA 4X1KA 3CPWF 4G4XA 3CD6F 5KX5A 5JQGB 1VQOF 5IJ9A 4G4VA 3KJJA 1VQ4F 4X3LA 2OTMA 3N2GA 3QTYA 4EI8A 5KMGA 3WGNA 1W59A 3JASB 3JAKB 3WGKA 2VAPA 3WPWA 5JVDB 3RYCA 2ZAUA 2IG8A 2YYEA 5JH7B 2EWCA 1W5AA 3VIUA 2CSLA 3P10A 2QI2A 3D54A 3MQWA 3JALA 5CB4B 1VQ7F 3V3TA 4NUTA 1X7OA 4IIJA 3LYBA 4I50B 3K12A 1VQ5F 4DXDA 1RQ7A 3F0GA 1X7PA 1IV4A 3HKEB 3WXMB 4U3JB 2W8BC 4X20B 4ZK7A 3KIZA 5GAPK 3G4SF 5EIBD 2CWJA 4F6RA 3F6MA 5EIBC 1PF5A 4O4HB 3C9SA 4BT2A 4ZHVA 2YXZA 4O4LB 3M1XA 5AVMA 4BVTA 2HP0A 3HKBA 3QHDA 3RE3A 1JN1A 2IAFA 5CA1A 2LBXA 2BTUA 2I6DA 3WJPA 3N2KA 4ZI7B 1XHOA 1QVGF 3WGMA 4KWEA 4O4IB 4B5CA 4ZHQA 1CN7A 1SA0A 4O4JB 3HTNA 3K2XA 3LWOC 3M4SA 1NJIH 1CK2A 2OTLF 3HKCB 5LA6B 3LWVC 4PWTA 3OW2F 2Z01A 3CXCF 1E7KA 3VYTC 1IV3A 3VCZA 2I6RA 3VMFB 3K14A 2RHOA 4HNAA 3N4ZA 3P0ZA 3IEWA 3ERNA 3L7QA 4G4WA 4X1IB 2R751 4BVQA 3R0PA 3S0WA 3KE1A 1K73H 4B62A 3NMUC 5G4UC 5FNVA 1QAHA 4EB6B 1TVKB 4TUYA 1U3LA 5C8YB 1COMA 2IQQA 3CG6A 3VI6A 1RQ2A 1FNKA 2UYNB 5BMVA 2FC3A 1QVFF 5J2TB 2PMPA 2ZOVA 5EYPA 2CVLA 2V9YA 3ZO8A 3UT5B 3DDNA 3JAMM 3PLAC 3P4EA 3NVIB 4NQ3A 1YI2F 5MN4A 3GHZA 3T80A 4BT5A 5IYZA 1YHQF 1W5EA 1IPAA 3D01A 5GONB 2LBWA 3S02A 2H8EA 1TUBA 3J7AR 3S0HA 3V7QA 5ITZA 1YIJF 2H6LA 2VAWA 5HY0A 3LFOA 3RYHA 4LNUB 5A2QM 4C8IA 3SIUA 2LBTA 2Q1XA 3JASA 3HAXD 4ZOLA 2P6YA 3CYQA 2MQEA 5MN6A 2UZHA 2GZLA 1X25A 3OBWA 4C81A 2Z1FA 4O2BB 4BT4A 5LYJB 4I55B 4YJ3B 1ONIA 3U0OA 2QTPA 2VGMA 2WALA 1Z5VA 3KHNA 2HP3A 3TD4A 5HWEA 2L26A 3CCVF 4TV9A 4BVSA 2ZF8A 4B46A 1M1KH 1VH8A 1VK3A 1W5BA 3LDTA 4X1YA 3HKEA 3RA5A 1FNJA 3RYFA 1NMUB 3S03A 3CCQF 3JAWA 4WBNB 3RYIA 4I4TA 5LOVA 2K1SA 3VOAA 1RLGA 4ZHWA 1YJNF 3CPQA 4EI9A 2OZBA 4TV8B 1VQ8F 3CMAF 3G71F 5HXUA 3DC2A 3PAFA 4FFBA 4BT6A 3CCSF 1W5FA 5EAZA 2VGNA 3RA6A 2Z1EA 2DYYA 3CMEF 4YJ2B 3MCAB 3CCUF 3D00A 1Z5WA 2GVIA 4X1KB 3NVKE 5KX5B 4ZI7A 1K8AH 5IJ9B 3F0EA 3CC2F 3N2GB 1VQNF 2BTOA 