3ERNA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with aracmp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 45
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ernA00
1YQNA 1VH8A 1U40A 1IV1A 4C8EA 3EORA 1IV4A 1KNKA 3FPIA 4C8IA 1GX1A 3GHZA 3F0DA 1JN1A 1W57A 3FBAA 2AMTA 1IV3A 2UZHA 3IEWA 1VHAA 3JVHA 3P10A 3Q8HA 3RE3A 1U3PA 3K14A 3IKFA 3ELCA 3B6NA 1H48A 1W55A 3ERNA 3F0EA 3QHDA 4C8GA 2GZLA 3P0ZA 3KE1A 3IKEA 1T0AA 3IEQA 4C82A 4C81A 1U3LA 2PMPA 3F6MA 1IV2A 3MBMA 3F0FA 5B8FA 1KNJA 1JY8A 3T80A 1U43A 3ESJA 3F0GA 3K2XA 1H47A
chains in the Genus database with same CATH superfamily
1X7PA 1FNJA 3G6EF 3J81M 3VI6A 3CD6F 5EZYA 5LP6A 5EYPA 3GHZA 2Z01A 3DDNA 2DT4A 3F0DA 3TD5A 4IHJA 3S0HA 1N8RH 2GZLA 2HP0B 3HWUA 3KE1A 1YJ9F 3N2KB 3CYPB 3HKCA 1RLUA 3VO8A 4EB6B 1CK2A 1RLGA 5IJ0A 4ZHQB 3I56F 3KHNA 3N2GB 3RYIB 2P6YA 1W3EX 1W5FA 3OBWA 1K9MH 3UT5A 3VCZA 3QUWA 3WGLA 3HTNA 4O4JA 2HS3A 3S03A 4X20A 5HXUA 2BTOA 3MQWA 3N4YA 4ZHYB 1RA4A 5A2QM 4WBNA 2LBWA 3CXCF 2HX0A 5IYZA 4X1KA 5GAPK 3WGNA 1W2BF 5JQGB 1VQ4F 5GINC 3R0PA 1VQKF 1S72F 5EIBD 2PMPA 2IG8A 3ZOPA 1QD9A 3NK6A 2RB9A 4M8IA 2OTMA 4G4ZA 3K2XA 3WPWA 4G4WA 2EWCA 2GVIA 4IIJB 3VOBA 1VH8A 3CB2A 1KNKA 1COMA 1J7HA 1FNKA 4O2BB 4NUTA 4NWOB 3P4EA 5LP6B 1U3PA 1OFUA 3CG6A 4IHJB 3P0ZA 1E7KA 1Q82H 2ZF8A 2Z1FA 3V7QA 3O85A 1PF5A 3IR9A 3CCLF 1SZQA 5HWEA 3J7AR 1ZWZA 1Q8RA 1H47A 3HKCB 4O4HA 1IV1A 4TZZA 3EORA 3GYQA 1YJWF 3K0TA 2FGYA 5LYJB 5GIOC 1JD1A 4O4JB 1FSZA 1RQ2A 2HS0A 3VIUA 1VQ6F 4B46A 3F0EA 3ZP7A 1OAPA 4WBNB 3M84A 4X3MA 2B33A 5HP7A 5J2TB 3CCEF 4C82A 4BT5A 5BMVB 3LMEA 4BVRA 5IYZB 4LCKA 4ZI7A 5C8YB 2OTLF 5HY2A 1TVKA 3JALA 3I55F 2BTUA 3E22A 2DYYA 4ZHVA 3V7EA 2QI2A 2WALA 3VMFB 2Q1YA 3CCQF 1VQMF 1TUBA 2QA4F 1YHQF 5FLXM 1YI2F 5JH7A 3JATA 3HKBB 1Q86H 5ITZA 3LYBA 4ZOLA 1IV3A 2H8EA 1X25A 3Q8HA 5DCVA 3S06A 2PHNA 1ODEA 3OONA 4TV9B 2HQSC 1Q7YH 2F9ZC 3IEQA 4BVTA 3CCSF 1YGYA 3E20B 2HRUA 1SDSA 2KTUA 1GZ0A 3N4ZA 3WJQA 2JNBA 3GTZA 4BT4A 4LNUB 2QTPA 2R6R1 3MCQA 2Z1TA 3OBYA 4RQOA 3C9RA 3FD5A 4BY9D 4X1YB 1W57A 2AMTA 2UZHA 5EB1B 3JVHA 3RYFA 3CYQA 2Z1EA 2W8BC 1FFXA 