3ERNA

Crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase complexed with aracmp
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
157
structure length
157
Chain Sequence
EMRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structure-based approach to ligand discovery for 2C-methyl-D-erythritol-2,4-cyclodiphosphate synthase: a target for antimicrobial therapy
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lyase
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
total genus 45
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3ernA00
4C8GA 3FPIA 2PMPA 3P0ZA 4C8EA 3IKEA 1IV4A 3QHDA 1U3LA 1T0AA 3ELCA 1KNJA 1IV2A 3F0FA 3K2XA 1VH8A 3EORA 3ESJA 3FBAA 3RE3A 1H47A 1W57A 3GHZA 1JY8A 3B6NA 3JVHA 1U43A 1U3PA 4C81A 3F0DA 2AMTA 2UZHA 3IKFA 1W55A 3ERNA 3F0EA 3F6MA 1JN1A 3F0GA 3IEWA 3K14A 4C8IA 4C82A 5B8FA 1H48A 3IEQA 3Q8HA 3P10A 1YQNA 1IV1A 3T80A 1KNKA 1GX1A 1VHAA 2GZLA 1IV3A 3KE1A 1U40A 3MBMA
chains in the Genus database with same CATH superfamily
4C4WC 1Z5VA 3E1YA 2G9IA 4ERHA 1T0AA 3VOAA 4BVTA 3CYQA 3EORA 3UT5B 4WBNB 5LOVA 2GVIA 3E20B 4O2BB 1VQLF 4I4TB 1U43A 3WGLA 1SDSA 3JAWA 3LWOC 3LWRC 2H6LA 2YYEA 5LA6B 4O4HA 1KQSF 4BT4A 4ZHQB 1TUBA 2K1SA 5IYZB 3TD4A 3SIVA 1FNKA 1UFYA 4IHJB 2FGYA 4WBNA 2QA4F 4DRXA 5JQGB 2OHWA 3HKCA 3WPXA 1XBIA 3TD5A 3CPWF 5CA0A 4NUTA 2F9ZC 4I50A 4G4YA 1W57A 2QEXF 3CD6F 3GHZA 1M90H 5C8YA 1JY8A 4IIJA 3N2KA 4EB6B 3P4EA 1RLGA 4DRXB 5JQGA 2Z1TA 3S02A 1PXWA 4O4LB 3HAXD 3OW2F 2EWCA 2N48A 3IEQA 4IHJA 3RYHA 3CC4F 1COMA 3I7TA 4X20A 3NVIB 1VHAA 1GX1A 3HKBA 3CCJF 1ZWZA 2RHHA 3NK7A 2VGNA 2UYPA 4I4TA 5EIBD 3K2XA 3R0PA 4TV8A 2CZWA 3ESJA 3RE3A 5C8YB 4PWTA 1H47A 4O2AB 4U39A 3QUWA 4EI8A 5FJ4C 3MDOA 1YJWF 4ZHYB 3CCVF 3NK6A 3KJKA 2W8BC 3C9UA 5JH7A 3CC2F 2HS4A 4ZHQA 1E7KA 3JASB 3FD5A 1Q8RA 3IKEA 3VO8A 2OZBA 2QI2A 5CA1A 2HX0A 2QTPA 2UYNA 2RHJA 3JARB 4O4LA 3JAKA 4ZHWA 3JVHA 2Z1UA 2KGWA 5LP6C 4XCQA 4ZHVA 3K14A 4O4JA 1W3EX 4RQOA 5HY2A 3F0GA 1XRGA 4I50B 3AGKA 3WXMB 1CLIA 3HTNA 1KNKA 3N2GB 5IJ9A 3HWUA 2LCAA 4G4VA 2WALA 3WPWA 5EIBC 5FNVB 5BMVA 3FPIA 2HS0A 5EYPA 1T0KB 3KIZA 3J7AR 1U3LA 1CN7A 4BVQA 2CW4A 4KWEA 5GAPK 1NMUB 1Q7YH 