1DT9A 1SDSA 4C4WC 3E22A 2KTVA 5KMGB 3CCJF 3HKDA 2BO1A 4X3MA 3O85A 4E6EA 3I56F 4DRXA 3V7EA 3S06A 1RA4A 3ESJA 1KNJA 3CB2A 3LWRC 3JATA 1IV1A 3JALB 1JFFA 1JJ2F 3N4YA 1VHAA 2KG4A 2VXYA 4IIJB 3JARA 1Q81H 4G4ZA 4O2AA 3IEQA 1XBIA 2HQSC 3TD3A 1OFUA 4ERHA 1J7HA 2UYNA 4RQOA 5CA0A 2AIFA 2KTUA 3V4DA 5J2UA 3LWQC 4M8IA 3F0FA 3GTZA 1Q82H 2AIZP 1KD1H 5FJ4C 4F6RB 3VYUC 3FBAA 3K0TA 1FFXA 3KJKA 2B33A 2HP0B 3HKBB 3OONA 1VQVA 1T0KB 3LWPC 1VQ9F 2ZODA 5CA1B 3CCEF 5LXTA 5IJ0A 1QU9A 2RHLA 5LP6A 5HP8A 3N2KB 4LNUA 4IHJA 4ZHQB 4B45A 3LMEA 1SA0B 1JY8A 3MBMA 1M90H 3IR9A 5JCOA 3FPIA 5LOVB 4C8EA 1H47A 1W55A 5HY1A 3IKFA 5JQGA 3WJQA 1Q8RA 2KGWA 1JD1A 4BT7A 1CLIA 4G88A 3WGLA 5FLXM 4HNAB 2G9IA 2BTQB 3JAKA 4TZZA 3CCMF 4EI7A 5JVDA 5JH7A 1QD9A 5FNVB 3IMPA 1FSZA 4TUYB 1PXWA 1DBFA 4NWOB 1W57A 3JVHA 3S0YA 2CHTA 3AGKA 5BMVB 5CB4A 5HY4A 5EYPB 1VQ6F 1ODEA 3TD5A 1N8RH 4I50A 2HS3A 3ZP4A 5MN5A 5IYZB 5LP6C 1H7MA 2ZVZA 3I7TA 4U3JA 4BW0B 4X20A 3VTIC 1YITF 2UYPA 2FGYA 3EORA 1TUBB 1W581 5ITZB 1KQSF 1GZ0A 4O4HA 4BVRA 3C9UA 5JCOC 4O4LA 3RYHB 2QEXF 4G4YA 4ZOLB 2CHSA 3ON1A 3M84A 3B6NA 5EZYB 3VOBA 5EB1B 5GIOC 4O4IA 1VQKF 4O4JA 3C9TA 3NK7A 1H48A 1S72F 2DT4A 2OHWA 3WPXA 3MDOA 4TV9B 3FD6A 2LCAA 1W41A 2HS0A 3HKCA 1RLUA 5LA6A 2RHJA 3RYCB 3C9RA 3NK6A 3QUWA 4X1YB 2RHHA 1YJ9F 3IKEA 3GYQA 4RHAA 3RYFB 2HVYD 3JAWB 3RYIB 1YGYA 4I4TB 4X1IA 5HY2A 3F0DA 1U3PA 2HS4A 2CW4A 2ZVYA 4ZHYB 4FFBB 3FFMA 4C82A 4EB6A 1TVKA 1SZQA 5C8YA 3FD5A 5GANK 1W40A 3WGJA 2VAMA 2Z1TA 4R40B 1YQNA 1ZWZA 5J2TA 2UYKA 3UT5A 4U39A 1W42A 5EWRA 1XV2A 2NMUA 5EO3A 2Z1UA 3E22B 3MCQA 2R6R1 3OBYA 3VYSC 5GONA 5GINC 3ZP7A 3HKDB
chains in the Genus database with same CATH topology
