3ERNA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with aracmp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
b'EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 45
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ernA00
3B6NA 1T0AA 3ERNA 3MBMA 3RE3A 1JN1A 3FPIA 1W57A 5B8FA 1YQNA 3IKFA 2GZLA 1IV1A 1H48A 1H47A 3IKEA 3KE1A 1U3PA 2UZHA 2PMPA 3IEWA 4C8IA 3F0GA 1U40A 3F6MA 3Q8HA 1IV3A 1KNJA 3ESJA 4C82A 3ELCA 3GHZA 4C8GA 1U43A 1W55A 3F0DA 3K14A 3EORA 3T80A 3FBAA 4C81A 2AMTA 3F0EA 1GX1A 1U3LA 1KNKA 3JVHA 3IEQA 1JY8A 3P0ZA 3K2XA 1IV4A 3QHDA 3P10A 1IV2A 1VH8A 1VHAA 4C8EA 3F0FA
chains in the Genus database with same CATH superfamily
3MCQA 3AGKA 1H48A 5LYJA 5LYJB 2HQSC 2CZWA 3LWVC 4C4WC 4LNUA 4LNUB 2ZOVA 3F6MA 4BY9D 1KNJA 4I55A 5HY1A 2ZVYA 5EIBC 1U43A 4X1IA 3K14A 3S0YA 3S03A 4C81A 3WPXA 3KIZA 3L7QA 2ZAUA 3TD4A 1M90H 1W40A 1XRGA 3JARA 3NMUC 1TVKA 1TVKB 5EYPB 3HAXD 4BT6A 1VHAA 1FFXA 2UYJA 3MDOA 4ZK7A 2F9ZC 3S06A 2OTMA 4TUYB 3VMFB 1H47A 1XHOA 3JCMM 4F6RA 4F6RB 3LWQC 1W5AA 3N2KA 3N2KB 4R40B 5KMGA 2AIZP 5CB4B 1VQ9F 5G4UC 3OBYA 1DBFA 4BT3A 5DCVA 2HRYA 4YJ2B 2CVLA 4TZZA 2GVIA 3VYTC 2Z1TA 3BYQA 1W2BF 2NMUA 1VH8A 4IIJB 4DXDA 2ZODA 2UYPA 4BVSA 3VO8A 4TV9A 1XV2A 4TV9B 5BMVB 2UYKA 1VQPF 2ZVZA 3HWUA 3HTNA 5EAZA 2CSLA 3F0GA 3CMAF 3CCEF 1T0KB 3VYUC 5J2UA 5J2UB 1W55A 5AVMA 2VXYA 3JATB 2OZBA 3T80A 3RYFB 3G6EF 1Z5VA 4DRXB 3KJKA 3R0PA 1IV4A 4EB6A 1RQ2A 2Z1EA 2RHOA 2G9IA 2HS4A 1Z5WA 4I4TA 4I4TB 3UT5A 3UT5B 4RQOA 5LP6A 5LP6B 3E22A 1GO0A 3S0WA 2VAMA 1Q86H 3WGNA 1VQKF 5C8YB 4IHJB 4O4JA 5A2QM 3D01A 4X20B 1R1MA 3NVKE 3CCRF 2HVYD 1YHQF 1GO1A 3CMEF 1UI9A 2VGMA 2VAWA 1ODEA 3K2XA 5KX5B 1VQ8F 3FFMA 1IV2A 1TUBA 1ONIA 1FSZA 3MBMA 1VQOF 1SDSA 3C9SA 2ALEA 1CK2A 3I3FA 5JQGB 3RYHB 1U40A 1YIJF 2BTOA 3JAWA 5EZYB 1GZ0A 5EWRA 2HX0A 1YJNF 2IQQA 2RB9A 3IMPA 4BW0B 5HP7A 3RYCA 3RYCB 3CC4F 1VQ7F 4ZOLA 2HP3A 3MCAB 1SA0A 3CB2A 3WGLA 3ERNA 1T0AA 3RE3A 3LWRC 2CW4A 3IKFA 3CCLF 4YJ3A 4YJ3B 5LA6A 3JAKA 3JAKB 1K8AH 3DDNA 2UZHA 2PMPA 4WBNA 4WBNB 1YJ9F 3ESJA 3CCSF 4NWOB 2IAFA 3IR9A 4I55B 1W59A 3N4ZA 3KHNA 1COMA 4X1IB 2QI2A 