1K8AH 5HP7A 3K12A 3JALA 3S0YA 5B8FA 3WJPA 2OTMA 4FFBA 1SA0A 5HY0A 3HKDA 3S03A 2LBTA 1YQNA 2B33A 2H8EA 5EZYB 3CCEF 5LP6A 3C9RA 4B62A 3GTZA 2HRUA 1Z5WA 4BT7A 5LP6B 3V7EA 4F6RB 3VI6A 3PLAC 3O85A 3V4DA 4X1KB 1W59A 2RHLA 3CMEF 3CCQF 3VYTC 3VIUA 1GO1A 1SA0B 4ZI7A 5JVDB 3QTYA 2AIFA 3CYPB 3CCLF 1OAPA 5KX5A 1DBFA 1W2BF 3IKFA 3F0EA 5KX5B 1VQ4F 5G4VC 2R751 3PAFA 4C82A 4TV9B 4YJ3A 1W581 5LXTA 1Q86H 5JCOC 1VK3A 3P0ZA 4TUYB 1GO0A 2HRYA 1VQVA 3CMAF 1YITF 3N2KB 4EB6A 1VH8A 4I55B 1R1MA 3N2GA 3LMEA 3FD6A 4E6EA 3V7QA 2HQSC 1RQ7A 3ZP7A 3CPQA 4YJ2B 3MCAB 1X7PA 5EZYA 3VOBA 4BY9D 5J2TB 2KTUA 4TV9A 3JARA 4C8IA 1VQMF 1YIJF 3IR9A 3Q8HA 3DDNA 1RQ2A 5HY4A 5MN4A 4X1YB 5KMGB 5IT9M 3C8LA 3VMFB 2BO1A 1KC8H 2HVYD 4ZI7B 5LA6A 3WGNA 3ZO8A 3CC7F 4C8EA 1IV4A 3C9SA 5MN6A 3ELCA 1ODEA 3GYQA 3IMPA 3RYFB 2DYYA 3UT5A 4X3LA 3HKEA 3RA5A 1JFFA 4O4JB 3WJRA 3G4SF 2VAWA 3G6EF 3DC2A 4U3JA 1CK2A 4TUYA 3LDTA 2VAMA 4TV8B 5FLXM 3D54A 4X1IA 4ZOLA 5EB0A 2BTUA 3S06A 3JALB 1J7HA 4EI9A 5CA1B 4ZOLB 5IJ0B 2NMUA 2HP3A 3LWQC 3ON1A 2CHTA 3RYHB 4G88A 3WJQA 3F0FA 2OTJF 4RHAA 5DCVA 1N8RH 5HY1A 2IG8A 5GIPC 1M1KH 5IJ9B 3CCMF 5MN5A 1VQPF 4U3JB 1QVGF 5FNVA 4I55A 3IEWA 1RLUA 1IPAA 2OTLF 4LCKA 3LWPC 1YI2F 5LYJA 2H8CA 1W41A 3HKCB 3RYFA 5GINC 1FFXA 1Q82H 5AVMA 3LFOA 1RA4A 2VGMA 1X25A 2VXYA 1NJIH 4G4XA 3CCSF 4O4HB 5KMGA 3HKBB 1Q81H 1PF5A 1TUBB 2R6R1 1UI9A 5EAZA 2GLZA 2KG4A 4C81A 5HXZA 1X7OA 2ZAUA 1JN1A 2IAFA 1H7MA 5JCOA 3TD3A 1JFFB 2UYJA 1QU9A 3WGKA 5EB1B 3KE1A 3RYIA 2CSLA 2PMPA 5GONB 3ZP4A 4EI7A 4O4IB 1IV2A 2ZF8A 1VQ9F 3OBYA 3ZOPA 4NQ3A 4HNAB 3C9TA 3D00A 3I56F 2Z1EA 4HNAA 1NQ3A 3RYCB 4BT5A 2VAPA 2L26A 3P10A 4X1KA 4O2BA 3T80A 1W5FA 1IV3A 2BTOA 1U40A 2Z1FA 5J2UA 3JATB 4O4IA 1QVFF 1W5BA 1VQ7F 1FSZA 4YJ2A 5GIOC 4IIJB 2CWJA 3WGJA 2KTVA 2Q1XA 2CHSA 1K73H 1X52A 5EWRA 2LBWA 3B6NA 3N4YA 2RHOA 3LYBA 3KHNA 2UZHA 1YJ9F 3CG6A 1VQKF 1W42A 3KJJA 4TZZA 3L7QA 3SIUA 4X1IB 1XV2A 4NWOB 1IV1A 3CCRF 4G4ZA 3JASA 2V9YA 3LWVC 1JJ2F 5CB4B 2CVLA 1VQ5F 3M1XA 1SZQA 2YXZA 1FFXB 5BMVB 5EYPB 1XHOA 1KNJA 5LYJB 4F6RA 1VQ8F 2I6DA 3HKEB 5HP8A 3VYUC 4BVRA 2AMTA 3RA6A 4FFBB 3JATA 3WGMA 3M4SA 3HKDB 2LBXA 4G4WA 5IYZA 3D01A 3M84A 4BT2A 3U0OA 5CB4A 