3ERNA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with aracmp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
total genus 45
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ernA00
1IV4A 1U43A 1VHAA 1YQNA 3IKFA 3B6NA 3ESJA 3JVHA 1U40A 3ERNA 3K2XA 4C8IA 5B8FA 3QHDA 1U3LA 3Q8HA 3IKEA 1JY8A 3ELCA 3P0ZA 1IV1A 1GX1A 4C8GA 3F0GA 3P10A 2PMPA 4C82A 4C8EA 3RE3A 3KE1A 4C81A 3F0EA 3MBMA 2AMTA 3IEQA 1VH8A 1H48A 1H47A 1KNJA 1IV3A 3FPIA 3GHZA 2GZLA 1T0AA 1W55A 3F6MA 1KNKA 1IV2A 3K14A 3FBAA 3F0DA 3T80A 2UZHA 3EORA 1W57A 1JN1A 3F0FA 1U3PA 3IEWA
chains in the Genus database with same CATH superfamily
3JARA 1VQ4F 3LWRC 1JFFB 3B6NA 3I3FA 3WPWA 5GINC 3CXCF 3P4EA 2IQQA 4WBNA 3FD5A 4KWEA 3LYBA 5EB0A 4LCKA 5LXTA 3C8LA 3CPWF 1GX1A 2KTUA 4NUTA 1W59A 3JAKA 4IHJA 3RYCA 3M1XA 1N8RH 3MBMA 4EI8A 3KJKA 3BYQA 4X1YA 3E22A 2ZAUA 1VQVA 3S0WA 4EB6A 1VQ5F 3SIUA 3OW2F 5FJ4C 5MN4A 4BT7A 1XV2A 2F9ZC 4B62A 3F6MA 1FFXB 2LBXA 3ZP7A 1CK2A 3J7AR 2LBTA 2KTVA 5IJ9A 3HKCB 1YHQF 2IAFA 3RYHA 3JVHA 3VTIC 1U40A 4BT4A 2CSLA 1K8AH 2L26A 4O4HB 5IJ0A 3RYFA 3PAFA 4O4LA 4X1KB 2RHLA 4PWTA 2PHNA 3V7QA 4X3MA 3IEQA 1JFFA 3FPIA 5IYZA 4X20A 2RHOA 3FFMA 3VO8A 2P6YA 2RHHA 1NQ3A 3F0DA 3R0PA 5LP6B 5LYJB 3CPQA 4O4JB 2R751 3ESJA 5B8FA 3ERNA 1U3LA 5CA1A 3KHNA 5JVDB 2VGNA 3N2KA 3MCAB 3S06A 3P0ZA 4C8GA 5HY1A 2CHSA 4NWOB 1VK3A 3WGKA 3CD6F 1FFXA 3CG6A 4B46A 3E1YA 3HKCA 4TUYB 1GO0A 2VAMA 4FFBA 1RQ7A 3WGJA 1T0AA 2CHTA 5IT9M 3T80A 3WGMA 3JATA 1U43A 4ZHVA 4YJ2A 2DT4A 2K1SA 3E20B 1PF5A 1JY8A 3CC7F 5EYPA 3NMUC 2AIFA 4C8EA 2QI2A 2UYJA 3JARB 3CCUF 3FD6A 1YJ9F 5LYJA 3F0EA 4O4JA 4BT2A 5HXZA 1GZ0A 1RLGA 4WBNB 1YJWF 1H48A 5LXTB 2HQSC 1W5FA 3TD4A 3K14A 2QA4F 1ONIA 3JAKB 4I50A 3EORA 4IHJB 3G6EF 1Z5WA 5MN5A 2HP3A 1M90H 3IKFA 3HKDB 1RA4A 3K2XA 4X1YB 3WPXA 2KGWA 3M4SA 1TUBB 2EWCA 3S0HA 1YJNF 3QUWA 4U3JA 4EB6B 2ZODA 3ELCA 3P10A 4BVTA 4C82A 3V4DA 4BT5A 3S0YA 5IJ9B 5CA0A 3RYHB 5HY0A 5JCOC 3HKEA 3NVKE 2AIZP 5IJ0B 4B5CA 3RYFB 1S72F 4O4LB 3CCVF 3KE1A 1W3EX 2CWJA 1VQPF 3CYQA 2UYNA 5IYZB 4X20B 3QTYA 3CYPB 3CCQF 4EI9A 1Q7YH 1M1KH 4XCQA 1ZWZA 1FNJA 2H6LA 