2ZVYA 3OONA 5EB1B 4ZHYB 3S03A 3CYQA 2ZOVA 4ZHVA 2ZVZA 4G4ZA 2K1SA 2MQEA 2N48A 4PWTA 2HQSC 4ZHWA 3WPXA 3TD3A 1R1MA 4G4XA 4ERHA 2LCAA 3CYPB 4R40B 3IMPA 4G4WA 4G4VA 3S0WA 5EAZA 3KHNA 3S0YA 2AIZP 3S02A 3TD4A 4B62A 4RHAA 3S06A 2L26A 4G4YA 5EB0A 4B5CA 3S0HA 2ZF8A 3WPWA 1OAPA 2KGWA 2W8BC 4G88A 3TD5A 3LDTA 2LBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZVY A;  3OON A;  5EB1 B;  4ZHY B;  3S03 A;  3CYQ A;  2ZOV A;  4ZHV A;  2ZVZ A;  4G4Z A;  2K1S A;  2MQE A;  2N48 A;  4PWT A;  2HQS C;  4ZHW A;  3WPX A;  3TD3 A;  1R1M A;  4G4X A;  4ERH A;  2LCA A;  3CYP B;  4R40 B;  3IMP A;  4G4W A;  4G4V A;  3S0W A;  5EAZ A;  3KHN A;  3S0Y A;  2AIZ P;  3S02 A;  3TD4 A;  4B62 A;  4RHA A;  3S06 A;  2L26 A;  4G4Y A;  5EB0 A;  4B5C A;  3S0H A;  2ZF8 A;  3WPW A;  1OAP A;  2KGW A;  2W8B C;  4G88 A;  3TD5 A;  3LDT A;  2LBT A; 
#chains in the Genus database with same CATH topology
 3ELC A;  2HX0 A;  3E1Y A;  2F9Z C;  2H8C A;  2N48 A;  4LCK A;  3HWU A;  4DRX B;  3JCM M;  1YJW F;  5GIP C;  3CYP B;  3VO8 A;  1U40 A;  5HXZ A;  3JAT B;  1VQM F;  1U43 A;  4BT3 A;  1JFF B;  1GX1 A;  3J81 M;  3CC4 F;  1K9M H;  2AMT A;  1KC8 H;  1W3E X;  2UYJ A;  4O2B A;  5LYJ A;  3JAR B;  1OAP A;  4O2A B;  1GO1 A;  1Q86 H;  4I55 A;  4YJ3 A;  3Q8H A;  1KNK A;  2HRY A;  3CCR F;  3SIV A;  3CC7 F;  1UFY A;  5CA0 B;  5HP7 A;  3E20 B;  5G4V C;  1GO0 A;  5J2U B;  3ZOP A;  1VQP F;  1NQ3 A;  1R1M A;  4XCQ A;  2OTJ F;  4C8G A;  5B8F A;  1UI9 A;  1IV2 A;  2HRU A;  1FFX B;  5IT9 M;  2Q1Y A;  1T0A A;  4WBN A;  1X52 A;  1W2B F;  2ALE A;  1VQL F;  3J80 M;  5EB0 A;  3C8L A;  4TV8 A;  2QA4 F;  2RB9 A;  5LXT B;  5IJ0 B;  3WJR A;  3I55 F;  4BY9 D;  5LP6 B;  3BYQ A;  1XRG A;  4IHJ B;  2PHN A;  2GLZ A;  2CZW A;  3G6E F;  2JNB A;  4YJ2 A;  5DCV A;  3CCL F;  3HJW C;  1Q7Y H;  5EZY A;  3I3F A;  4X1K A;  3CPW F;  4G4X A;  3CD6 F;  5KX5 A;  5JQG B;  1VQO F;  5IJ9 A;  4G4V A;  3KJJ A;  1VQ4 F;  4X3L A;  2OTM A;  3N2G A;  3QTY A;  4EI8 A;  5KMG A;  3WGN A;  1W59 A;  3JAS B;  3JAK B;  3WGK A;  2VAP A;  