3QUWA

Crystal structure of yeast mmf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
TLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein MMF1
publication title Crystal structures and putative interface of Saccharomyces cerevisiae mitochondrial matrix proteins Mmf1 and Mam33.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3quwA00
2CSLA 2OTMA 3KJJA 1QD9A 2CW4A 1XRGA 1FNKA 3MQWA 1ONIA 2B33A 3K0TA 2CHTA 3D01A 4NWOB 3QUWA 1QAHA 2CHSA 1PF5A 1NQ3A 3GTZA 3KJKA 3V4DA 5HP7A 3ZO8A 2UYKA 2IG8A 1XHOA 3I3FA 4ZK7A 1X25A 2CVLA 2CWJA 3VCZA 3R0PA 3ZP7A 3M4SA 1ODEA 2UYNA 1UFYA 3K12A 3M1XA 1JD1A 1J7HA 1UI9A 2UYJA 2EWCA 2UYNB 3I7TA 1FNJA 3L7QA 3LYBA 5HP8A 1COMA 3ZP4A 3ZOPA 3LMEA 1DBFA 2DYYA 2UYPA 1QU9A
chains in the Genus database with same CATH superfamily
3F0FA 3K0TA 2G9IA 5J2UB 3HKBB 1JN1A 4O4JA 2ZVZA 1W40A 4I4TB 1XHOA 2UZHA 4ZK7A 1VQPF 3IEWA 3JAWB 4C8EA 1K9MH 4I55B 1VQVA 3C9RA 4WBNB 1W581 5BMVB 1W57A 2GVIA 3JALB 2OTJF 2WALA 4TV9A 4NQ3A 4YJ2B 2ZOVA 3HKEB 4BVTA 4I50A 2H8CA 1CN7A 5IYZB 1CLIA 3WPWA 4EB6A 1PXWA 3KIZA 3AGKA 5HY1A 1W5AA 2L26A 3JASB 2RB9A 3DC2A 1QVGF 2CW4A 5HXUA 4BT2A 1K73H 1QVFF 3JAKB 3I56F 4TUYA 4X1IA 2Z1UA 4G4YA 3SIVA 3ESJA 3MCQA 5EYPB 3CCLF 3R0PA 3GYQA 3UT5B 1GO0A 4BVQA 5JCOC 5KMGB 4G4VA 3K12A 3M1XA 3VO8A 4G88A 2HP0A 3ZP4A 2JNBA 1TVKA 2Z1FA 3J80M 1VQKF 4O2BB 4EB6B 4ZHWA 3OBWA 1YI2F 3RA6A 4IIJA 5JQGB 5IJ0A 3QTYA 3LWQC 1YIJF 2HRUA 3QHDA 1VQ5F 2FGYA 2OHWA 3CC2F 4TUYB 1T0AA 2R6R1 3WPXA 3C8LA 3JATA 4O4HB 1X52A 3WGKA 5JH7A 5MN5A 2AIZP 4FFBA 3RYFA 4O4IA 3J7AR 1ODEA 4E6EA 2UYJA 1H48A 4HNAA 2KTVA 5LYJB 5FNVA 5HY4A 2VGNA 1X7OA 3KHNA 1QD9A 5AVMA 1OAPA 5CA1A 3LWPC 3IKEA 1NQ3A 3GTZA 4BT6A 1IV2A 2ZODA 1YHQF 3EORA 3K2XA 2CVLA 2CWJA 5GONB 5EZYA 5LP6C 3B6NA 3VYTC 2HRYA 1JY8A 2LBXA 4PWTA 1W42A 3NVKE 4B45A 4B5CA 3WJPA 3KE1A 4HNAB 5EWRA 4DXDA 1DT9A 4G4WA 3NMUC 4ZI7B 4BY9D 5KX5A 5GAPK 1RA4A 1FNKA 3CG6A 1Z5WA 3VYUC 5EB0A 1JJ2F 1ONIA 1RLGA 4BVSA 1VH8A 1YJNF 3IR9A 4U3JA 1M90H 4G4ZA 1VHAA 2KTUA 2HQSC 1KNKA 3RYCB 4O4LA 4X1YA 1VQ6F 2HP3A 3IMPA 1SDSA 2I6RA 2F9ZC 3CMEF 3HKCA 2HS0A 3WGNA 2N48A 2ZVYA 3LFOA 2UYNA 2H6LA 