3ELCA 3QHDA 4RHAA 1RQ7A 3C9SA 5EIBC 3RYHB 4U3JA 4XCQA 1W5AA 5KX5B 1JJ2F 3VYTC 5EB0A 5FNVB 4X3LA 4YJ2A 1XHOA 1CN7A 1U40A 3LWVC 3RA6A 3LWRC 1TVKB 1SA0B 2HVYD 3JCMM 3E1YA 4O2AA 1DBFA 1TUBB 1QAHA 2GLZA 3CMEF 5LA6B 5JH7B 2BO1A 3JATB 5ITZB 3ERNA 4C8GA 1VQ9F 2RHOA 3HKDA 1U3LA 2CZWA 2L26A 3MBMA 2BTQB 5CA0A 4TV8A 3M1XA 1NMUB 1YIJF 5EWRA 3HAXD 4U39A 2R751 4B5CA 5JVDA 4BT3A 1QU9A 3FFMA 3WGJA 4TUYA 3AGKA 3D54A 3IEWA 4BT7A 5KMGA 3CCVF 1VHAA 5J2UA 1W42A 5EZYB 3IMPA 1DT9A 5EYPB 2OZBA 5JCOC 2MQEA 3RYFB 1W59A 3LDTA 1KC8H 4BVSA 1KD1H 3VTIC 2OHWA 3F0FA 3MDOA 1JY8A 3CCRF 3CC4F 4U3JB 3F0GA 4YJ3A 3CCUF 3JAMM 5IJ0B 3JASA 3HKEA 3G71F 4YJ2B 2H8CA 4DRXA 5LP6C 1GX1A 1W581 4O4IA 1JFFA 2IQQA 3UT5B 2HP3A 1QVFF 3JARA 5CB4A 3IKFA 4X20B 2Q1XA 4FFBA 4F6RA 2I6RA 3KJKA 3U0OA 5LXTA 2K1SA 5FJ4C 2ZODA 5IJ9A 4KWEA 1GO0A 4EI9A 4HNAA 3PAFA 4X1KB 3HKDB 3LFOA 3V4DA 4EI8A 1PXWA 5G4VC 5AVMA 2NMUA 5CA0B 2ZOVA 4TV8B 1VQLF 4C8EA 2VGMA 3MCAB 1VQOF 3TD3A 3DC2A 2VAPA 2ZAUA 5JVDB 1K73H 3FBAA 2N48A 3OW2F 5GANK 1ONIA 4ZK7A 3G4SF 4G4VA 4TUYB 4R40B 4BW0B 4C4WC 5KMGB 3PLAC 5J2UB 4EB6A 3WJPA 5LOVA 2CSLA 3M4SA 3KIZA 4X1IA 3CPWF 1CLIA 5MN4A 1W41A 1IV4A 4O4HB 3WPXA 3CC7F 5MN6A 3NMUC 3JASB 2AIFA 4I50A 4DRXB 3K14A 2AIZP 1JFFB 1H48A 2RHJA 3JARB 2V9YA 2VXYA 1VQVA 2RHHA 4FFBB 4E6EA 1Z5VA 4NQ3A 3F6MA 4G4XA 3S02A 3CC2F 4F6RB 1KNJA 5LXTB 4B62A 2KG4A 4ZHWA 2UYJA 2YXZA 2VAMA 5IJ9B 3CPQA 1YQNA 2I6DA 4HNAB 4ZI7B 1M1KH 4O2BA 3BYQA 2Z1UA 5GIPC 3SIUA 3HJWC 2UYNA 3FD6A 3FPIA 4I4TA 4C8IA 2UYPA 3JALB 3JAKA 3E22B 3RA5A 1JN1A 3VYUC 1X52A 3S0YA 5CA1A 4PWTA 4O4LA 1NJIH 3K12A 3CCMF 1YJNF 1W55A 4ZOLB 2FC3A 2CHSA 3IKEA 3RYCA 1H7MA 1KQSF 3J80M 1UI9A 3T80A 3CCJF 1K8AH 2CVLA 5LYJA 5LOVB 5HY4A 4X1IB 2VGNA 4I55A 5HXZA 1Z5WA 2RHLA 3WGMA 5GONA 1NQ3A 3I7TA 5J2TA 3P10A 3L7QA 5BMVA 4BT2A 4I50B 5C8YA 3QTYA 3LWPC 2ZVYA 1FFXB 2OTJF 3JAWA 2LBXA 2G9IA 1U43A 1QVGF 2H6LA 1W40A 3HKBA 2CWJA 3LWQC 2VAWA 1R1MA 1XRGA 3CMAF 1Q81H 1YITF 1IPAA 4B45A 1UFYA 4TV9A 2UYNB 3TD4A 3ZO8A 4G88A 4I4TB 2HS4A 3JAKB 5EAZA 4ERHA 3VOAA 3C9UA 3WJRA 5CA1B 4O2AB 4O4LB 4BVQA 1W5EA 4LNUA 3S0WA 3D00A 