3WPW A;  5JVD B;  3RYC A;  2ZAU A;  2IG8 A;  2YYE A;  5JH7 B;  2EWC A;  1W5A A;  3VIU A;  2CSL A;  3P10 A;  2QI2 A;  3D54 A;  3MQW A;  3JAL A;  5CB4 B;  1VQ7 F;  3V3T A;  4NUT A;  1X7O A;  4IIJ A;  3LYB A;  4I50 B;  3K12 A;  1VQ5 F;  4DXD A;  1RQ7 A;  3F0G A;  1X7P A;  1IV4 A;  3HKE B;  3WXM B;  4U3J B;  2W8B C;  4X20 B;  4ZK7 A;  3KIZ A;  5GAP K;  3G4S F;  5EIB D;  2CWJ A;  4F6R A;  3F6M A;  5EIB C;  1PF5 A;  4O4H B;  3C9S A;  4BT2 A;  4ZHV A;  2YXZ A;  4O4L B;  3M1X A;  5AVM A;  4BVT A;  2HP0 A;  3HKB A;  3QHD A;  3RE3 A;  1JN1 A;  2IAF A;  5CA1 A;  2LBX A;  2BTU A;  2I6D A;  3WJP A;  3N2K A;  4ZI7 B;  1XHO A;  1QVG F;  3WGM A;  4KWE A;  4O4I B;  4B5C A;  4ZHQ A;  1CN7 A;  1SA0 A;  4O4J B;  3HTN A;  3K2X A;  3LWO C;  3M4S A;  1NJI H;  1CK2 A;  2OTL F;  3HKC B;  5LA6 B;  3LWV C;  4PWT A;  3OW2 F;  2Z01 A;  3CXC F;  1E7K A;  3VYT C;  1IV3 A;  3VCZ A;  2I6R A;  3VMF B;  3K14 A;  2RHO A;  4HNA A;  3N4Z A;  3P0Z A;  3IEW A;  3ERN A;  3L7Q A;  4G4W A;  4X1I B;  2R75 1;  4BVQ A;  3R0P A;  3S0W A;  3KE1 A;  1K73 H;  4B62 A;  3NMU C;  5G4U C;  5FNV A;  1QAH A;  4EB6 B;  1TVK B;  4TUY A;  1U3L A;  5C8Y B;  1COM A;  2IQQ A;  3CG6 A;  3VI6 A;  1RQ2 A;  1FNK A;  2UYN B;  5BMV A;  2FC3 A;  1QVF F;  5J2T B;  2PMP A;  2ZOV A;  5EYP A;  2CVL A;  2V9Y A;  3ZO8 A;  3UT5 B;  3DDN A;  3JAM M;  3PLA C;  3P4E A;  3NVI B;  4NQ3 A;  1YI2 F;  5MN4 A;  3GHZ A;  3T80 A;  4BT5 A;  5IYZ A;  1YHQ F;  1W5E A;  1IPA A;  3D01 A;  5GON B;  2LBW A;  3S02 A;  2H8E A;  1TUB A;  3J7A R;  3S0H A;  3V7Q A;  5ITZ A;  1YIJ F;  2H6L A;  2VAW A;  5HY0 A;  3LFO A;  3RYH A;  4LNU B;  5A2Q M;  4C8I A;  3SIU A;  2LBT A;  2Q1X A;  3JAS A;  3HAX D;  4ZOL A;  2P6Y A;  3CYQ A;  2MQE A;  5MN6 A;  2UZH A;  2GZL A;  1X25 A;  3OBW A;  4C81 A;  2Z1F A;  4O2B B;  4BT4 A;  5LYJ B;  4I55 B;  4YJ3 B;  1ONI