2UYNB 3E22A 5IJ0A 3MQWA 1DT9A 4C8GA 4ZK7A 5GANK 1YHQF 4DXDA 2BTQB 2ZVZA 3HJWC 2IQQA 3E22B 4B45A 3QHDA 3JAWB 4X20B 1JD1A 5A2QM 5JVDA 5LOVB 3JAMM 1W5AA 3S0HA 5GONA 3J80M 1U3PA 4BW0B 4LNUB 4R40B 2I6RA 2ALEA 4O2AA 1VQ6F 4LNUA 1GZ0A 2MQEA 5HWEA 1YJNF 3JCMM 3S0WA 3MBMA 1TVKA 5ITZB 3I55F 5LXTB 4B5CA 3CXCF 3N4ZA 4X1YA 3V3TA 3VYSC 3FBAA 2Z01A 3CCUF 3K0TA 4B46A 2DT4A 2FC3A 3OONA 2HS3A 3F0DA 5ITZA 3OBWA 5J2TA 3CB2A 1H48A 3I3FA 5G4UC 3RYIB 2GZLA 5CA0B 2ZVYA 3NMUC 2ZODA 2RB9A 2AIZP 4BT3A 1YGYA 5J2UB 2P6YA 2JNBA 2HP0B 2UYKA 1OFUA 2PHNA 3VCZA 1K9MH 1QAHA 3JAKB 3J81M 2ZOVA 4BT6A 4X3MA 3RYCA 5EO3A 4YJ3B 4BVSA 1ONIA 1S72F 2Q1YA 1KD1H 1W5EA 1FNJA 1TVKB 3FFMA 1W55A 3ERNA 3F6MA 3NVKE 3VTIC 1VQNF 2HP0A 3MCQA 5HXUA 5JH7B 3BYQA 4M8IA 1W40A 1VQOF 1QD9A 3G71F
chains in the Genus database with same CATH topology
4C8GA 3FPIA 2PMPA 3P0ZA 4C8EA 3IKEA 1IV4A 3QHDA 1U3LA 1T0AA 3ELCA 1KNJA 1IV2A 3F0FA 3K2XA 1VH8A 3EORA 3ESJA 3FBAA 3RE3A 1H47A 1W57A 3GHZA 1JY8A 3B6NA 3JVHA 1U43A 1U3PA 4C81A 3F0DA 2AMTA 2UZHA 3IKFA 1W55A 3ERNA 3F0EA 3F6MA 1JN1A 3F0GA 3IEWA 3K14A 4C8IA 4C82A 5B8FA 1H48A 3IEQA 3Q8HA 3P10A 1YQNA 1IV1A 3T80A 1KNKA 1GX1A 1VHAA 2GZLA 1IV3A 3KE1A 1U40A 3MBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8G A;  3FPI A;  2PMP A;  3P0Z A;  4C8E A;  3IKE A;  1IV4 A;  3QHD A;  1U3L A;  1T0A A;  3ELC A;  1KNJ A;  1IV2 A;  3F0F A;  3K2X A;  1VH8 A;  3EOR A;  3ESJ A;  3FBA A;  3RE3 A;  1H47 A;  1W57 A;  3GHZ A;  1JY8 A;  3B6N A;  3JVH A;  1U43 A;  1U3P A;  4C81 A;  3F0D A;  2AMT A;  2UZH A;  3IKF A;  1W55 A;  3ERN A;  3F0E A;  3F6M A;  1JN1 A;  3F0G A;  3IEW A;  3K14 A;  4C8I A;  4C82 A;  5B8F A;  1H48 A;  3IEQ A;  3Q8H A;  3P10 A;  1YQN A;  1IV1 A;  3T80 A;  1KNK A;  1GX1 A;  1VHA A;  2GZL A;  1IV3 A;  3KE1 A;  1U40 A;  3MBM A; 
#chains in the Genus database with same CATH topology