4EI7A 5HP8A 3RYCB 5G4UC 1GO1A 4BT6A 2LCAA 5EO3A 4X1YA 2KGWA 3C8LA 3WXMB 3ZP4A 2UYKA 5HY1A 2ZVZA 3NVIB 1VQ8F 2KTVA 1XV2A 3C9TA 4I55B 2HP0A 3RYHA 1X7OA 3RE3A 5KX5A 4DXDA 3N2KA 3LWOC 5GONB 1W5BA 3NVKE 4ZHQA 2YYEA 5FNVA 2CW4A 2LBTA 3N2GA 1T0KB 3RYIA 3I3FA 3JAWB 1VQNF 1SA0A 2QEXF 2ALEA 3V3TA 1VQ7F 5LA6A 3ON1A 4YJ3B 5MN5A 3SIVA 2IAFA 5HY0A 1VQPF 1M90H 2CHTA 3HKEB 3VYSC 5JQGA 1VQ5F 3B6NA 1VK3A 5JCOA 3NK7A 4O4IB 3WGKA 5IT9M 1T0AA 3KJJA 3D01A 5CB4B 4C81A 1XBIA 1IV2A 4IIJA 5B8FA 4G4YA 2HRYA 3ESJA
chains in the Genus database with same CATH topology
1YQNA 1VH8A 1U40A 1IV1A 4C8EA 3EORA 1IV4A 1KNKA 3FPIA 4C8IA 1GX1A 3GHZA 3F0DA 1JN1A 1W57A 3FBAA 2AMTA 1IV3A 2UZHA 3IEWA 1VHAA 3JVHA 3P10A 3Q8HA 3RE3A 1U3PA 3K14A 3IKFA 3ELCA 3B6NA 1H48A 1W55A 3ERNA 3F0EA 3QHDA 4C8GA 2GZLA 3P0ZA 3KE1A 3IKEA 1T0AA 3IEQA 4C82A 4C81A 1U3LA 2PMPA 3F6MA 1IV2A 3MBMA 3F0FA 5B8FA 1KNJA 1JY8A 3T80A 1U43A 3ESJA 3F0GA 3K2XA 1H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQN A;  1VH8 A;  1U40 A;  1IV1 A;  4C8E A;  3EOR A;  1IV4 A;  1KNK A;  3FPI A;  4C8I A;  1GX1 A;  3GHZ A;  3F0D A;  1JN1 A;  1W57 A;  3FBA A;  2AMT A;  1IV3 A;  2UZH A;  3IEW A;  1VHA A;  3JVH A;  3P10 A;  3Q8H A;  3RE3 A;  1U3P A;  3K14 A;  3IKF A;  3ELC A;  3B6N A;  1H48 A;  1W55 A;  3ERN A;  3F0E A;  3QHD A;  4C8G A;  2GZL A;  3P0Z A;  3KE1 A;  3IKE A;  1T0A A;  3IEQ A;  4C82 A;  4C81 A;  1U3L A;  2PMP A;  3F6M A;  1IV2 A;  3MBM A;  3F0F A;  5B8F A;  1KNJ A;  1JY8 A;  3T80 A;  1U43 A;  3ESJ A;  3F0G A;  3K2X A;  1H47 A; 
#chains in the Genus database with same CATH topology
 1X7P A;  1FNJ A;  3G6E F;  3J81 M;  3VI6 A;  3CD6 F;  5EZY A;  5LP6 A;  5EYP A;  3GHZ A;  2Z01 A;  3DDN A;  2DT4 A;  3F0D A;  3TD5 A;  4IHJ A;  3S0H A;  1N8R H;  2GZL A;  2HP0 B;  3HWU A;  3KE1 A;  1YJ9 F;  3N2K B;  3CYP B;  3HKC A;  1RLU A;  3VO8 A;  4EB6 B;  1CK2 A;  1RLG A;  5IJ0 A;  4ZHQ B;  3I56 F;  3KHN A;  3N2G B;  3RYI B;  2P6Y A;  1W3E X;  1W5F A;  3OBW A;  1K9M H;  3UT5 A;  3VCZ A;  3QUW A;  3WGL A;  3HTN A;  4O4J A;  2HS3 A;  3S03 A;  4X20 A;  5HXU A;  2BTO A;  