4EI9A 2R6R1 2RHHA 4B45A 4ZHWA 2OHWA 1Q82H 3JARB 2BO1A 1VQVA 3QTYA 5CA0A 5CA0B 5CA1A 4FFBA 4FFBB 3F0FA 1FFXB 3WJQA 1X52A 4ZI7A 4ZI7B 1Q81H 5IT9M 2FGYA 2CWJA 2HS3A 3M1XA 5G4VC 3E1YA 2R751 3HKCA 3HKCB 5KMGB 2HRUA 4C8GA 1KD1H 2H8EA 4O4HA 4O4HB 5HXZA 3O85A 5MN4A 2ZF8A 1K9MH 3WJRA 3JAMM 3VI6A 2VGNA 3PAFA 1GX1A 2PHNA 1VQNF 3IEQA 1JY8A 3GYQA 3WPWA 4RHAA 3N2GA 4O4LA 4O4LB 3CXCF 3VIUA 2OTLF 2V9YA 1YJWF 3GTZA 3C8LA 1YI2F 2W8BC 2CHSA 1QAHA 2HP0A 2KG4A 4U39A 3VYSC 3ZP7A 1W57A 1S72F 1RQ7A 4O2AA 4O2AB 3ZP4A 3TD3A 2AIFA 5FNVA 4G4WA 3D00A 1QVGF 4LCKA 3Q8HA 1IV3A 4C82A 1RLGA 5LXTA 5LXTB 3CYQA 5JCOC 3F0DA 3WGJA 3HKBA 3OONA 3FBAA 3I7TA 1UFYA 3M4SA 5HY4A 2RHLA 5JH7A 4NQ3A 5GONA 4ERHA 4EB6B 1CLIA 2Q1YA 5IYZA 5IYZB 1VQMF 2GLZA 1KC8H 3C9RA 1Q8RA 3CCUF 3HJWC 3CD6F 3V7EA 5GAPK 3E22B 2WALA 3N4YA 1PXWA 5HY2A 4O4JB 3G4SF 3CCQF 2DYYA 3JVHA 5GINC 3JALA 4X1YA 4X1YB 3VOAA 1VQLF 3MQWA 3P10A 2N48A 1TUBB 5J2TA 2GZLA 2KTVA 5IJ9A 2MQEA 5MN5A 3LYBA 3KE1A 1U3PA 3C9UA 5LOVA 5JVDA 1QU9A 3FD5A 5FJ4C 3RA5A 1W42A 3JAWB 2QEXF 5EO3A 3F0EA 2BTQB 3VTIC 3ON1A 5HY0A 3WJPA 2OTJF 2RHJA 1JFFA 1JFFB 4X3LA 4ZOLB 5HXUA 3OW2F 4X1KA 4X1KB 1SA0B 4C8EA 4G4ZA 4U3JA 3B6NA 1JN1A 1DT9A 3CPQA 5GANK 3IKEA 5LA6B 4B62A 3HKEA 3HKEB 2K1SA 2Q1XA 4B5CA 1RLUA 3ELCA 4O2BA 4O2BB 5EIBD 3RA6A 1J7HA 3DC2A 1PF5A 1X7PA 2FC3A 3K12A 3CCMF 3C9TA 3E20B 1VQ4F 3LMEA 4ZHYB 2L26A 1JJ2F 5CA1B 5EB1B 1YITF 2LBXA 1OFUA 5B8FA 2KTUA 3HKDA 3HKDB 3J81M 5ITZA 5ITZB 3ZOPA 2YYEA 5HWEA 3V7QA 5EB0A 1W581 1Q7YH 2Z1FA 2LCAA 1W5EA 3TD5A 2VAPA 3LFOA 3CPWF 3P0ZA 4O4IA 4O4IB 2HS0A 1X7OA 5EYPA 3N2GB 1NJIH 1M1KH 3SIVA 3JASA 1ZWZA 3JASB 2HP0B 3D54A 4TUYA 1IPAA 3VCZA 4BVRA 3V4DA 3CCJF 1CN7A 2Z1UA 5FNVB 5CB4A 1NQ3A 4M8IA 2QTPA 3WGKA 3GHZA 4BVQA 1E7KA 2EWCA 4YJ2A 2AMTA 3HKBB 2P6YA 2LBWA 1X25A 5LP6C 3J7AR 1KNKA 1XBIA 4HNAA 4HNAB 5JH7B 5GONB 3QHDA 4IIJA 4XCQA 4E6EA 3NK7A 2YXZA 2IG8A 3CC7F 1K73H 5BMVA 3S0HA 4I50A 4I50B 1IV1A 4TV8A 4G4XA 4TV8B 1VK3A 4BVTA 3IEWA 2LBTA 3PLAC 5MN6A 1RA4A 1H7MA 3JATA 4G4VA 4ZHVA 2B33A 3CG6A 3RYFA 3I56F 4DRXA 3SIUA 3KJJA 1U3LA 1W3EX 2JNBA 1JD1A 3JALB 5IJ0A 5IJ0B 3CC2F 