 4C4W C;  1Z5V A;  3E1Y A;  2G9I A;  4ERH A;  1T0A A;  3VOA A;  4BVT A;  3CYQ A;  3EOR A;  3UT5 B;  4WBN B;  5LOV A;  2GVI A;  3E20 B;  4O2B B;  1VQL F;  4I4T B;  1U43 A;  3WGL A;  1SDS A;  3JAW A;  3LWO C;  3LWR C;  2H6L A;  2YYE A;  5LA6 B;  4O4H A;  1KQS F;  4BT4 A;  4ZHQ B;  1TUB A;  2K1S A;  5IYZ B;  3TD4 A;  3SIV A;  1FNK A;  1UFY A;  4IHJ B;  2FGY A;  4WBN A;  2QA4 F;  4DRX A;  5JQG B;  2OHW A;  3HKC A;  3WPX A;  1XBI A;  3TD5 A;  3CPW F;  5CA0 A;  4NUT A;  2F9Z C;  4I50 A;  4G4Y A;  1W57 A;  2QEX F;  3CD6 F;  3GHZ A;  1M90 H;  5C8Y A;  1JY8 A;  4IIJ A;  3N2K A;  4EB6 B;  3P4E A;  1RLG A;  4DRX B;  5JQG A;  2Z1T A;  3S02 A;  1PXW A;  4O4L B;  3HAX D;  3OW2 F;  2EWC A;  2N48 A;  3IEQ A;  4IHJ A;  3RYH A;  3CC4 F;  1COM A;  3I7T A;  4X20 A;  3NVI B;  1VHA A;  1GX1 A;  3HKB A;  3CCJ F;  1ZWZ A;  2RHH A;  3NK7 A;  2VGN A;  2UYP A;  4I4T A;  5EIB D;  3K2X A;  3R0P A;  4TV8 A;  2CZW A;  3ESJ A;  3RE3 A;  5C8Y B;  4PWT A;  1H47 A;  4O2A B;  4U39 A;  3QUW A;  4EI8 A;  5FJ4 C;  3MDO A;  1YJW F;  4ZHY B;  3CCV F;  3NK6 A;  3KJK A;  2W8B C;  3C9U A;  5JH7 A;  3CC2 F;  2HS4 A;  4ZHQ A;  1E7K A;  3JAS B;  3FD5 A;  1Q8R A;  3IKE A;  3VO8 A;  2OZB A;  2QI2 A;  5CA1 A;  2HX0 A;  2QTP A;  2UYN A;  2RHJ A;  3JAR B;  4O4L A;  3JAK A;  4ZHW A;  3JVH A;  2Z1U A;  2KGW A;  5LP6 C;  4XCQ A;  4ZHV A;  3K14 A;  4O4J A;  1W3E X;  4RQO A;  5HY2 A;  3F0G A;  1XRG A;  4I50 B;  3AGK A;  3WXM B;  1CLI A;  3HTN A;  1KNK A;  3N2G B;  5IJ9 A;  3HWU A;  2LCA A;  4G4V A;  2WAL A;  3WPW A;  5EIB C;  5FNV B;  5BMV A;  3FPI A;  2HS0 A;  5EYP A;  1T0K B;  3KIZ A;  3J7A R;  1U3L A;  1CN7 A;  4BVQ A;  2CW4 A;  4KWE A;  5GAP K;  1NMU B;  1Q7Y H;  1K8A H;  5HP7 A;  3K12 A;  3JAL A;  3S0Y A;  5B8F A;  3WJP A;  2OTM A;  4FFB A;  1SA0 A;  5HY0 A;  3HKD A;  3S03 A;  2LBT A;  1YQN A;  2B33 A;  2H8E A;  5EZY B;  3CCE F;  5LP6 A;  3C9R A;  4B62 A;  3GTZ A;  2HRU A;  1Z5W A;  4BT7 A;  5LP6 B;  3V7E A;  4F6R B;  3VI6 A;  3PLA C;  3O85 A;  3V4D A;  4X1K B;  1W59 A;  2RHL A;  3CME F;  3CCQ F;  3VYT C;  3VIU A;  1GO1 A;  1SA0 B;  4ZI7 A;  5JVD B;  3QTY A;  2AIF A;  3CYP B;  3CCL F;  1OAP A;  5KX5 A;  1DBF A;  1W2B F;  3IKF A;  3F0E A;  5KX5 B;  1VQ4 F;  5G4V C;  2R75 1;  3PAF A;  4C82 A;  4TV9 B;  4YJ3 A;  1W58 1;  5LXT A;  1Q86 H;  5JCO C;  1VK3 A;  3P0Z A;  4TUY B;  1GO0 A;  2HRY A;  1VQV A;  3CMA F;  1YIT F;  3N2K B;  4EB6 A;  1VH8 A;  4I55 B;  1R1M A;  3N2G