3JAMM 5LA6B 5C8YB 1IV4A 1DBFA 5ITZA 3V7QA 2HX0A 1QU9A 5J2TB 3CCSF 3F0DA 3CCUF 4ZHQB 3KJJA 5IT9M 1U3LA 3G4SF 1Q81H 5IJ9A 3G6EF 1W41A 2ALEA 5CB4A 2HVYD 3N2GB 1W5BA 4M8IA 3RA5A 3E1YA 1VQMF 5JVDA 4X20A 1X25A 4O2AA 3LWOC 3M4SA 2ZAUA 3ON1A 5GIPC 5EIBD 3CMAF 5JCOA 3F0EA 1VQ7F 3TD5A 4LNUB 4XCQA 1VK3A 3E20B 3F6MA 5A2QM 3D54A 1SA0A 5LOVA 3OONA 1Q82H 3CCEF 1VQ9F 3RYIA 3FBAA 3MCAB 2P6YA 5HP7A 2PMPA 3JVHA 5CB4B 3RYHA 4ZHVA 4O4JB 1Z5VA 4LCKA 4U39A 5HY0A 3O85A 3NVIB 3S0HA 5G4VC 3WGMA 1VQNF 4TV9B 3LMEA 4I50B 2DT4A 3IKFA 1OFUA 3NK7A 3T80A 1KNJA 1W59A 1GZ0A 3GHZA 3N4YA 3CCRF 4YJ3A 4B62A 3WJQA 3K14A 3V4DA 3CCQF 1IV3A 4X1IB 2RHLA 5B8FA 4TV8A 3P10A 3U0OA 3S0YA 1FFXA 5LP6A 3FFMA 1UI9A 4G4XA 3WXMB 1YJ9F 4F6RA 1W55A 2UYPA 2HP0B 2IQQA 5EAZA 1TVKB 3HTNA 3VMFB 4RHAA 2AMTA 3WJRA 4BT5A 2YXZA 5EB1B 3D01A 4BT7A 4IIJB 5IJ0B 3IEQA 2HS3A 1YJWF 3HWUA 3PLAC 1TUBA 1N8RH 4C8IA 3ZP7A 3Q8HA 5LXTA 3JATB 3CCVF 5JH7B 4FFBB 3RYFB 4O4IB 2EWCA 3I7TA 3L7QA 1FFXB 1YITF 3NK6A 1Q7YH 2VAWA 2VAPA 3CYQA 4B46A 2CSLA 2AIFA 5FNVB 1KC8H 1U3PA 2QTPA 5MN6A 2B33A 4ZOLA 1VQ4F 2CHSA 3HKDA 4DRXA 5EO3A 3JARA 5CA1B 1JFFA 2UYKA 2Z1TA 3I3FA 4IHJA 5EIBC 1W3EX 3FPIA 1NJIH 2BTUA 3P0ZA 3F0GA 1Q86H 4X3MA 1UFYA 4RQOA 1E7KA 5EZYB 1YQNA 3I55F 3C9SA 2KGWA 2VXYA 5MN4A 1KD1H 2Q1XA 3BYQA 5J2UA 4C82A 1FSZA 3C9UA 2MQEA 4X1KA 5KX5B 4EI8A 4I4TA 2QA4F 3KJKA 3S02A 2Q1YA 3OBYA 3JAWA 2V9YA 4U3JB 3SIUA 3JARB 3CC7F 5DCVA 4I55A 4C4WC 4WBNA 3ERNA 3JALA 3N4ZA 4O4LB 3DDNA 4X1YB 4YJ2A 3HKCB 1YGYA 1JD1A 5IYZA 2YYEA 2UYNB 3CB2A 4KWEA 2RHHA 3CXCF 5HY2A 1COMA 2BTOA 2VGMA 3JASA 3LWVC 1VQ8F 5FJ4C 4C8GA 4EI7A 1IPAA 3TD3A 3JAKA 5ITZB 5HWEA 1T0KB 4NWOB 3QUWA 1ZWZA 3CCJF 4X1KB 3S06A 1PF5A 5IJ9B 5EYPA 2OTLF 3CC4F 3UT5A 1KQSF 4EI9A 1IV1A 5KMGA 1VQOF 1U43A 3ELCA 2LBWA 5JVDB 4X20B 4O2AB 2ZF8A 1J7HA 3LYBA 4O2BA 2LCAA 2CZWA 2DYYA 5JQGA 3VTIC 3G71F 3WGJA 3FD5A 2PHNA 3VI6A 1XBIA 5HXZA 2W8BC 3RE3A 1SA0B 2QI2A 5LOVB 3RYIB 3M84A 4ERHA 1K8AH 5FLXM 3OW2F 4O4HA 3RYHB 5CA0A 3VOBA 5LYJA 3D00A 3S0WA 1FNJA 4BW0B 3VIUA 3E22A 1RLUA 3S03A 3LDTA 2IAFA 1RQ7A 2CHTA 2KG4A 1W5EA 4YJ3B 3CPQA 2HS4A 2GZLA 5GONA 1GO1A 2LBTA 2VAMA 5CA0B 