4G4WA 5C8YA 2Q1YA 5JH7B 1XBIA 3M84A 3NK6A 2OTLF 5CA1B 1H47A 3HKDA 3N2KB 3I56F 1TUBA 3DC2A 1ODEA 1QVGF 3FBAA 1VQKF 5BMVA 3CCMF 2W8BC 5HY2A 4HNAA 4C4WC 3VI6A 2LCAA 4FFBB 3N2GA 4G88A 1W40A 4TV8B 3HAXD 3F0GA 4ZHYB 3VOAA 3OBYA 3C9UA 3JATB 2G9IA 4YJ2B 3GYQA 3TD3A 3PLAC 2HX0A 3S02A 4O4IA 4F6RA 5EYPB 5EZYA 1QAHA 3VCZA 2H8CA 1VQNF 3AGKA 1CN7A 4BT6A 1VQOF 4LNUA 5JH7A 5GAPK 2IG8A 4BW0B 1YIJF 1VQ9F 4ZI7A 4I50B 1W42A 2HP0A 3RA6A 4TV9B 4U39A 2Z1FA 1PXWA 3WJQA 2QEXF 2Z1TA 2VAPA 5DCVA 3LMEA 4U3JB 3U0OA 3VOBA 5LOVA 3HTNA 2RHJA 1UI9A 3VYTC 2CW4A 4TV8A 3C9TA 3C9SA 5EB1B 5LA6B 2HRYA 5LP6C 5CA0B 3V7EA 5EIBD 3HKEB 3JAWA 3JCMM 2ZVZA 1XRGA 1COMA 3OONA 3HWUA 3MQWA 5CB4A 2B33A 3DDNA 4IIJB 5KX5A 3D00A 2ZF8A 2VGMA 5HP8A 3CC2F 2UYNB 5A2QM 1DBFA 1K73H 5JQGA 1KNKA 1IV2A 1X7PA 5EO3A 3I7TA 5C8YB 1Q86H 3VYSC 1KC8H 3TD5A 5FLXM 1JN1A 4ZHQA 1IV4A 4BY9D 2ZVYA 1QU9A 3JASA 4TV9A 4DRXA 2UYPA 4YJ3A 3CMAF 5GONA 2NMUA 4R40B 3RA5A 5BMVB 3WXMB 1UFYA 1VQ8F 4HNAB 5LA6A 3GTZA 2BO1A 1QVFF 3N2GB 3CCSF 1SA0A 1FNKA 1NJIH 2GLZA 1W57A 2HRUA 1U3PA 4ZOLA 2ZOVA 4IIJA 2HVYD 1Q82H 3MCQA 2Z01A 5GIPC 4O4IB 4F6RB 3I55F 3Q8HA 4ZK7A 2H8EA 5EZYB 2WALA 2BTQB 3LWVC 1TVKA 1R1MA 1OAPA 4LNUB 3WJRA 4O2BA 3J81M 4RHAA 2FC3A 2Z1EA 4G4ZA 5ITZA 3GHZA 3RYIB 5FNVA 1GO1A 4ZI7B 3LWQC 2HP0B 3OBWA 1SZQA 5JCOA 3K0TA 3CCEF 3VIUA 4C8IA 2OTJF 5LOVB 3IR9A 4BT3A 2R6R1 1YITF 4X1IA 4ERHA 3LFOA 4I4TB 3WGNA 3CCJF 2OZBA 4BVSA 5J2UA 1KD1H 3IMPA 1W581 1W41A 1W2BF 3JAWB 3UT5A 2UYKA 4B45A 1FSZA 5J2TA 1VQLF 2HS3A 1T0KB 4I55A 5EWRA 2N48A 3N4ZA 5CB4B 2KG4A 5HWEA 2RB9A 5KX5B 3O85A 2Q1XA 3D54A 1VQ7F 4E6EA 3ZOPA 3CCLF 1RLUA 3JAMM 2LBWA 5G4UC 3G71F 3VMFB 5KMGA 1W5EA 2V9YA 1Q81H 2HS4A 4DXDA 3JALA 5JQGB 4O2AB 2DYYA 1XHOA 5GIOC 1JJ2F 3RYIA 3K12A 4ZHQB 5AVMA 1JD1A 1VQ6F 4DRXB 3JASB 1X25A 4G4VA 4BVQA 4YJ3B 1VH8A 5GONB 3V3TA 2VAWA 1Z5VA 2Z1UA 1X7OA 4I4TA 4M8IA 5HXUA 1E7KA 3CMEF 3C9RA 1YQNA 2HS0A 5MN6A 1W5AA 2BTOA 4G4YA 4ZHWA 1Q8RA 3ON1A 1J7HA 1SA0B 2MQEA 1CLIA 3KIZA 3CCRF 3D01A 4BVRA 1IV1A 2OTMA 3CB2A 4ZOLB 2QTPA 3RE3A 3J80M 1H7MA 1VQMF 3LWPC 5G4VC 2CZWA 3HKBB 3NVIB 1W55A 4O4HA 1RQ2A 