A;  3LME A;  3FD6 A;  4E6E A;  3V7Q A;  2HQS C;  1RQ7 A;  3ZP7 A;  3CPQ A;  4YJ2 B;  3MCA B;  1X7P A;  5EZY A;  3VOB A;  4BY9 D;  5J2T B;  2KTU A;  4TV9 A;  3JAR A;  4C8I A;  1VQM F;  1YIJ F;  3IR9 A;  3Q8H A;  3DDN A;  1RQ2 A;  5HY4 A;  5MN4 A;  4X1Y B;  5KMG B;  5IT9 M;  3C8L A;  3VMF B;  2BO1 A;  1KC8 H;  2HVY D;  4ZI7 B;  5LA6 A;  3WGN A;  3ZO8 A;  3CC7 F;  4C8E A;  1IV4 A;  3C9S A;  5MN6 A;  3ELC A;  1ODE A;  3GYQ A;  3IMP A;  3RYF B;  2DYY A;  3UT5 A;  4X3L A;  3HKE A;  3RA5 A;  1JFF A;  4O4J B;  3WJR A;  3G4S F;  2VAW A;  3G6E F;  3DC2 A;  4U3J A;  1CK2 A;  4TUY A;  3LDT A;  2VAM A;  4TV8 B;  5FLX M;  3D54 A;  4X1I A;  4ZOL A;  5EB0 A;  2BTU A;  3S06 A;  3JAL B;  1J7H A;  4EI9 A;  5CA1 B;  4ZOL B;  5IJ0 B;  2NMU A;  2HP3 A;  3LWQ C;  3ON1 A;  2CHT A;  3RYH B;  4G88 A;  3WJQ A;  3F0F A;  2OTJ F;  4RHA A;  5DCV A;  1N8R H;  5HY1 A;  2IG8 A;  5GIP C;  1M1K H;  5IJ9 B;  3CCM F;  5MN5 A;  1VQP F;  4U3J B;  1QVG F;  5FNV A;  4I55 A;  3IEW A;  1RLU A;  1IPA A;  2OTL F;  4LCK A;  3LWP C;  1YI2 F;  5LYJ A;  2H8C A;  1W41 A;  3HKC B;  3RYF A;  5GIN C;  1FFX A;  1Q82 H;  5AVM A;  3LFO A;  1RA4 A;  2VGM A;  1X25 A;  2VXY A;  1NJI H;  4G4X A;  3CCS F;  4O4H B;  5KMG A;  3HKB B;  1Q81 H;  1PF5 A;  1TUB B;  2R6R 1;  1UI9 A;  5EAZ A;  2GLZ A;  2KG4 A;  4C81 A;  5HXZ A;  1X7O A;  2ZAU A;  1JN1 A;  2IAF A;  1H7M A;  5JCO A;  3TD3 A;  1JFF B;  2UYJ A;  1QU9 A;  3WGK A;  5EB1 B;  3KE1 A;  3RYI A;  2CSL A;  2PMP A;  5GON B;  3ZP4 A;  4EI7 A;  4O4I B;  1IV2 A;  2ZF8 A;  1VQ9 F;  3OBY A;  3ZOP A;  4NQ3 A;  4HNA B;  3C9T A;  3D00 A;  3I56 F;  2Z1E A;  4HNA A;  1NQ3 A;  3RYC B;  4BT5 A;  2VAP A;  2L26 A;  3P10 A;  4X1K A;  4O2B A;  3T80 A;  1W5F A;  1IV3 A;  2BTO A;  1U40 A;  2Z1F A;  5J2U A;  3JAT B;  4O4I A;  1QVF F;  1W5B A;  1VQ7 F;  1FSZ A;  4YJ2 A;  5GIO C;  4IIJ B;  2CWJ A;  3WGJ A;  2KTV A;  2Q1X A;  2CHS A;  1K73 H;  1X52 A;  5EWR A;  2LBW A;  3B6N A;  3N4Y A;  2RHO A;  3LYB A;  3KHN A;  2UZH A;  1YJ9 F;  3CG6 A;  1VQK F;  1W42 A;  3KJJ A;  4TZZ A;  3L7Q A;  3SIU A;  4X1I B;  1XV2 A;  4NWO B;  1IV1 A;  3CCR F;  4G4Z A;  3JAS A;  2V9Y A;  3LWV