3MQW A;  3N4Y A;  4ZHY B;  1RA4 A;  5A2Q M;  4WBN A;  2LBW A;  3CXC F;  2HX0 A;  5IYZ A;  4X1K A;  5GAP K;  3WGN A;  1W2B F;  5JQG B;  1VQ4 F;  5GIN C;  3R0P A;  1VQK F;  1S72 F;  5EIB D;  2PMP A;  2IG8 A;  3ZOP A;  1QD9 A;  3NK6 A;  2RB9 A;  4M8I A;  2OTM A;  4G4Z A;  3K2X A;  3WPW A;  4G4W A;  2EWC A;  2GVI A;  4IIJ B;  3VOB A;  1VH8 A;  3CB2 A;  1KNK A;  1COM A;  1J7H A;  1FNK A;  4O2B B;  4NUT A;  4NWO B;  3P4E A;  5LP6 B;  1U3P A;  1OFU A;  3CG6 A;  4IHJ B;  3P0Z A;  1E7K A;  1Q82 H;  2ZF8 A;  2Z1F A;  3V7Q A;  3O85 A;  1PF5 A;  3IR9 A;  3CCL F;  1SZQ A;  5HWE A;  3J7A R;  1ZWZ A;  1Q8R A;  1H47 A;  3HKC B;  4O4H A;  1IV1 A;  4TZZ A;  3EOR A;  3GYQ A;  1YJW F;  3K0T A;  2FGY A;  5LYJ B;  5GIO C;  1JD1 A;  4O4J B;  1FSZ A;  1RQ2 A;  2HS0 A;  3VIU A;  1VQ6 F;  4B46 A;  3F0E A;  3ZP7 A;  1OAP A;  4WBN B;  3M84 A;  4X3M A;  2B33 A;  5HP7 A;  5J2T B;  3CCE F;  4C82 A;  4BT5 A;  5BMV B;  3LME A;  4BVR A;  5IYZ B;  4LCK A;  4ZI7 A;  5C8Y B;  2OTL F;  5HY2 A;  1TVK A;  3JAL A;  3I55 F;  2BTU A;  3E22 A;  2DYY A;  4ZHV A;  3V7E A;  2QI2 A;  2WAL A;  3VMF B;  2Q1Y A;  3CCQ F;  1VQM F;  1TUB A;  2QA4 F;  1YHQ F;  5FLX M;  1YI2 F;  5JH7 A;  3JAT A;  3HKB B;  1Q86 H;  5ITZ A;  3LYB A;  4ZOL A;  1IV3 A;  2H8E A;  1X25 A;  3Q8H A;  5DCV A;  3S06 A;  2PHN A;  1ODE A;  3OON A;  4TV9 B;  2HQS C;  1Q7Y H;  2F9Z C;  3IEQ A;  4BVT A;  3CCS F;  1YGY A;  3E20 B;  2HRU A;  1SDS A;  2KTU A;  1GZ0 A;  3N4Z A;  3WJQ A;  2JNB A;  3GTZ A;  4BT4 A;  4LNU B;  2QTP A;  2R6R 1;  3MCQ A;  2Z1T A;  3OBY A;  4RQO A;  3C9R A;  3FD5 A;  4BY9 D;  4X1Y B;  1W57 A;  2AMT A;  2UZH A;  5EB1 B;  3JVH A;  3RYF A;  3CYQ A;  2Z1E A;  2W8B C;  1FFX A;  3ELC A;  3QHD A;  4RHA A;  1RQ7 A;  3C9S A;  5EIB C;  3RYH B;  4U3J A;  4XCQ A;  1W5A A;  5KX5 B;  1JJ2 F;  3VYT C;  5EB0 A;  5FNV B;  4X3L A;  4YJ2 A;  1XHO A;  1CN7 A;  1U40 A;  3LWV C;  3RA6 A;  3LWR C;  1TVK B;  1SA0 B;  2HVY D;  3JCM M;  3E1Y A;  4O2A A;  1DBF A;  1TUB B;  1QAH A;  2GLZ A;  3CME F;  5LA6 B;  5JH7 B;  2BO1 A;  3JAT B;  5ITZ B;  3ERN A;  4C8G