4O2AA 1IPAA 1TVKB 3G4SF 3MDOA 4X1KA 4O2BB 1VHAA 1KQSF 5HP7A 5ITZB 1YI2F 3ZO8A 5FNVB 1W5BA 2JNBA 1K9MH 4NQ3A 4X3LA 4TZZA 1YGYA 5EIBC 4G4XA 1NMUB 2FGYA 2PMPA 3KJJA 5LP6A 3N4YA 4C81A 3WGLA 3WJPA 2GVIA 4X1IB 1IV3A 1KNJA 2I6DA 1OFUA 2GZLA 5J2UB 5JVDA 3RYCB 3CC4F 1X52A 2UZHA 2OHWA 1SDSA 2I6RA 3F0FA 3IKEA 3IEWA 3UT5B 3VYUC 5HY4A 5J2TB 3E22B 3QHDA 4EI7A 3HJWC 4I55B 4TUYA 3NK7A 2CVLA 2VXYA 4RQOA 3HKBA 2YYEA 5EAZA 3L7QA 3SIVA 3ZP4A 5KMGB 1QD9A 2AMTA 5GANK 3JALB 3LWOC 1DT9A 3S03A 2ALEA 3LDTA 2BTUA 2YXZA
chains in the Genus database with same CATH topology
1IV4A 1U43A 1VHAA 1YQNA 3IKFA 3B6NA 3ESJA 3JVHA 1U40A 3ERNA 3K2XA 4C8IA 5B8FA 3QHDA 1U3LA 3Q8HA 3IKEA 1JY8A 3ELCA 3P0ZA 1IV1A 1GX1A 4C8GA 3F0GA 3P10A 2PMPA 4C82A 4C8EA 3RE3A 3KE1A 4C81A 3F0EA 3MBMA 2AMTA 3IEQA 1VH8A 1H48A 1H47A 1KNJA 1IV3A 3FPIA 3GHZA 2GZLA 1T0AA 1W55A 3F6MA 1KNKA 1IV2A 3K14A 3FBAA 3F0DA 3T80A 2UZHA 3EORA 1W57A 1JN1A 3F0FA 1U3PA 3IEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV4 A;  1U43 A;  1VHA A;  1YQN A;  3IKF A;  3B6N A;  3ESJ A;  3JVH A;  1U40 A;  3ERN A;  3K2X A;  4C8I A;  5B8F A;  3QHD A;  1U3L A;  3Q8H A;  3IKE A;  1JY8 A;  3ELC A;  3P0Z A;  1IV1 A;  1GX1 A;  4C8G A;  3F0G A;  3P10 A;  2PMP A;  4C82 A;  4C8E A;  3RE3 A;  3KE1 A;  4C81 A;  3F0E A;  3MBM A;  2AMT A;  3IEQ A;  1VH8 A;  1H48 A;  1H47 A;  1KNJ A;  1IV3 A;  3FPI A;  3GHZ A;  2GZL A;  1T0A A;  1W55 A;  3F6M A;  1KNK A;  1IV2 A;  3K14 A;  3FBA A;  3F0D A;  3T80 A;  2UZH A;  3EOR A;  1W57 A;  1JN1 A;  3F0F A;  1U3P A;  3IEW A; 
#chains in the Genus database with same CATH topology
 3JAR A;  1VQ4 F;  3LWR C;  1JFF B;  3B6N A;  3I3F A;  3WPW A;  5GIN C;  3CXC F;  3P4E A;  2IQQ A;  4WBN A;  3FD5 A;  4KWE A;  3LYB A;  5EB0 A;  4LCK A;  5LXT A;  3C8L A;  3CPW F;  1GX1 A;  2KTU A;  4NUT A;  1W59 A;  3JAK A;  4IHJ A;  3RYC A;  3M1X A;  1N8R H;  3MBM A;  4EI8 A;  3KJK A;  3BYQ A;  4X1Y A;  3E22 A;  2ZAU A;  1VQV A;  3S0W A;  4EB6 A;  1VQ5 F;  3SIU A;  3OW2 F;  5FJ4 C;  5MN4 A;  4BT7 A;  1XV2 A;  2F9Z C;  4B62 A;  3F6M A;  1FFX B;  2LBX A;  3ZP7 A;  