3RYIA 3RYIB 2I6RA 5JCOA 3VOBA 4BT5A 2DT4A 4X3MA 3FPIA 3WXMB 4G88A 2H8CA 5J2TB 5IJ9B 5C8YA 3CCVF 4IHJA 3LWPC 3LDTA 4X20A 3LWOC 2QA4F 5LOVB 5JVDB 3NK6A 3I55F 1FNJA 1SZQA 3EORA 4PWTA 3G71F 3K0TA 2KGWA 5KX5A 4EI7A 5GIPC 4ZHQA 4ZHQB 3M84A 4BT7A 2H6LA 2CHTA 2UYNA 2UYNB 3P4EA 2I6DA 2Z01A 4KWEA 1VQ5F 3V3TA 4NUTA 4U3JB 1W5BA 1YQNA 1N8RH 5JQGA 1FNKA 3RYHA 1NMUB 4C8IA 5GIOC 3QUWA 5FLXM 3FD6A 4BT4A 3J80M 1QVFF 5EZYA 1W5FA 1QD9A 4BT2A 1KQSF 3NVIB 4G4YA 3OBWA 3CYPB 5HP8A 2BTUA 1YGYA 3U0OA 4B46A 1W41A 1OAPA 3S02A 3ZO8A 1VQ6F 3WGMA 4EI8A
chains in the Genus database with same CATH topology
3B6NA 1T0AA 3ERNA 3MBMA 3RE3A 1JN1A 3FPIA 1W57A 5B8FA 1YQNA 3IKFA 2GZLA 1IV1A 1H48A 1H47A 3IKEA 3KE1A 1U3PA 2UZHA 2PMPA 3IEWA 4C8IA 3F0GA 1U40A 3F6MA 3Q8HA 1IV3A 1KNJA 3ESJA 4C82A 3ELCA 3GHZA 4C8GA 1U43A 1W55A 3F0DA 3K14A 3EORA 3T80A 3FBAA 4C81A 2AMTA 3F0EA 1GX1A 1U3LA 1KNKA 3JVHA 3IEQA 1JY8A 3P0ZA 3K2XA 1IV4A 3QHDA 3P10A 1IV2A 1VH8A 1VHAA 4C8EA 3F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6N A;  1T0A A;  3ERN A;  3MBM A;  3RE3 A;  1JN1 A;  3FPI A;  1W57 A;  5B8F A;  1YQN A;  3IKF A;  2GZL A;  1IV1 A;  1H48 A;  1H47 A;  3IKE A;  3KE1 A;  1U3P A;  2UZH A;  2PMP A;  3IEW A;  4C8I A;  3F0G A;  1U40 A;  3F6M A;  3Q8H A;  1IV3 A;  1KNJ A;  3ESJ A;  4C82 A;  3ELC A;  3GHZ A;  4C8G A;  1U43 A;  1W55 A;  3F0D A;  3K14 A;  3EOR A;  3T80 A;  3FBA A;  4C81 A;  2AMT A;  3F0E A;  1GX1 A;  1U3L A;  1KNK A;  3JVH A;  3IEQ A;  1JY8 A;  3P0Z A;  3K2X A;  1IV4 A;  3QHD A;  3P10 A;  1IV2 A;  1VH8 A;  1VHA A;  4C8E A;  3F0F A; 
#chains in the Genus database with same CATH topology
 3MCQ A;  3AGK A;  1H48 A;  5LYJ A;  5LYJ B;  2HQS C;  2CZW A;  3LWV C;  4C4W C;  4LNU A;  4LNU B;  2ZOV A;  3F6M A;  4BY9 D;  1KNJ A;  4I55 A;  5HY1 A;  2ZVY A;  5EIB C;  1U43 A;  4X1I A;  3K14 A;  3S0Y A;  3S03 A;  4C81 A;  3WPX A;  3KIZ A;  3L7Q A;  2ZAU A;  3TD4 A;  1M90 H;  1W40 A;  1XRG A;  3JAR A;  3NMU C;  1TVK A;  1TVK B;  5EYP B;  3HAX D;  4BT6 A;  1VHA A;  1FFX A;  2UYJ A;  3MDO A;  4ZK7 A;  2F9Z C;  3S06 A;  2OTM A;  4TUY B;  3VMF