C;  1JJ2 F;  5CB4 B;  2CVL A;  1VQ5 F;  3M1X A;  1SZQ A;  2YXZ A;  1FFX B;  5BMV B;  5EYP B;  1XHO A;  1KNJ A;  5LYJ B;  4F6R A;  1VQ8 F;  2I6D A;  3HKE B;  5HP8 A;  3VYU C;  4BVR A;  2AMT A;  3RA6 A;  4FFB B;  3JAT A;  3WGM A;  3M4S A;  3HKD B;  2LBX A;  4G4W A;  5IYZ A;  3D01 A;  3M84 A;  4BT2 A;  3U0O A;  5CB4 A;  2UYN B;  3E22 A;  5IJ0 A;  3MQW A;  1DT9 A;  4C8G A;  4ZK7 A;  5GAN K;  1YHQ F;  4DXD A;  2BTQ B;  2ZVZ A;  3HJW C;  2IQQ A;  3E22 B;  4B45 A;  3QHD A;  3JAW B;  4X20 B;  1JD1 A;  5A2Q M;  5JVD A;  5LOV B;  3JAM M;  1W5A A;  3S0H A;  5GON A;  3J80 M;  1U3P A;  4BW0 B;  4LNU B;  4R40 B;  2I6R A;  2ALE A;  4O2A A;  1VQ6 F;  4LNU A;  1GZ0 A;  2MQE A;  5HWE A;  1YJN F;  3JCM M;  3S0W A;  3MBM A;  1TVK A;  5ITZ B;  3I55 F;  5LXT B;  4B5C A;  3CXC F;  3N4Z A;  4X1Y A;  3V3T A;  3VYS C;  3FBA A;  2Z01 A;  3CCU F;  3K0T A;  4B46 A;  2DT4 A;  2FC3 A;  3OON A;  2HS3 A;  3F0D A;  5ITZ A;  3OBW A;  5J2T A;  3CB2 A;  1H48 A;  3I3F A;  5G4U C;  3RYI B;  2GZL A;  5CA0 B;  2ZVY A;  3NMU C;  2ZOD A;  2RB9 A;  2AIZ P;  4BT3 A;  1YGY A;  5J2U B;  2P6Y A;  2JNB A;  2HP0 B;  2UYK A;  1OFU A;  2PHN A;  3VCZ A;  1K9M H;  1QAH A;  3JAK B;  3J81 M;  2ZOV A;  4BT6 A;  4X3M A;  3RYC A;  5EO3 A;  4YJ3 B;  4BVS A;  1ONI A;  1S72 F;  2Q1Y A;  1KD1 H;  1W5E A;  1FNJ A;  1TVK B;  3FFM A;  1W55 A;  3ERN A;  3F6M A;  3NVK E;  3VTI C;  1VQN F;  2HP0 A;  3MCQ A;  5HXU A;  5JH7 B;  3BYQ A;  4M8I A;  1W40 A;  1VQO F;  1QD9 A;  3G71 F; 
#chains in the Genus database with same CATH homology
 4C8G A;  3FPI A;  2PMP A;  3P0Z A;  4C8E A;  3IKE A;  1IV4 A;  3QHD A;  1U3L A;  1T0A A;  3ELC A;  1KNJ A;  1IV2 A;  3F0F A;  3K2X A;  1VH8 A;  3EOR A;  3ESJ A;  3FBA A;  3RE3 A;  1H47 A;  1W57 A;  3GHZ A;  1JY8 A;  3B6N A;  3JVH A;  1U43 A;  1U3P A;  4C81 A;  3F0D A;  2AMT A;  2UZH A;  3IKF A;  1W55 A;  3ERN A;  3F0E A;  3F6M A;  1JN1 A;  3F0G A;  3IEW A;  3K14 A;  4C8I A;  4C82 A;  5B8F A;  1H48 A;  3IEQ A;  3Q8H A;  3P10 A;  1YQN A;  1IV1 A;  3T80 A;  1KNK A;  1GX1 A;  1VHA A;  2GZL A;  1IV3 A;  3KE1 A;  1U40 A;  3MBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...