1CK2 A;  3J7A R;  2LBT A;  2KTV A;  5IJ9 A;  3HKC B;  1YHQ F;  2IAF A;  3RYH A;  3JVH A;  3VTI C;  1U40 A;  4BT4 A;  2CSL A;  1K8A H;  2L26 A;  4O4H B;  5IJ0 A;  3RYF A;  3PAF A;  4O4L A;  4X1K B;  2RHL A;  4PWT A;  2PHN A;  3V7Q A;  4X3M A;  3IEQ A;  1JFF A;  3FPI A;  5IYZ A;  4X20 A;  2RHO A;  3FFM A;  3VO8 A;  2P6Y A;  2RHH A;  1NQ3 A;  3F0D A;  3R0P A;  5LP6 B;  5LYJ B;  3CPQ A;  4O4J B;  2R75 1;  3ESJ A;  5B8F A;  3ERN A;  1U3L A;  5CA1 A;  3KHN A;  5JVD B;  2VGN A;  3N2K A;  3MCA B;  3S06 A;  3P0Z A;  4C8G A;  5HY1 A;  2CHS A;  4NWO B;  1VK3 A;  3WGK A;  3CD6 F;  1FFX A;  3CG6 A;  4B46 A;  3E1Y A;  3HKC A;  4TUY B;  1GO0 A;  2VAM A;  4FFB A;  1RQ7 A;  3WGJ A;  1T0A A;  2CHT A;  5IT9 M;  3T80 A;  3WGM A;  3JAT A;  1U43 A;  4ZHV A;  4YJ2 A;  2DT4 A;  2K1S A;  3E20 B;  1PF5 A;  1JY8 A;  3CC7 F;  5EYP A;  3NMU C;  2AIF A;  4C8E A;  2QI2 A;  2UYJ A;  3JAR B;  3CCU F;  3FD6 A;  1YJ9 F;  5LYJ A;  3F0E A;  4O4J A;  4BT2 A;  5HXZ A;  1GZ0 A;  1RLG A;  4WBN B;  1YJW F;  1H48 A;  5LXT B;  2HQS C;  1W5F A;  3TD4 A;  3K14 A;  2QA4 F;  1ONI A;  3JAK B;  4I50 A;  3EOR A;  4IHJ B;  3G6E F;  1Z5W A;  5MN5 A;  2HP3 A;  1M90 H;  3IKF A;  3HKD B;  1RA4 A;  3K2X A;  4X1Y B;  3WPX A;  2KGW A;  3M4S A;  1TUB B;  2EWC A;  3S0H A;  1YJN F;  3QUW A;  4U3J A;  4EB6 B;  2ZOD A;  3ELC A;  3P10 A;  4BVT A;  4C82 A;  3V4D A;  4BT5 A;  3S0Y A;  5IJ9 B;  5CA0 A;  3RYH B;  5HY0 A;  5JCO C;  3HKE A;  3NVK E;  2AIZ P;  5IJ0 B;  4B5C A;  3RYF B;  1S72 F;  4O4L B;  3CCV F;  3KE1 A;  1W3E X;  2CWJ A;  1VQP F;  3CYQ A;  2UYN A;  5IYZ B;  4X20 B;  3QTY A;  3CYP B;  3CCQ F;  4EI9 A;  1Q7Y H;  1M1K H;  4XCQ A;  1ZWZ A;  1FNJ A;  2H6L A;  4G4W A;  5C8Y A;  2Q1Y A;  5JH7 B;  1XBI A;  3M84 A;  3NK6 A;  2OTL F;  5CA1 B;  1H47 A;  3HKD A;  3N2K B;  3I56 F;  1TUB A;  3DC2 A;  1ODE A;  1QVG F;  3FBA A;  1VQK F;  5BMV A;  3CCM F;  2W8B C;  5HY2 A;  4HNA A;  4C4W C;  3VI6 A;  2LCA A;  4FFB B;  3N2G A;  4G88 A;  1W40 A;  4TV8 B;  3HAX D;  3F0G A;  4ZHY B;  3VOA A;  3OBY A;  3C9U A;  3JAT B;  2G9I A;  4YJ2 B;  3GYQ A;  3TD3 