B;  1H47 A;  1XHO A;  3JCM M;  4F6R A;  4F6R B;  3LWQ C;  1W5A A;  3N2K A;  3N2K B;  4R40 B;  5KMG A;  2AIZ P;  5CB4 B;  1VQ9 F;  5G4U C;  3OBY A;  1DBF A;  4BT3 A;  5DCV A;  2HRY A;  4YJ2 B;  2CVL A;  4TZZ A;  2GVI A;  3VYT C;  2Z1T A;  3BYQ A;  1W2B F;  2NMU A;  1VH8 A;  4IIJ B;  4DXD A;  2ZOD A;  2UYP A;  4BVS A;  3VO8 A;  4TV9 A;  1XV2 A;  4TV9 B;  5BMV B;  2UYK A;  1VQP F;  2ZVZ A;  3HWU A;  3HTN A;  5EAZ A;  2CSL A;  3F0G A;  3CMA F;  3CCE F;  1T0K B;  3VYU C;  5J2U A;  5J2U B;  1W55 A;  5AVM A;  2VXY A;  3JAT B;  2OZB A;  3T80 A;  3RYF B;  3G6E F;  1Z5V A;  4DRX B;  3KJK A;  3R0P A;  1IV4 A;  4EB6 A;  1RQ2 A;  2Z1E A;  2RHO A;  2G9I A;  2HS4 A;  1Z5W A;  4I4T A;  4I4T B;  3UT5 A;  3UT5 B;  4RQO A;  5LP6 A;  5LP6 B;  3E22 A;  1GO0 A;  3S0W A;  2VAM A;  1Q86 H;  3WGN A;  1VQK F;  5C8Y B;  4IHJ B;  4O4J A;  5A2Q M;  3D01 A;  4X20 B;  1R1M A;  3NVK E;  3CCR F;  2HVY D;  1YHQ F;  1GO1 A;  3CME F;  1UI9 A;  2VGM A;  2VAW A;  1ODE A;  3K2X A;  5KX5 B;  1VQ8 F;  3FFM A;  1IV2 A;  1TUB A;  1ONI A;  1FSZ A;  3MBM A;  1VQO F;  1SDS A;  3C9S A;  2ALE A;  1CK2 A;  3I3F A;  5JQG B;  3RYH B;  1U40 A;  1YIJ F;  2BTO A;  3JAW A;  5EZY B;  1GZ0 A;  5EWR A;  2HX0 A;  1YJN F;  2IQQ A;  2RB9 A;  3IMP A;  4BW0 B;  5HP7 A;  3RYC A;  3RYC B;  3CC4 F;  1VQ7 F;  4ZOL A;  2HP3 A;  3MCA B;  1SA0 A;  3CB2 A;  3WGL A;  3ERN A;  1T0A A;  3RE3 A;  3LWR C;  2CW4 A;  3IKF A;  3CCL F;  4YJ3 A;  4YJ3 B;  5LA6 A;  3JAK A;  3JAK B;  1K8A H;  3DDN A;  2UZH A;  2PMP A;  4WBN A;  4WBN B;  1YJ9 F;  3ESJ A;  3CCS F;  4NWO B;  2IAF A;  3IR9 A;  4I55 B;  1W59 A;  3N4Z A;  3KHN A;  1COM A;  4X1I B;  2QI2 A;  4EI9 A;  2R6R 1;  2RHH A;  4B45 A;  4ZHW A;  2OHW A;  1Q82 H;  3JAR B;  2BO1 A;  1VQV A;  3QTY A;  5CA0 A;  5CA0 B;  5CA1 A;  4FFB A;  4FFB B;  3F0F A;  1FFX B;  3WJQ A;  1X52 A;  4ZI7 A;  4ZI7 B;  1Q81 H;  5IT9 M;  2FGY A;  2CWJ A;  2HS3 A;  3M1X A;  5G4V C;  3E1Y A;  2R75 1;  3HKC A;  3HKC B;  5KMG B;  2HRU A;  4C8G A;  1KD1 H;  2H8E A;  4O4H A;  4O4H B;  5HXZ A;  3O85 A;  5MN4 A;  2ZF8 A;  1K9M H;  3WJR A;  3JAM