A;  3U0O A;  2QTP A;  2VGM A;  2WAL A;  1Z5V A;  3KHN A;  2HP3 A;  3TD4 A;  5HWE A;  2L26 A;  3CCV F;  4TV9 A;  4BVS A;  2ZF8 A;  4B46 A;  1M1K H;  1VH8 A;  1VK3 A;  1W5B A;  3LDT A;  4X1Y A;  3HKE A;  3RA5 A;  1FNJ A;  3RYF A;  1NMU B;  3S03 A;  3CCQ F;  3JAW A;  4WBN B;  3RYI A;  4I4T A;  5LOV A;  2K1S A;  3VOA A;  1RLG A;  4ZHW A;  1YJN F;  3CPQ A;  4EI9 A;  2OZB A;  4TV8 B;  1VQ8 F;  3CMA F;  3G71 F;  5HXU A;  3DC2 A;  3PAF A;  4FFB A;  4BT6 A;  3CCS F;  1W5F A;  5EAZ A;  2VGN A;  3RA6 A;  2Z1E A;  2DYY A;  3CME F;  4YJ2 B;  3MCA B;  3CCU F;  3D00 A;  1Z5W A;  2GVI A;  4X1K B;  3NVK E;  5KX5 B;  4ZI7 A;  1K8A H;  5IJ9 B;  3F0E A;  3CC2 F;  3N2G B;  1VQN F;  2BTO A;  1DT9 A;  1SDS A;  4C4W C;  3E22 A;  2KTV A;  5KMG B;  3CCJ F;  3HKD A;  2BO1 A;  4X3M A;  3O85 A;  4E6E A;  3I56 F;  4DRX A;  3V7E A;  3S06 A;  1RA4 A;  3ESJ A;  1KNJ A;  3CB2 A;  3LWR C;  3JAT A;  1IV1 A;  3JAL B;  1JFF A;  1JJ2 F;  3N4Y A;  1VHA A;  2KG4 A;  2VXY A;  4IIJ B;  3JAR A;  1Q81 H;  4G4Z A;  4O2A A;  3IEQ A;  1XBI A;  2HQS C;  3TD3 A;  1OFU A;  4ERH A;  1J7H A;  2UYN A;  4RQO A;  5CA0 A;  2AIF A;  2KTU A;  3V4D A;  5J2U A;  3LWQ C;  4M8I A;  3F0F A;  3GTZ A;  1Q82 H;  2AIZ P;  1KD1 H;  5FJ4 C;  4F6R B;  3VYU C;  3FBA A;  3K0T A;  1FFX A;  3KJK A;  2B33 A;  2HP0 B;  3HKB B;  3OON A;  1VQV A;  1T0K B;  3LWP C;  1VQ9 F;  2ZOD A;  5CA1 B;  3CCE F;  5LXT A;  5IJ0 A;  1QU9 A;  2RHL A;  5LP6 A;  5HP8 A;  3N2K B;  4LNU A;  4IHJ A;  4ZHQ B;  4B45 A;  3LME A;  1SA0 B;  1JY8 A;  3MBM A;  1M90 H;  3IR9 A;  5JCO A;  3FPI A;  5LOV B;  4C8E A;  1H47 A;  1W55 A;  5HY1 A;  3IKF A;  5JQG A;  3WJQ A;  1Q8R A;  2KGW A;  1JD1 A;  4BT7 A;  1CLI A;  4G88 A;  3WGL A;  5FLX M;  4HNA B;  2G9I A;  2BTQ B;  3JAK A;  4TZZ A;  3CCM F;  4EI7 A;  5JVD A;  5JH7 A;  1QD9 A;  5FNV B;  3IMP A;  1FSZ A;  