A;  3PLA C;  2HX0 A;  3S02 A;  4O4I A;  4F6R A;  5EYP B;  5EZY A;  1QAH A;  3VCZ A;  2H8C A;  1VQN F;  3AGK A;  1CN7 A;  4BT6 A;  1VQO F;  4LNU A;  5JH7 A;  5GAP K;  2IG8 A;  4BW0 B;  1YIJ F;  1VQ9 F;  4ZI7 A;  4I50 B;  1W42 A;  2HP0 A;  3RA6 A;  4TV9 B;  4U39 A;  2Z1F A;  1PXW A;  3WJQ A;  2QEX F;  2Z1T A;  2VAP A;  5DCV A;  3LME A;  4U3J B;  3U0O A;  3VOB A;  5LOV A;  3HTN A;  2RHJ A;  1UI9 A;  3VYT C;  2CW4 A;  4TV8 A;  3C9T A;  3C9S A;  5EB1 B;  5LA6 B;  2HRY A;  5LP6 C;  5CA0 B;  3V7E A;  5EIB D;  3HKE B;  3JAW A;  3JCM M;  2ZVZ A;  1XRG A;  1COM A;  3OON A;  3HWU A;  3MQW A;  5CB4 A;  2B33 A;  3DDN A;  4IIJ B;  5KX5 A;  3D00 A;  2ZF8 A;  2VGM A;  5HP8 A;  3CC2 F;  2UYN B;  5A2Q M;  1DBF A;  1K73 H;  5JQG A;  1KNK A;  1IV2 A;  1X7P A;  5EO3 A;  3I7T A;  5C8Y B;  1Q86 H;  3VYS C;  1KC8 H;  3TD5 A;  5FLX M;  1JN1 A;  4ZHQ A;  1IV4 A;  4BY9 D;  2ZVY A;  1QU9 A;  3JAS A;  4TV9 A;  4DRX A;  2UYP A;  4YJ3 A;  3CMA F;  5GON A;  2NMU A;  4R40 B;  3RA5 A;  5BMV B;  3WXM B;  1UFY A;  1VQ8 F;  4HNA B;  5LA6 A;  3GTZ A;  2BO1 A;  1QVF F;  3N2G B;  3CCS F;  1SA0 A;  1FNK A;  1NJI H;  2GLZ A;  1W57 A;  2HRU A;  1U3P A;  4ZOL A;  2ZOV A;  4IIJ A;  2HVY D;  1Q82 H;  3MCQ A;  2Z01 A;  5GIP C;  4O4I B;  4F6R B;  3I55 F;  3Q8H A;  4ZK7 A;  2H8E A;  5EZY B;  2WAL A;  2BTQ B;  3LWV C;  1TVK A;  1R1M A;  1OAP A;  4LNU B;  3WJR A;  4O2B A;  3J81 M;  4RHA A;  2FC3 A;  2Z1E A;  4G4Z A;  5ITZ A;  3GHZ A;  3RYI B;  5FNV A;  1GO1 A;  4ZI7 B;  3LWQ C;  2HP0 B;  3OBW A;  1SZQ A;  5JCO A;  3K0T A;  3CCE F;  3VIU A;  4C8I A;  2OTJ F;  5LOV B;  3IR9 A;  4BT3 A;  2R6R 1;  1YIT F;  4X1I A;  4ERH A;  3LFO A;  4I4T B;  3WGN A;  3CCJ F;  2OZB A;  4BVS A;  5J2U A;  1KD1 H;  3IMP A;  1W58 1;  1W41 A;  1W2B F;  3JAW B;  3UT5 A;  2UYK A;  4B45 A;  1FSZ A;  5J2T A;  1VQL F;  2HS3 A;  1T0K B;  4I55 A;  5EWR A;  2N48 A;  3N4Z A;  5CB4 B;  2KG4 A;  5HWE A;  2RB9 A;  5KX5 B;  3O85 A;  2Q1X A;  3D54 A;  1VQ7 F;  4E6E A;  3ZOP A;  3CCL F;  1RLU A;  3JAM M;  2LBW A;  5G4U C;  3G71 F;  3VMF B;  5KMG A;  1W5E A;  2V9Y