3QUWA

Crystal structure of yeast mmf1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
TLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIAVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein MMF1
publication title Crystal structures and putative interface of Saccharomyces cerevisiae mitochondrial matrix proteins Mmf1 and Mam33.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3quwA00
3K12A 1QD9A 1FNKA 1XHOA 5HP8A 1PF5A 2EWCA 2CHTA 3K0TA 3ZP7A 3GTZA 4ZK7A 1NQ3A 2UYKA 3L7QA 3R0PA 2CWJA 2OTMA 1ONIA 3M1XA 3KJJA 3QUWA 2B33A 2DYYA 1UFYA 3ZP4A 1COMA 1X25A 1XRGA 2CSLA 5HP7A 1QU9A 3I3FA 2UYJA 1ODEA 2CHSA 1UI9A 2UYNB 2UYNA 3D01A 3LMEA 3M4SA 1DBFA 3VCZA 3ZO8A 1J7HA 1FNJA 3MQWA 4NWOB 1QAHA 3KJKA 2CW4A 3LYBA 1JD1A 3V4DA 2CVLA 3I7TA 3ZOPA 2IG8A 2UYPA
chains in the Genus database with same CATH superfamily
1TVKA 5CA1A 1JFFA 2R751 3VO8A 2GLZA 1VQVA 2ZVYA 4G4WA 4C81A 2UYKA 2OTMA 5CB4B 2YYEA 4O2BB 2BO1A 4TUYB 3ZP4A 5EB0A 1Z5WA 1VQMF 1COMA 2CSLA 4O4HA 5GANK 3F0FA 3JAKA 4YJ3B 5HWEA 1H47A 3D01A 4XCQA 4BT7A 3O85A 4X20B 3IMPA 1RQ2A 3NMUC 3CCSF 5HXUA 4B46A 3LWOC 2EWCA 3JASB 3WPXA 4HNAA 5KMGA 5LOVA 4NUTA 4ZI7B 5IJ9B 1T0KB 1VQ9F 5CA0B 2L26A 3HKEA 2HS3A 3QHDA 2LCAA 3KJJA 4C8GA 2OTLF 1W5BA 3VOAA 3MCAB 5MN4A 3IEQA 2PHNA 1GX1A 3NK7A 1W57A 4X1YB 4M8IA 1Q86H 2H6LA 3HKDA 3KE1A 5JH7A 3P4EA 5FNVA 4F6RA 1KC8H 3HKCB 3RYCA 3I7TA 1FFXA 1W40A 3M84A 1QD9A 3CXCF 5EO3A 3J80M 3HKBA 3CYQA 4X3LA 1W59A 2BTOA 3RA6A 1YJWF 2K1SA 4WBNB 5HY2A 4EI9A 3S0WA 3QTYA 3RYHA 4ZOLB 3JVHA 1SA0B 1W42A 3F0EA 4BVSA 3UT5A 3I3FA 2GZLA 1ODEA 4X1KA 2RHHA 4I55B 3RYFB 4C82A 1JD1A 4I4TB 4O2AA 5BMVA 5IYZB 5JVDA 2GVIA 3ERNA 3S0YA 3CC7F 3ON1A 3K0TA 3N2KA 3RYIB 4YJ2B 3WJPA 3IKEA 2UZHA 3IEWA 4FFBB 1E7KA 5LP6C 3E22A 5KX5B 2DYYA 3C9RA 1VH8A 4X1IB 3JCMM 5LP6A 2LBTA 2RHOA 5ITZA 2RB9A 5G4VC 4BVTA 2ZVZA 4BVQA 3K12A 1W41A 3V3TA 2N48A 4EI8A 4ZHQB 1U3PA 3HAXD 1YITF 2WALA 4B45A 4EI7A 4TV8B 3M1XA 4ZHYB 5J2UA 3G6EF 4BVRA 3GHZA 1YIJF 5GONB 3JALB 3ZO8A 3SIVA 5C8YB 5LXTA 2HP3A 2Z01A 4DRXB 3KHNA 3V4DA 5MN5A 3FBAA 2R6R1 2IG8A 2H8EA 5CA1B 4I50A 5GAPK 1KD1H 1IV1A 4ZK7A 2CWJA 1VQ8F 4EB6A 