A;  1VQ9 F;  2RHO A;  3HKD A;  1U3L A;  2CZW A;  2L26 A;  3MBM A;  2BTQ B;  5CA0 A;  4TV8 A;  3M1X A;  1NMU B;  1YIJ F;  5EWR A;  3HAX D;  4U39 A;  2R75 1;  4B5C A;  5JVD A;  4BT3 A;  1QU9 A;  3FFM A;  3WGJ A;  4TUY A;  3AGK A;  3D54 A;  3IEW A;  4BT7 A;  5KMG A;  3CCV F;  1VHA A;  5J2U A;  1W42 A;  5EZY B;  3IMP A;  1DT9 A;  5EYP B;  2OZB A;  5JCO C;  2MQE A;  3RYF B;  1W59 A;  3LDT A;  1KC8 H;  4BVS A;  1KD1 H;  3VTI C;  2OHW A;  3F0F A;  3MDO A;  1JY8 A;  3CCR F;  3CC4 F;  4U3J B;  3F0G A;  4YJ3 A;  3CCU F;  3JAM M;  5IJ0 B;  3JAS A;  3HKE A;  3G71 F;  4YJ2 B;  2H8C A;  4DRX A;  5LP6 C;  1GX1 A;  1W58 1;  4O4I A;  1JFF A;  2IQQ A;  3UT5 B;  2HP3 A;  1QVF F;  3JAR A;  5CB4 A;  3IKF A;  4X20 B;  2Q1X A;  4FFB A;  4F6R A;  2I6R A;  3KJK A;  3U0O A;  5LXT A;  2K1S A;  5FJ4 C;  2ZOD A;  5IJ9 A;  4KWE A;  1GO0 A;  4EI9 A;  4HNA A;  3PAF A;  4X1K B;  3HKD B;  3LFO A;  3V4D A;  4EI8 A;  1PXW A;  5G4V C;  5AVM A;  2NMU A;  5CA0 B;  2ZOV A;  4TV8 B;  1VQL F;  4C8E A;  2VGM A;  3MCA B;  1VQO F;  3TD3 A;  3DC2 A;  2VAP A;  2ZAU A;  5JVD B;  1K73 H;  3FBA A;  2N48 A;  3OW2 F;  5GAN K;  1ONI A;  4ZK7 A;  3G4S F;  4G4V A;  4TUY B;  4R40 B;  4BW0 B;  4C4W C;  5KMG B;  3PLA C;  5J2U B;  4EB6 A;  3WJP A;  5LOV A;  2CSL A;  3M4S A;  3KIZ A;  4X1I A;  3CPW F;  1CLI A;  5MN4 A;  1W41 A;  1IV4 A;  4O4H B;  3WPX A;  3CC7 F;  5MN6 A;  3NMU C;  3JAS B;  2AIF A;  4I50 A;  4DRX B;  3K14 A;  2AIZ P;  1JFF B;  1H48 A;  2RHJ A;  3JAR B;  2V9Y A;  2VXY A;  1VQV A;  2RHH A;  4FFB B;  4E6E A;  1Z5V A;  4NQ3 A;  3F6M A;  4G4X A;  3S02 A;  3CC2 F;  4F6R B;  1KNJ A;  5LXT B;  4B62 A;  2KG4 A;  4ZHW A;  2UYJ A;  2YXZ A;  2VAM A;  5IJ9 B;  3CPQ A;  1YQN A;  2I6D A;  4HNA B;  4ZI7 B;  1M1K H;  4O2B A;  3BYQ A;  2Z1U A;  5GIP C;  3SIU A;  3HJW C;  2UYN A;  3FD6 A;  3FPI A;  4I4T A;  4C8I A;  2UYP A;  3JAL B;  3JAK A;  3E22 B;  3RA5 A;  1JN1 A;  3VYU C;  1X52 A;  3S0Y A;  5CA1 A;  4PWT A;  4O4L A;  1NJI H;  3K12 A;  3CCM F;  1YJN F;  1W55 A;  4ZOL B;  2FC3 A;  2CHS A;  3IKE A;  3RYC A;  1H7M A;  1KQS F;  3J80 