1W5FA 4TV8B 3TD4A 3MBMA 3WGLA 4TZZA 1W2BF 1H47A 1RQ2A 3V3TA 4ZI7A 5LP6B 3CCMF 3E22B 4F6RB 2H8EA 2K1SA 4BT4A 2NMUA 2BTQB 3CPWF 3V7EA 5G4UC 3RYCA 1NMUB 1M1KH 3CYPB 3ZO8A 2IG8A 2Z01A 5GINC 4BVRA 1SZQA 3VCZA 3J81M 1TUBB 2FC3A 4BT3A 5LA6A 1S72F 2RHOA 3C9TA 5C8YA 3FD6A 5LXTB 3MDOA 1R1MA 1GX1A 5J2TA 5HP8A 3N2KA 4ZHQA 2QEXF 2I6DA 2R751 4R40B 3VYSC 2OTMA 3LWRC 2RHJA 1XRGA 3JCMM 3HKBA 3MQWA 3PAFA 3VOAA 1QAHA 3N2GA 5GIOC 3HAXD 1CK2A 4ZOLB 1U40A 3HKDB 4DRXB 4C81A 1XV2A 4NUTA 1JFFB 5GANK 1VQLF 4X3LA 5BMVA 3P4EA 4IHJB 1X7PA 4ZHYB 2OZBA 4LNUA 3HKEA 3HJWC 2BO1A 3CD6F 1Q8RA 1H7MA 3ZOPA 2Z1EA 2GLZA 3N2KB
chains in the Genus database with same CATH topology
2CSLA 2OTMA 3KJJA 1QD9A 2CW4A 1XRGA 1FNKA 3MQWA 1ONIA 2B33A 3K0TA 2CHTA 3D01A 4NWOB 3QUWA 1QAHA 2CHSA 1PF5A 1NQ3A 3GTZA 3KJKA 3V4DA 5HP7A 3ZO8A 2UYKA 2IG8A 1XHOA 3I3FA 4ZK7A 1X25A 2CVLA 2CWJA 3VCZA 3R0PA 3ZP7A 3M4SA 1ODEA 2UYNA 1UFYA 3K12A 3M1XA 1JD1A 1J7HA 1UI9A 2UYJA 2EWCA 2UYNB 3I7TA 1FNJA 3L7QA 3LYBA 5HP8A 1COMA 3ZP4A 3ZOPA 3LMEA 1DBFA 2DYYA 2UYPA 1QU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSL A;  2OTM A;  3KJJ A;  1QD9 A;  2CW4 A;  1XRG A;  1FNK A;  3MQW A;  1ONI A;  2B33 A;  3K0T A;  2CHT A;  3D01 A;  4NWO B;  3QUW A;  1QAH A;  2CHS A;  1PF5 A;  1NQ3 A;  3GTZ A;  3KJK A;  3V4D A;  5HP7 A;  3ZO8 A;  2UYK A;  2IG8 A;  1XHO A;  3I3F A;  4ZK7 A;  1X25 A;  2CVL A;  2CWJ A;  3VCZ A;  3R0P A;  3ZP7 A;  3M4S A;  1ODE A;  2UYN A;  1UFY A;  3K12 A;  3M1X A;  1JD1 A;  1J7H A;  1UI9 A;  2UYJ A;  2EWC A;  2UYN B;  3I7T A;  1FNJ A;  3L7Q A;  3LYB A;  5HP8 A;  1COM A;  3ZP4 A;  3ZOP A;  3LME A;  1DBF A;  2DYY A;  2UYP A;  1QU9 A; 
#chains in the Genus database with same CATH topology
 3F0F A;  3K0T A;  2G9I A;  5J2U B;  3HKB B;  1JN1 A;  4O4J A;  2ZVZ A;  1W40 A;  4I4T B;  1XHO A;  2UZH A;  4ZK7 A;  1VQP F;  3IEW A;  3JAW B;  4C8E A;  1K9M H;  4I55 B;  1VQV A;  3C9R A;  4WBN B;  1W58 1;  5BMV B;  1W57 A;  2GVI A;  3JAL B;  2OTJ F;  2WAL A;  4TV9 A;  4NQ3 A;  4YJ2 B;  2ZOV A;  3HKE B;  4BVT A;  4I50 A;  2H8C A;  1CN7 A;  5IYZ B;  1CLI A;  3WPW A;  4EB6 A;  1PXW A;  