2ZF8A 5AVMA 5DCVA 3JAKB 3VYUC 2UYJA 1VQLF 2UYNB 5LA6A 1FNJA 3C9SA 3CB2A 3OONA 1DT9A 1T0AA 3JAMM 1W55A 3VYTC 2CHTA 1X52A 5LOVB 3G71F 1KNKA 3WXMB 4G4VA 2P6YA 1SDSA 5CB4A 1ONIA 4O2BA 3FPIA 3E1YA 2Q1YA 5IJ0A 4TUYA 2W8BC 4O4JA 1YHQF 5HP7A 3JATA 2HQSC 3HKDB 5EIBD 3GYQA 3OBYA 4G88A 5JH7B 5FNVB 4X20A 1NJIH 2ZOVA 4C4WC 2FGYA 1VQKF 1GO0A 2ZAUA 1IPAA 2LBWA 3CPQA 2F9ZC 1Z5VA 1XHOA 3V7EA 5HP8A 3JASA 3HKBB 3TD4A 3WGMA 1KQSF 4ZI7A 5IJ9A 3GTZA 3E20B 1VQOF 2HP0A 1ZWZA 5GIOC 1IV3A 3ESJA 4IIJA 4E6EA 3RYHB 2HS0A 3QUWA 4U3JA 1Q81H 3P0ZA 1R1MA 1K9MH 3IKFA 3VIUA 1VQPF 4IHJB 4X1YA 3CC2F 4BT5A 2VGNA 4NWOB 2RHJA 2AIZP 3IR9A 4C8IA 2IAFA 1KNJA 2H8CA 3FD5A 3CCEF 3CCMF 2BTQB 3S02A 1J7HA 1X7PA 2KGWA 3N2KB 1PXWA 4NQ3A 4TZZA 1K73H 3OBWA 2JNBA 4C8EA 4DXDA 2MQEA 3JAWB 4O4LB 3WGLA 2HRUA 1YI2F 3E22B 3TD3A 4ZHWA 3Q8HA 4ZOLA 4ERHA 4X3MA 1SA0A 1U40A 3VI6A 4BT4A 3CCQF 1QU9A 4ZHVA 3HJWC 2Q1XA 5JQGA 3EORA 3HTNA 2Z1TA 1OFUA 3N4YA 4I4TA 3OW2F 5HY1A 5JCOC 4LNUB 4B5CA 3RA5A 3VTIC 5IYZA 3NVIB 3MCQA 1TUBA 3K14A 3J7AR 1GO1A 1OAPA 4YJ2A 3R0PA 5FLXM 3P10A 3C8LA 5J2UB 1H48A 3DC2A 2ZODA 5HY0A 4BT2A 1VHAA 5J2TA 1RQ7A 1X25A 3S03A 2HX0A 4X1IA 5G4UC 1W5AA 3LMEA 3F6MA 3JARB 5LXTB 3LWQC 3CCUF 5FJ4C 3SIUA 3LYBA 3F0DA 5LYJB 3CG6A 2UYPA 2VAPA 5GINC 5EYPA 1TVKB 1FNKA 1Q82H 1JFFB 1PF5A 2VAMA 3J81M 1Q8RA 2KTUA 3ZP7A 4ZHQA 4G4XA 3N4ZA 1RA4A 1VK3A 2AMTA 3HWUA 3B6NA 4TV8A 3I56F 2QI2A 4O4IA 3I55F 1UFYA 1W581 4O4HB 3WJRA 1SZQA 2VXYA 3N2GA 5EIBC 5EAZA 5EZYA 2IQQA 3WGNA 5C8YA 2OHWA 3KJKA 4TV9A 4DRXA 2LBXA 3CD6F 3ZOPA 3LWRC 1CN7A 2QEXF 2V9YA 1VQ5F 1VQ7F 2OZBA 4HNAB 5EWRA 5KMGB 3TD5A 2QTPA 2DT4A 3WGKA 3HKEB 5IJ0B 4O4JB 3CPWF 2BTUA 3VMFB 4PWTA 5HXZA 3JATB 2QA4F 3G4SF 3C9TA 1U43A 4YJ3A 1RLUA 2UYNA 3PLAC 3M4SA 3NK6A 1Q7YH 1VQNF 2HVYD 2Z1UA 4F6RB 3VYSC 3RYCB 1FFXB 1YQNA 3K2XA 3CMAF 2VAWA 2KG4A 3CYPB 1JJ2F 2AIFA 3LFOA 2HP0B 3CC4F 1NQ3A 1H7MA 1M1KH 3L7QA 4IIJB 5CA0A 2G9IA 4U3JB 4BW0B 5GIPC 3KIZA 3UT5B 3D54A 3FFMA 2Z1FA 3C9UA 2OTJF 3VCZA 1CLIA 4X1KB 1XBIA 1QAHA 4BY9D 2CW4A 1VQ4F 3NVKE 4LCKA 2I6RA 3RE3A 4O2AB 3HKCA 2CVLA 5BMVB 3CMEF 3CCLF 1JN1A 5JVDB 3LWPC 3MBMA 1W2BF 2KTVA 5HY4A 3PAFA 1RLGA 2HS4A 