4TUY B;  1PXW A;  1DBF A;  4NWO B;  1W57 A;  3JVH A;  3S0Y A;  2CHT A;  3AGK A;  5BMV B;  5CB4 A;  5HY4 A;  5EYP B;  1VQ6 F;  1ODE A;  3TD5 A;  1N8R H;  4I50 A;  2HS3 A;  3ZP4 A;  5MN5 A;  5IYZ B;  5LP6 C;  1H7M A;  2ZVZ A;  3I7T A;  4U3J A;  4BW0 B;  4X20 A;  3VTI C;  1YIT F;  2UYP A;  2FGY A;  3EOR A;  1TUB B;  1W58 1;  5ITZ B;  1KQS F;  1GZ0 A;  4O4H A;  4BVR A;  3C9U A;  5JCO C;  4O4L A;  3RYH B;  2QEX F;  4G4Y A;  4ZOL B;  2CHS A;  3ON1 A;  3M84 A;  3B6N A;  5EZY B;  3VOB A;  5EB1 B;  5GIO C;  4O4I A;  1VQK F;  4O4J A;  3C9T A;  3NK7 A;  1H48 A;  1S72 F;  2DT4 A;  2OHW A;  3WPX A;  3MDO A;  4TV9 B;  3FD6 A;  2LCA A;  1W41 A;  2HS0 A;  3HKC A;  1RLU A;  5LA6 A;  2RHJ A;  3RYC B;  3C9R A;  3NK6 A;  3QUW A;  4X1Y B;  2RHH A;  1YJ9 F;  3IKE A;  3GYQ A;  4RHA A;  3RYF B;  2HVY D;  3JAW B;  3RYI B;  1YGY A;  4I4T B;  4X1I A;  5HY2 A;  3F0D A;  1U3P A;  2HS4 A;  2CW4 A;  2ZVY A;  4ZHY B;  4FFB B;  3FFM A;  4C82 A;  4EB6 A;  1TVK A;  1SZQ A;  5C8Y A;  3FD5 A;  5GAN K;  1W40 A;  3WGJ A;  2VAM A;  2Z1T A;  4R40 B;  1YQN A;  1ZWZ A;  5J2T A;  2UYK A;  3UT5 A;  4U39 A;  1W42 A;  5EWR A;  1XV2 A;  2NMU A;  5EO3 A;  2Z1U A;  3E22 B;  3MCQ A;  2R6R 1;  3OBY A;  3VYS C;  5GON A;  5GIN C;  3ZP7 A;  3HKD B; 
#chains in the Genus database with same CATH homology
 2ZVY A;  3OON A;  5EB1 B;  4ZHY B;  3S03 A;  3CYQ A;  2ZOV A;  4ZHV A;  2ZVZ A;  4G4Z A;  2K1S A;  2MQE A;  2N48 A;  4PWT A;  2HQS C;  4ZHW A;  3WPX A;  3TD3 A;  1R1M A;  4G4X A;  4ERH A;  2LCA A;  3CYP B;  4R40 B;  3IMP A;  4G4W A;  4G4V A;  3S0W A;  5EAZ A;  3KHN A;  3S0Y A;  2AIZ P;  3S02 A;  3TD4 A;  4B62 A;  4RHA A;  3S06 A;  2L26 A;  4G4Y A;  5EB0 A;  4B5C A;  3S0H A;  2ZF8 A;  3WPW A;  1OAP A;  2KGW A;  2W8B C;  4G88 A;  3TD5 A;  3LDT A;  2LBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...