3KIZ A;  3AGK A;  5HY1 A;  1W5A A;  2L26 A;  3JAS B;  2RB9 A;  3DC2 A;  1QVG F;  2CW4 A;  5HXU A;  4BT2 A;  1K73 H;  1QVF F;  3JAK B;  3I56 F;  4TUY A;  4X1I A;  2Z1U A;  4G4Y A;  3SIV A;  3ESJ A;  3MCQ A;  5EYP B;  3CCL F;  3R0P A;  3GYQ A;  3UT5 B;  1GO0 A;  4BVQ A;  5JCO C;  5KMG B;  4G4V A;  3K12 A;  3M1X A;  3VO8 A;  4G88 A;  2HP0 A;  3ZP4 A;  2JNB A;  1TVK A;  2Z1F A;  3J80 M;  1VQK F;  4O2B B;  4EB6 B;  4ZHW A;  3OBW A;  1YI2 F;  3RA6 A;  4IIJ A;  5JQG B;  5IJ0 A;  3QTY A;  3LWQ C;  1YIJ F;  2HRU A;  3QHD A;  1VQ5 F;  2FGY A;  2OHW A;  3CC2 F;  4TUY B;  1T0A A;  2R6R 1;  3WPX A;  3C8L A;  3JAT A;  4O4H B;  1X52 A;  3WGK A;  5JH7 A;  5MN5 A;  2AIZ P;  4FFB A;  3RYF A;  4O4I A;  3J7A R;  1ODE A;  4E6E A;  2UYJ A;  1H48 A;  4HNA A;  2KTV A;  5LYJ B;  5FNV A;  5HY4 A;  2VGN A;  1X7O A;  3KHN A;  1QD9 A;  5AVM A;  1OAP A;  5CA1 A;  3LWP C;  3IKE A;  1NQ3 A;  3GTZ A;  4BT6 A;  1IV2 A;  2ZOD A;  1YHQ F;  3EOR A;  3K2X A;  2CVL A;  2CWJ A;  5GON B;  5EZY A;  5LP6 C;  3B6N A;  3VYT C;  2HRY A;  1JY8 A;  2LBX A;  4PWT A;  1W42 A;  3NVK E;  4B45 A;  4B5C A;  3WJP A;  3KE1 A;  4HNA B;  5EWR A;  4DXD A;  1DT9 A;  4G4W A;  3NMU C;  4ZI7 B;  4BY9 D;  5KX5 A;  5GAP K;  1RA4 A;  1FNK A;  3CG6 A;  1Z5W A;  3VYU C;  5EB0 A;  1JJ2 F;  1ONI A;  1RLG A;  4BVS A;  1VH8 A;  1YJN F;  3IR9 A;  4U3J A;  1M90 H;  4G4Z A;  1VHA A;  2KTU A;  2HQS C;  1KNK A;  3RYC B;  4O4L A;  4X1Y A;  1VQ6 F;  2HP3 A;  3IMP A;  1SDS A;  2I6R A;  2F9Z C;  3CME F;  3HKC A;  2HS0 A;  3WGN A;  2N48 A;  2ZVY A;  3LFO A;  2UYN A;  2H6L A;  3JAM M;  5LA6 B;  5C8Y B;  1IV4 A;  1DBF A;  5ITZ A;  3V7Q A;  2HX0 A;  1QU9 A;  5J2T B;  3CCS F;  3F0D A;  3CCU F;  4ZHQ B;  3KJJ A;  5IT9 M;  1U3L A;  3G4S F;  1Q81 H;  5IJ9 A;  3G6E F;  1W41 A;  2ALE A;  5CB4 A;  2HVY D;  3N2G B;  1W5B A;  4M8I A;  3RA5 A;  3E1Y A;  1VQM F;  5JVD A;  4X20 A;  1X25 A;  4O2A A;  3LWO C;  3M4S A;  2ZAU A;  3ON1 A;  5GIP C;  5EIB D;  3CMA F;  5JCO A;  3F0E A;  1VQ7 F;  3TD5 A;  4LNU B;  4XCQ A;  1VK3 A;  3E20 B;  3F6M A;  5A2Q M;  3D54 A;  1SA0 A;  5LOV A;  3OON A;  1Q82 H;  3CCE