1CK2A 4BT6A 1X7OA 3WPWA 4WBNA 3U0OA 5A2QM 3T80A 1W5EA 2B33A 2HRYA 2CZWA 1YJ9F 2RHLA 1JY8A 4IHJA 1NMUB 1YGYA 5EB1B 2CHSA 3D00A 3AGKA 5JQGB 2FC3A 5LP6B 4U39A 3V7QA 5ITZB 1M90H 4I55A 1VQ6F 3RYFA 4B62A 4KWEA 3WJQA 1QVFF 1TUBB 1QVGF 3CCRF 1N8RH 3BYQA 5JCOA 3RYIA 2VGMA 2YXZA 1W3EX 3JAWA 3S0HA 1S72F 4O4LA 4FFBA 4R40B 5J2TB 5KX5A 1XV2A 3CCVF 4RHAA 1YJNF 1XRGA 3LWVC 4G4ZA 2NMUA 4BT3A 1FSZA 2Z1EA 3FD6A 1W5FA 4LNUA 3WGJA 3MDOA 5EYPB 2ALEA 4RQOA 5MN6A 4I50B 3S06A 3LDTA 5B8FA 5IT9M 3CCJF 3ELCA 2I6DA 4O4IB 4EB6B 1U3LA 1IV2A 1IV4A 4G4YA 3N2GB 3DDNA 1UI9A 5EZYB 1DBFA 3F0GA 5GONA 3JARA 3JALA 5LA6B 3MQWA 4TV9B 1K8AH 3VOBA 2PMPA 5LYJA 1GZ0A
chains in the Genus database with same CATH topology
3K12A 1QD9A 1FNKA 1XHOA 5HP8A 1PF5A 2EWCA 2CHTA 3K0TA 3ZP7A 3GTZA 4ZK7A 1NQ3A 2UYKA 3L7QA 3R0PA 2CWJA 2OTMA 1ONIA 3M1XA 3KJJA 3QUWA 2B33A 2DYYA 1UFYA 3ZP4A 1COMA 1X25A 1XRGA 2CSLA 5HP7A 1QU9A 3I3FA 2UYJA 1ODEA 2CHSA 1UI9A 2UYNB 2UYNA 3D01A 3LMEA 3M4SA 1DBFA 3VCZA 3ZO8A 1J7HA 1FNJA 3MQWA 4NWOB 1QAHA 3KJKA 2CW4A 3LYBA 1JD1A 3V4DA 2CVLA 3I7TA 3ZOPA 2IG8A 2UYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K12 A;  1QD9 A;  1FNK A;  1XHO A;  5HP8 A;  1PF5 A;  2EWC A;  2CHT A;  3K0T A;  3ZP7 A;  3GTZ A;  4ZK7 A;  1NQ3 A;  2UYK A;  3L7Q A;  3R0P A;  2CWJ A;  2OTM A;  1ONI A;  3M1X A;  3KJJ A;  3QUW A;  2B33 A;  2DYY A;  1UFY A;  3ZP4 A;  1COM A;  1X25 A;  1XRG A;  2CSL A;  5HP7 A;  1QU9 A;  3I3F A;  2UYJ A;  1ODE A;  2CHS A;  1UI9 A;  2UYN B;  2UYN A;  3D01 A;  3LME A;  3M4S A;  1DBF A;  3VCZ A;  3ZO8 A;  1J7H A;  1FNJ A;  3MQW A;  4NWO B;  1QAH A;  3KJK A;  2CW4 A;  3LYB A;  1JD1 A;  3V4D A;  2CVL A;  3I7T A;  3ZOP A;  2IG8 A;  2UYP A; 
#chains in the Genus database with same CATH topology
 1TVK A;  5CA1 A;  1JFF A;  2R75 1;  3VO8 A;  2GLZ A;  1VQV A;  2ZVY A;  4G4W A;  4C81 A;  2UYK A;  2OTM A;  5CB4 B;  2YYE A;  4O2B B;  2BO1 A;  4TUY B;  3ZP4 A;  5EB0 A;  1Z5W A;  1VQM F;  1COM A;  2CSL A;  4O4H A;  5GAN K;  3F0F A;  3JAK A;  4YJ3 B;  5HWE A;  1H47 A;  3D01 A;  4XCQ A;  4BT7 A;  3O85 A;  4X20 B;  3IMP A;  1RQ2 A;  3NMU C;  3CCS F;  5HXU A;  