M;  3VI6 A;  2VGN A;  3PAF A;  1GX1 A;  2PHN A;  1VQN F;  3IEQ A;  1JY8 A;  3GYQ A;  3WPW A;  4RHA A;  3N2G A;  4O4L A;  4O4L B;  3CXC F;  3VIU A;  2OTL F;  2V9Y A;  1YJW F;  3GTZ A;  3C8L A;  1YI2 F;  2W8B C;  2CHS A;  1QAH A;  2HP0 A;  2KG4 A;  4U39 A;  3VYS C;  3ZP7 A;  1W57 A;  1S72 F;  1RQ7 A;  4O2A A;  4O2A B;  3ZP4 A;  3TD3 A;  2AIF A;  5FNV A;  4G4W A;  3D00 A;  1QVG F;  4LCK A;  3Q8H A;  1IV3 A;  4C82 A;  1RLG A;  5LXT A;  5LXT B;  3CYQ A;  5JCO C;  3F0D A;  3WGJ A;  3HKB A;  3OON A;  3FBA A;  3I7T A;  1UFY A;  3M4S A;  5HY4 A;  2RHL A;  5JH7 A;  4NQ3 A;  5GON A;  4ERH A;  4EB6 B;  1CLI A;  2Q1Y A;  5IYZ A;  5IYZ B;  1VQM F;  2GLZ A;  1KC8 H;  3C9R A;  1Q8R A;  3CCU F;  3HJW C;  3CD6 F;  3V7E A;  5GAP K;  3E22 B;  2WAL A;  3N4Y A;  1PXW A;  5HY2 A;  4O4J B;  3G4S F;  3CCQ F;  2DYY A;  3JVH A;  5GIN C;  3JAL A;  4X1Y A;  4X1Y B;  3VOA A;  1VQL F;  3MQW A;  3P10 A;  2N48 A;  1TUB B;  5J2T A;  2GZL A;  2KTV A;  5IJ9 A;  2MQE A;  5MN5 A;  3LYB A;  3KE1 A;  1U3P A;  3C9U A;  5LOV A;  5JVD A;  1QU9 A;  3FD5 A;  5FJ4 C;  3RA5 A;  1W42 A;  3JAW B;  2QEX F;  5EO3 A;  3F0E A;  2BTQ B;  3VTI C;  3ON1 A;  5HY0 A;  3WJP A;  2OTJ F;  2RHJ A;  1JFF A;  1JFF B;  4X3L A;  4ZOL B;  5HXU A;  3OW2 F;  4X1K A;  4X1K B;  1SA0 B;  4C8E A;  4G4Z A;  4U3J A;  3B6N A;  1JN1 A;  1DT9 A;  3CPQ A;  5GAN K;  3IKE A;  5LA6 B;  4B62 A;  3HKE A;  3HKE B;  2K1S A;  2Q1X A;  4B5C A;  1RLU A;  3ELC A;  4O2B A;  4O2B B;  5EIB D;  3RA6 A;  1J7H A;  3DC2 A;  1PF5 A;  1X7P A;  2FC3 A;  3K12 A;  3CCM F;  3C9T A;  3E20 B;  1VQ4 F;  3LME A;  4ZHY B;  2L26 A;  1JJ2 F;  5CA1 B;  5EB1 B;  1YIT F;  2LBX A;  1OFU A;  5B8F A;  2KTU A;  3HKD A;  3HKD B;  3J81 M;  5ITZ A;  5ITZ B;  3ZOP A;  2YYE A;  5HWE A;  3V7Q A;  5EB0 A;  1W58 1;  1Q7Y H;  2Z1F A;  2LCA A;  1W5E A;  3TD5 A;  2VAP A;  3LFO A;  3CPW F;  3P0Z A;  4O4I A;  4O4I B;  2HS0 A;  1X7O A;  5EYP A;  3N2G B;  1NJI H;  1M1K H;  3SIV A;  3JAS A;  1ZWZ A;  3JAS B;  2HP0 B;  3D54 A;  4TUY A;  1IPA A;  3VCZ A;  4BVR A;  3V4D A;  3CCJ F;  1CN7 A;  2Z1U A;  5FNV B;  5CB4 