F;  1VQ9 F;  3RYI A;  3FBA A;  3MCA B;  2P6Y A;  5HP7 A;  2PMP A;  3JVH A;  5CB4 B;  3RYH A;  4ZHV A;  4O4J B;  1Z5V A;  4LCK A;  4U39 A;  5HY0 A;  3O85 A;  3NVI B;  3S0H A;  5G4V C;  3WGM A;  1VQN F;  4TV9 B;  3LME A;  4I50 B;  2DT4 A;  3IKF A;  1OFU A;  3NK7 A;  3T80 A;  1KNJ A;  1W59 A;  1GZ0 A;  3GHZ A;  3N4Y A;  3CCR F;  4YJ3 A;  4B62 A;  3WJQ A;  3K14 A;  3V4D A;  3CCQ F;  1IV3 A;  4X1I B;  2RHL A;  5B8F A;  4TV8 A;  3P10 A;  3U0O A;  3S0Y A;  1FFX A;  5LP6 A;  3FFM A;  1UI9 A;  4G4X A;  3WXM B;  1YJ9 F;  4F6R A;  1W55 A;  2UYP A;  2HP0 B;  2IQQ A;  5EAZ A;  1TVK B;  3HTN A;  3VMF B;  4RHA A;  2AMT A;  3WJR A;  4BT5 A;  2YXZ A;  5EB1 B;  3D01 A;  4BT7 A;  4IIJ B;  5IJ0 B;  3IEQ A;  2HS3 A;  1YJW F;  3HWU A;  3PLA C;  1TUB A;  1N8R H;  4C8I A;  3ZP7 A;  3Q8H A;  5LXT A;  3JAT B;  3CCV F;  5JH7 B;  4FFB B;  3RYF B;  4O4I B;  2EWC A;  3I7T A;  3L7Q A;  1FFX B;  1YIT F;  3NK6 A;  1Q7Y H;  2VAW A;  2VAP A;  3CYQ A;  4B46 A;  2CSL A;  2AIF A;  5FNV B;  1KC8 H;  1U3P A;  2QTP A;  5MN6 A;  2B33 A;  4ZOL A;  1VQ4 F;  2CHS A;  3HKD A;  4DRX A;  5EO3 A;  3JAR A;  5CA1 B;  1JFF A;  2UYK A;  2Z1T A;  3I3F A;  4IHJ A;  5EIB C;  1W3E X;  3FPI A;  1NJI H;  2BTU A;  3P0Z A;  3F0G A;  1Q86 H;  4X3M A;  1UFY A;  4RQO A;  1E7K A;  5EZY B;  1YQN A;  3I55 F;  3C9S A;  2KGW A;  2VXY A;  5MN4 A;  1KD1 H;  2Q1X A;  3BYQ A;  5J2U A;  4C82 A;  1FSZ A;  3C9U A;  2MQE A;  4X1K A;  5KX5 B;  4EI8 A;  4I4T A;  2QA4 F;  3KJK A;  3S02 A;  2Q1Y A;  3OBY A;  3JAW A;  2V9Y A;  4U3J B;  3SIU A;  3JAR B;  3CC7 F;  5DCV A;  4I55 A;  4C4W C;  4WBN A;  3ERN A;  3JAL A;  3N4Z A;  4O4L B;  3DDN A;  4X1Y B;  4YJ2 A;  3HKC B;  1YGY A;  1JD1 A;  5IYZ A;  2YYE A;  2UYN B;  3CB2 A;  4KWE A;  2RHH A;  3CXC F;  5HY2 A;  1COM A;  2BTO A;  2VGM A;  3JAS A;  3LWV C;  1VQ8 F;  5FJ4 C;  4C8G A;  4EI7 A;  1IPA A;  3TD3 A;  3JAK A;  5ITZ B;  5HWE A;  1T0K B;  4NWO B;  3QUW A;  1ZWZ A;  3CCJ F;  4X1K B;  3S06 A;  1PF5 A;  5IJ9 B;  5EYP A;  2OTL F;  3CC4 F;  3UT5 A;  1KQS F;  4EI9 A;  1IV1 A;  5KMG A;  1VQO F;  1U43 A;  3ELC A;  2LBW A;  5JVD B;  4X20 B;  