4B46 A;  3LWO C;  2EWC A;  3JAS B;  3WPX A;  4HNA A;  5KMG A;  5LOV A;  4NUT A;  4ZI7 B;  5IJ9 B;  1T0K B;  1VQ9 F;  5CA0 B;  2L26 A;  3HKE A;  2HS3 A;  3QHD A;  2LCA A;  3KJJ A;  4C8G A;  2OTL F;  1W5B A;  3VOA A;  3MCA B;  5MN4 A;  3IEQ A;  2PHN A;  1GX1 A;  3NK7 A;  1W57 A;  4X1Y B;  4M8I A;  1Q86 H;  2H6L A;  3HKD A;  3KE1 A;  5JH7 A;  3P4E A;  5FNV A;  4F6R A;  1KC8 H;  3HKC B;  3RYC A;  3I7T A;  1FFX A;  1W40 A;  3M84 A;  1QD9 A;  3CXC F;  5EO3 A;  3J80 M;  3HKB A;  3CYQ A;  4X3L A;  1W59 A;  2BTO A;  3RA6 A;  1YJW F;  2K1S A;  4WBN B;  5HY2 A;  4EI9 A;  3S0W A;  3QTY A;  3RYH A;  4ZOL B;  3JVH A;  1SA0 B;  1W42 A;  3F0E A;  4BVS A;  3UT5 A;  3I3F A;  2GZL A;  1ODE A;  4X1K A;  2RHH A;  4I55 B;  3RYF B;  4C82 A;  1JD1 A;  4I4T B;  4O2A A;  5BMV A;  5IYZ B;  5JVD A;  2GVI A;  3ERN A;  3S0Y A;  3CC7 F;  3ON1 A;  3K0T A;  3N2K A;  3RYI B;  4YJ2 B;  3WJP A;  3IKE A;  2UZH A;  3IEW A;  4FFB B;  1E7K A;  5LP6 C;  3E22 A;  5KX5 B;  2DYY A;  3C9R A;  1VH8 A;  4X1I B;  3JCM M;  5LP6 A;  2LBT A;  2RHO A;  5ITZ A;  2RB9 A;  5G4V C;  4BVT A;  2ZVZ A;  4BVQ A;  3K12 A;  1W41 A;  3V3T A;  2N48 A;  4EI8 A;  4ZHQ B;  1U3P A;  3HAX D;  1YIT F;  2WAL A;  4B45 A;  4EI7 A;  4TV8 B;  3M1X A;  4ZHY B;  5J2U A;  3G6E F;  4BVR A;  3GHZ A;  1YIJ F;  5GON B;  3JAL B;  3ZO8 A;  3SIV A;  5C8Y B;  5LXT A;  2HP3 A;  2Z01 A;  4DRX B;  3KHN A;  3V4D A;  5MN5 A;  3FBA A;  2R6R 1;  2IG8 A;  2H8E A;  5CA1 B;  4I50 A;  5GAP K;  1KD1 H;  1IV1 A;  4ZK7 A;  2CWJ A;  1VQ8 F;  4EB6 A;  2ZF8 A;  5AVM A;  5DCV A;  3JAK B;  3VYU C;  2UYJ A;  1VQL F;  2UYN B;  5LA6 A;  1FNJ A;  3C9S A;  3CB2 A;  3OON A;  1DT9 A;  1T0A A;  3JAM M;  1W55 A;  3VYT C;  2CHT A;  1X52 A;  5LOV B;  3G71 F;  1KNK A;  3WXM B;  4G4V A;  2P6Y A;  1SDS A;  5CB4 A;  1ONI A;  4O2B A;  3FPI A;  3E1Y A;  2Q1Y A;  5IJ0 A;  4TUY A;  2W8B C;  4O4J A;  1YHQ F;  5HP7 A;  3JAT A;  2HQS C;  3HKD B;  5EIB D;  3GYQ A;  3OBY A;  4G88 A;  5JH7 B;  5FNV B;  4X20 A;  1NJI H;  2ZOV A;  4C4W C;  2FGY A;  1VQK F;  1GO0 A;  2ZAU A;  1IPA A;  2LBW A;  3CPQ A;  2F9Z C;  1Z5V A;  1XHO A;  3V7E A;  5HP8 