A;  1NQ3 A;  4M8I A;  2QTP A;  3WGK A;  3GHZ A;  4BVQ A;  1E7K A;  2EWC A;  4YJ2 A;  2AMT A;  3HKB B;  2P6Y A;  2LBW A;  1X25 A;  5LP6 C;  3J7A R;  1KNK A;  1XBI A;  4HNA A;  4HNA B;  5JH7 B;  5GON B;  3QHD A;  4IIJ A;  4XCQ A;  4E6E A;  3NK7 A;  2YXZ A;  2IG8 A;  3CC7 F;  1K73 H;  5BMV A;  3S0H A;  4I50 A;  4I50 B;  1IV1 A;  4TV8 A;  4G4X A;  4TV8 B;  1VK3 A;  4BVT A;  3IEW A;  2LBT A;  3PLA C;  5MN6 A;  1RA4 A;  1H7M A;  3JAT A;  4G4V A;  4ZHV A;  2B33 A;  3CG6 A;  3RYF A;  3I56 F;  4DRX A;  3SIU A;  3KJJ A;  1U3L A;  1W3E X;  2JNB A;  1JD1 A;  3JAL B;  5IJ0 A;  5IJ0 B;  3CC2 F;  3RYI A;  3RYI B;  2I6R A;  5JCO A;  3VOB A;  4BT5 A;  2DT4 A;  4X3M A;  3FPI A;  3WXM B;  4G88 A;  2H8C A;  5J2T B;  5IJ9 B;  5C8Y A;  3CCV F;  4IHJ A;  3LWP C;  3LDT A;  4X20 A;  3LWO C;  2QA4 F;  5LOV B;  5JVD B;  3NK6 A;  3I55 F;  1FNJ A;  1SZQ A;  3EOR A;  4PWT A;  3G71 F;  3K0T A;  2KGW A;  5KX5 A;  4EI7 A;  5GIP C;  4ZHQ A;  4ZHQ B;  3M84 A;  4BT7 A;  2H6L A;  2CHT A;  2UYN A;  2UYN B;  3P4E A;  2I6D A;  2Z01 A;  4KWE A;  1VQ5 F;  3V3T A;  4NUT A;  4U3J B;  1W5B A;  1YQN A;  1N8R H;  5JQG A;  1FNK A;  3RYH A;  1NMU B;  4C8I A;  5GIO C;  3QUW A;  5FLX M;  3FD6 A;  4BT4 A;  3J80 M;  1QVF F;  5EZY A;  1W5F A;  1QD9 A;  4BT2 A;  1KQS F;  3NVI B;  4G4Y A;  3OBW A;  3CYP B;  5HP8 A;  2BTU A;  1YGY A;  3U0O A;  4B46 A;  1W41 A;  1OAP A;  3S02 A;  3ZO8 A;  1VQ6 F;  3WGM A;  4EI8 A; 
#chains in the Genus database with same CATH homology
 3B6N A;  1T0A A;  3ERN A;  3MBM A;  3RE3 A;  1JN1 A;  3FPI A;  1W57 A;  5B8F A;  1YQN A;  3IKF A;  2GZL A;  1IV1 A;  1H48 A;  1H47 A;  3IKE A;  3KE1 A;  1U3P A;  2UZH A;  2PMP A;  3IEW A;  4C8I A;  3F0G A;  1U40 A;  3F6M A;  3Q8H A;  1IV3 A;  1KNJ A;  3ESJ A;  4C82 A;  3ELC A;  3GHZ A;  4C8G A;  1U43 A;  1W55 A;  3F0D A;  3K14 A;  3EOR A;  3T80 A;  3FBA A;  4C81 A;  2AMT A;  3F0E A;  1GX1 A;  1U3L A;  1KNK A;  3JVH A;  3IEQ A;  1JY8 A;  3P0Z A;  3K2X A;  1IV4 A;  3QHD A;  3P10 A;  1IV2 A;  1VH8 A;  1VHA A;  4C8E A;  3F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...