M;  1UI9 A;  3T80 A;  3CCJ F;  1K8A H;  2CVL A;  5LYJ A;  5LOV B;  5HY4 A;  4X1I B;  2VGN A;  4I55 A;  5HXZ A;  1Z5W A;  2RHL A;  3WGM A;  5GON A;  1NQ3 A;  3I7T A;  5J2T A;  3P10 A;  3L7Q A;  5BMV A;  4BT2 A;  4I50 B;  5C8Y A;  3QTY A;  3LWP C;  2ZVY A;  1FFX B;  2OTJ F;  3JAW A;  2LBX A;  2G9I A;  1U43 A;  1QVG F;  2H6L A;  1W40 A;  3HKB A;  2CWJ A;  3LWQ C;  2VAW A;  1R1M A;  1XRG A;  3CMA F;  1Q81 H;  1YIT F;  1IPA A;  4B45 A;  1UFY A;  4TV9 A;  2UYN B;  3TD4 A;  3ZO8 A;  4G88 A;  4I4T B;  2HS4 A;  3JAK B;  5EAZ A;  4ERH A;  3VOA A;  3C9U A;  3WJR A;  5CA1 B;  4O2A B;  4O4L B;  4BVQ A;  1W5E A;  4LNU A;  3S0W A;  3D00 A;  4EI7 A;  5HP8 A;  3RYC B;  5G4U C;  1GO1 A;  4BT6 A;  2LCA A;  5EO3 A;  4X1Y A;  2KGW A;  3C8L A;  3WXM B;  3ZP4 A;  2UYK A;  5HY1 A;  2ZVZ A;  3NVI B;  1VQ8 F;  2KTV A;  1XV2 A;  3C9T A;  4I55 B;  2HP0 A;  3RYH A;  1X7O A;  3RE3 A;  5KX5 A;  4DXD A;  3N2K A;  3LWO C;  5GON B;  1W5B A;  3NVK E;  4ZHQ A;  2YYE A;  5FNV A;  2CW4 A;  2LBT A;  3N2G A;  1T0K B;  3RYI A;  3I3F A;  3JAW B;  1VQN F;  1SA0 A;  2QEX F;  2ALE A;  3V3T A;  1VQ7 F;  5LA6 A;  3ON1 A;  4YJ3 B;  5MN5 A;  3SIV A;  2IAF A;  5HY0 A;  1VQP F;  1M90 H;  2CHT A;  3HKE B;  3VYS C;  5JQG A;  1VQ5 F;  3B6N A;  1VK3 A;  5JCO A;  3NK7 A;  4O4I B;  3WGK A;  5IT9 M;  1T0A A;  3KJJ A;  3D01 A;  5CB4 B;  4C81 A;  1XBI A;  1IV2 A;  4IIJ A;  5B8F A;  4G4Y A;  2HRY A;  3ESJ A; 
#chains in the Genus database with same CATH homology
 1YQN A;  1VH8 A;  1U40 A;  1IV1 A;  4C8E A;  3EOR A;  1IV4 A;  1KNK A;  3FPI A;  4C8I A;  1GX1 A;  3GHZ A;  3F0D A;  1JN1 A;  1W57 A;  3FBA A;  2AMT A;  1IV3 A;  2UZH A;  3IEW A;  1VHA A;  3JVH A;  3P10 A;  3Q8H A;  3RE3 A;  1U3P A;  3K14 A;  3IKF A;  3ELC A;  3B6N A;  1H48 A;  1W55 A;  3ERN A;  3F0E A;  3QHD A;  4C8G A;  2GZL A;  3P0Z A;  3KE1 A;  3IKE A;  1T0A A;  3IEQ A;  4C82 A;  4C81 A;  1U3L A;  2PMP A;  3F6M A;  1IV2 A;  3MBM A;  3F0F A;  5B8F A;  1KNJ A;  1JY8 A;  3T80 A;  1U43 A;  3ESJ A;  3F0G A;  3K2X A;  1H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...