A;  1Q81 H;  2HS4 A;  4DXD A;  3JAL A;  5JQG B;  4O2A B;  2DYY A;  1XHO A;  5GIO C;  1JJ2 F;  3RYI A;  3K12 A;  4ZHQ B;  5AVM A;  1JD1 A;  1VQ6 F;  4DRX B;  3JAS B;  1X25 A;  4G4V A;  4BVQ A;  4YJ3 B;  1VH8 A;  5GON B;  3V3T A;  2VAW A;  1Z5V A;  2Z1U A;  1X7O A;  4I4T A;  4M8I A;  5HXU A;  1E7K A;  3CME F;  3C9R A;  1YQN A;  2HS0 A;  5MN6 A;  1W5A A;  2BTO A;  4G4Y A;  4ZHW A;  1Q8R A;  3ON1 A;  1J7H A;  1SA0 B;  2MQE A;  1CLI A;  3KIZ A;  3CCR F;  3D01 A;  4BVR A;  1IV1 A;  2OTM A;  3CB2 A;  4ZOL B;  2QTP A;  3RE3 A;  3J80 M;  1H7M A;  1VQM F;  3LWP C;  5G4V C;  2CZW A;  3HKB B;  3NVI B;  1W55 A;  4O4H A;  1RQ2 A;  4O2A A;  1IPA A;  1TVK B;  3G4S F;  3MDO A;  4X1K A;  4O2B B;  1VHA A;  1KQS F;  5HP7 A;  5ITZ B;  1YI2 F;  3ZO8 A;  5FNV B;  1W5B A;  2JNB A;  1K9M H;  4NQ3 A;  4X3L A;  4TZZ A;  1YGY A;  5EIB C;  4G4X A;  1NMU B;  2FGY A;  2PMP A;  3KJJ A;  5LP6 A;  3N4Y A;  4C81 A;  3WGL A;  3WJP A;  2GVI A;  4X1I B;  1IV3 A;  1KNJ A;  2I6D A;  1OFU A;  2GZL A;  5J2U B;  5JVD A;  3RYC B;  3CC4 F;  1X52 A;  2UZH A;  2OHW A;  1SDS A;  2I6R A;  3F0F A;  3IKE A;  3IEW A;  3UT5 B;  3VYU C;  5HY4 A;  5J2T B;  3E22 B;  3QHD A;  4EI7 A;  3HJW C;  4I55 B;  4TUY A;  3NK7 A;  2CVL A;  2VXY A;  4RQO A;  3HKB A;  2YYE A;  5EAZ A;  3L7Q A;  3SIV A;  3ZP4 A;  5KMG B;  1QD9 A;  2AMT A;  5GAN K;  3JAL B;  3LWO C;  1DT9 A;  3S03 A;  2ALE A;  3LDT A;  2BTU A;  2YXZ A; 
#chains in the Genus database with same CATH homology
 1IV4 A;  1U43 A;  1VHA A;  1YQN A;  3IKF A;  3B6N A;  3ESJ A;  3JVH A;  1U40 A;  3ERN A;  3K2X A;  4C8I A;  5B8F A;  3QHD A;  1U3L A;  3Q8H A;  3IKE A;  1JY8 A;  3ELC A;  3P0Z A;  1IV1 A;  1GX1 A;  4C8G A;  3F0G A;  3P10 A;  2PMP A;  4C82 A;  4C8E A;  3RE3 A;  3KE1 A;  4C81 A;  3F0E A;  3MBM A;  2AMT A;  3IEQ A;  1VH8 A;  1H48 A;  1H47 A;  1KNJ A;  1IV3 A;  3FPI A;  3GHZ A;  2GZL A;  1T0A A;  1W55 A;  3F6M A;  1KNK A;  1IV2 A;  3K14 A;  3FBA A;  3F0D A;  3T80 A;  2UZH A;  3EOR A;  1W57 A;  1JN1 A;  3F0F A;  1U3P A;  3IEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...