A;  3JAS A;  3HKB B;  3TD4 A;  3WGM A;  1KQS F;  4ZI7 A;  5IJ9 A;  3GTZ A;  3E20 B;  1VQO F;  2HP0 A;  1ZWZ A;  5GIO C;  1IV3 A;  3ESJ A;  4IIJ A;  4E6E A;  3RYH B;  2HS0 A;  3QUW A;  4U3J A;  1Q81 H;  3P0Z A;  1R1M A;  1K9M H;  3IKF A;  3VIU A;  1VQP F;  4IHJ B;  4X1Y A;  3CC2 F;  4BT5 A;  2VGN A;  4NWO B;  2RHJ A;  2AIZ P;  3IR9 A;  4C8I A;  2IAF A;  1KNJ A;  2H8C A;  3FD5 A;  3CCE F;  3CCM F;  2BTQ B;  3S02 A;  1J7H A;  1X7P A;  2KGW A;  3N2K B;  1PXW A;  4NQ3 A;  4TZZ A;  1K73 H;  3OBW A;  2JNB A;  4C8E A;  4DXD A;  2MQE A;  3JAW B;  4O4L B;  3WGL A;  2HRU A;  1YI2 F;  3E22 B;  3TD3 A;  4ZHW A;  3Q8H A;  4ZOL A;  4ERH A;  4X3M A;  1SA0 A;  1U40 A;  3VI6 A;  4BT4 A;  3CCQ F;  1QU9 A;  4ZHV A;  3HJW C;  2Q1X A;  5JQG A;  3EOR A;  3HTN A;  2Z1T A;  1OFU A;  3N4Y A;  4I4T A;  3OW2 F;  5HY1 A;  5JCO C;  4LNU B;  4B5C A;  3RA5 A;  3VTI C;  5IYZ A;  3NVI B;  3MCQ A;  1TUB A;  3K14 A;  3J7A R;  1GO1 A;  1OAP A;  4YJ2 A;  3R0P A;  5FLX M;  3P10 A;  3C8L A;  5J2U B;  1H48 A;  3DC2 A;  2ZOD A;  5HY0 A;  4BT2 A;  1VHA A;  5J2T A;  1RQ7 A;  1X25 A;  3S03 A;  2HX0 A;  4X1I A;  5G4U C;  1W5A A;  3LME A;  3F6M A;  3JAR B;  5LXT B;  3LWQ C;  3CCU F;  5FJ4 C;  3SIU A;  3LYB A;  3F0D A;  5LYJ B;  3CG6 A;  2UYP A;  2VAP A;  5GIN C;  5EYP A;  1TVK B;  1FNK A;  1Q82 H;  1JFF B;  1PF5 A;  2VAM A;  3J81 M;  1Q8R A;  2KTU A;  3ZP7 A;  4ZHQ A;  4G4X A;  3N4Z A;  1RA4 A;  1VK3 A;  2AMT A;  3HWU A;  3B6N A;  4TV8 A;  3I56 F;  2QI2 A;  4O4I A;  3I55 F;  1UFY A;  1W58 1;  4O4H B;  3WJR A;  1SZQ A;  2VXY A;  3N2G A;  5EIB C;  5EAZ A;  5EZY A;  2IQQ A;  3WGN A;  5C8Y A;  2OHW A;  3KJK A;  4TV9 A;  4DRX A;  2LBX A;  3CD6 F;  3ZOP A;  3LWR C;  1CN7 A;  2QEX F;  2V9Y A;  1VQ5 F;  1VQ7 F;  2OZB A;  4HNA B;  5EWR A;  5KMG B;  3TD5 A;  2QTP A;  2DT4 A;  3WGK A;  3HKE B;  5IJ0 B;  4O4J B;  3CPW F;  2BTU A;  3VMF B;  4PWT A;  5HXZ A;  3JAT B;  2QA4 F;  3G4S F;  3C9T A;  1U43 A;  4YJ3 A;  1RLU A;  2UYN A;  3PLA C;  3M4S A;  3NK6 A;  1Q7Y H;  1VQN F;  2HVY D;  2Z1U A;  4F6R B;  3VYS C;  3RYC B;  1FFX B;  1YQN A;  3K2X A;  3CMA F;  2VAW A;  2KG4 A;  