4O2A B;  2ZF8 A;  1J7H A;  3LYB A;  4O2B A;  2LCA A;  2CZW A;  2DYY A;  5JQG A;  3VTI C;  3G71 F;  3WGJ A;  3FD5 A;  2PHN A;  3VI6 A;  1XBI A;  5HXZ A;  2W8B C;  3RE3 A;  1SA0 B;  2QI2 A;  5LOV B;  3RYI B;  3M84 A;  4ERH A;  1K8A H;  5FLX M;  3OW2 F;  4O4H A;  3RYH B;  5CA0 A;  3VOB A;  5LYJ A;  3D00 A;  3S0W A;  1FNJ A;  4BW0 B;  3VIU A;  3E22 A;  1RLU A;  3S03 A;  3LDT A;  2IAF A;  1RQ7 A;  2CHT A;  2KG4 A;  1W5E A;  4YJ3 B;  3CPQ A;  2HS4 A;  2GZL A;  5GON A;  1GO1 A;  2LBT A;  2VAM A;  5CA0 B;  1W5F A;  4TV8 B;  3TD4 A;  3MBM A;  3WGL A;  4TZZ A;  1W2B F;  1H47 A;  1RQ2 A;  3V3T A;  4ZI7 A;  5LP6 B;  3CCM F;  3E22 B;  4F6R B;  2H8E A;  2K1S A;  4BT4 A;  2NMU A;  2BTQ B;  3CPW F;  3V7E A;  5G4U C;  3RYC A;  1NMU B;  1M1K H;  3CYP B;  3ZO8 A;  2IG8 A;  2Z01 A;  5GIN C;  4BVR A;  1SZQ A;  3VCZ A;  3J81 M;  1TUB B;  2FC3 A;  4BT3 A;  5LA6 A;  1S72 F;  2RHO A;  3C9T A;  5C8Y A;  3FD6 A;  5LXT B;  3MDO A;  1R1M A;  1GX1 A;  5J2T A;  5HP8 A;  3N2K A;  4ZHQ A;  2QEX F;  2I6D A;  2R75 1;  4R40 B;  3VYS C;  2OTM A;  3LWR C;  2RHJ A;  1XRG A;  3JCM M;  3HKB A;  3MQW A;  3PAF A;  3VOA A;  1QAH A;  3N2G A;  5GIO C;  3HAX D;  1CK2 A;  4ZOL B;  1U40 A;  3HKD B;  4DRX B;  4C81 A;  1XV2 A;  4NUT A;  1JFF B;  5GAN K;  1VQL F;  4X3L A;  5BMV A;  3P4E A;  4IHJ B;  1X7P A;  4ZHY B;  2OZB A;  4LNU A;  3HKE A;  3HJW C;  2BO1 A;  3CD6 F;  1Q8R A;  1H7M A;  3ZOP A;  2Z1E A;  2GLZ A;  3N2K B; 
#chains in the Genus database with same CATH homology
 2CSL A;  2OTM A;  3KJJ A;  1QD9 A;  2CW4 A;  1XRG A;  1FNK A;  3MQW A;  1ONI A;  2B33 A;  3K0T A;  2CHT A;  3D01 A;  4NWO B;  3QUW A;  1QAH A;  2CHS A;  1PF5 A;  1NQ3 A;  3GTZ A;  3KJK A;  3V4D A;  5HP7 A;  3ZO8 A;  2UYK A;  2IG8 A;  1XHO A;  3I3F A;  4ZK7 A;  1X25 A;  2CVL A;  2CWJ A;  3VCZ A;  3R0P A;  3ZP7 A;  3M4S A;  1ODE A;  2UYN A;  1UFY A;  3K12 A;  3M1X A;  1JD1 A;  1J7H A;  1UI9 A;  2UYJ A;  2EWC A;  2UYN B;  3I7T A;  1FNJ A;  3L7Q A;  3LYB A;  5HP8 A;  1COM A;  3ZP4 A;  3ZOP A;  3LME A;  1DBF A;  2DYY A;  2UYP A;  1QU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...