3CYP B;  1JJ2 F;  2AIF A;  3LFO A;  2HP0 B;  3CC4 F;  1NQ3 A;  1H7M A;  1M1K H;  3L7Q A;  4IIJ B;  5CA0 A;  2G9I A;  4U3J B;  4BW0 B;  5GIP C;  3KIZ A;  3UT5 B;  3D54 A;  3FFM A;  2Z1F A;  3C9U A;  2OTJ F;  3VCZ A;  1CLI A;  4X1K B;  1XBI A;  1QAH A;  4BY9 D;  2CW4 A;  1VQ4 F;  3NVK E;  4LCK A;  2I6R A;  3RE3 A;  4O2A B;  3HKC A;  2CVL A;  5BMV B;  3CME F;  3CCL F;  1JN1 A;  5JVD B;  3LWP C;  3MBM A;  1W2B F;  2KTV A;  5HY4 A;  3PAF A;  1RLG A;  2HS4 A;  1CK2 A;  4BT6 A;  1X7O A;  3WPW A;  4WBN A;  3U0O A;  5A2Q M;  3T80 A;  1W5E A;  2B33 A;  2HRY A;  2CZW A;  1YJ9 F;  2RHL A;  1JY8 A;  4IHJ A;  1NMU B;  1YGY A;  5EB1 B;  2CHS A;  3D00 A;  3AGK A;  5JQG B;  2FC3 A;  5LP6 B;  4U39 A;  3V7Q A;  5ITZ B;  1M90 H;  4I55 A;  1VQ6 F;  3RYF A;  4B62 A;  4KWE A;  3WJQ A;  1QVF F;  1TUB B;  1QVG F;  3CCR F;  1N8R H;  3BYQ A;  5JCO A;  3RYI A;  2VGM A;  2YXZ A;  1W3E X;  3JAW A;  3S0H A;  1S72 F;  4O4L A;  4FFB A;  4R40 B;  5J2T B;  5KX5 A;  1XV2 A;  3CCV F;  4RHA A;  1YJN F;  1XRG A;  3LWV C;  4G4Z A;  2NMU A;  4BT3 A;  1FSZ A;  2Z1E A;  3FD6 A;  1W5F A;  4LNU A;  3WGJ A;  3MDO A;  5EYP B;  2ALE A;  4RQO A;  5MN6 A;  4I50 B;  3S06 A;  3LDT A;  5B8F A;  5IT9 M;  3CCJ F;  3ELC A;  2I6D A;  4O4I B;  4EB6 B;  1U3L A;  1IV2 A;  1IV4 A;  4G4Y A;  3N2G B;  3DDN A;  1UI9 A;  5EZY B;  1DBF A;  3F0G A;  5GON A;  3JAR A;  3JAL A;  5LA6 B;  3MQW A;  4TV9 B;  1K8A H;  3VOB A;  2PMP A;  5LYJ A;  1GZ0 A; 
#chains in the Genus database with same CATH homology
 3K12 A;  1QD9 A;  1FNK A;  1XHO A;  5HP8 A;  1PF5 A;  2EWC A;  2CHT A;  3K0T A;  3ZP7 A;  3GTZ A;  4ZK7 A;  1NQ3 A;  2UYK A;  3L7Q A;  3R0P A;  2CWJ A;  2OTM A;  1ONI A;  3M1X A;  3KJJ A;  3QUW A;  2B33 A;  2DYY A;  1UFY A;  3ZP4 A;  1COM A;  1X25 A;  1XRG A;  2CSL A;  5HP7 A;  1QU9 A;  3I3F A;  2UYJ A;  1ODE A;  2CHS A;  1UI9 A;  2UYN B;  2UYN A;  3D01 A;  3LME A;  3M4S A;  1DBF A;  3VCZ A;  3ZO8 A;  1J7H A;  1FNJ A;  3MQW A;  4NWO B;  1QAH A;  3KJK A;  2CW4 A;  3LYB A;  1JD1 A;  3V4D A;  2CVL A;  3I7T A;  3ZOP A;  2IG8 A;  2UYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...